NONHSAT124922
Revision as of 21:58, 25 July 2014 by 124.16.129.48 (talk) (Created page with "Please input one-sentence summary here.
==Annotated Information==
===Transcriptomic Nomeclature===
Please input transcriptomic nomeclature information here.
===Functio...")
Please input one-sentence summary here.
Contents
Annotated Information
Transcriptomic Nomeclature
Please input transcriptomic nomeclature information here.
Function
Please input function information here.
Regulation
Please input regulation information here.
Expression
Please input expression information here.
Allelic Information and Variation
Please input allelic information and variation information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this lncRNA
Please input related labs here.
References
Please input cited references here.
Basic Information
Transcript ID |
NONHSAT124922 |
Source |
NONCODE4.0 |
Same with |
, |
Classification |
intergenic |
Length |
1796 nt |
Genomic location |
chr8+:9045788..9051405 |
Exon number |
2 |
Exons |
9045788..9047096,9050919..9051405 |
Genome context |
|
Sequence |
000001 agagtcttct ggagggacat tacaaataat caggcactcc cagtgctggg agctaagttc tgttacaggg aagagaaaga 000080
000081 aacaatggga ataccaagga ggatatttac agagggggaa ggctttgagc tgaaattgaa cggtgaataa aggctgagca 000160 000161 gccatggtga gatgggggga gactcttctg aatggtgtgg tggcggaagt gggggtgggg gggatgcaac agtcttgttg 000240 000241 gactggaaca tagAGTTCAA ATGGCGGAAT TTCAGAGCTT TGACGCTCTA CTATTAAGAA GGTCCAGCAA GTTCTGCCGT 000320 000321 GAACAGTTGT GCTCATAGct agctgtgtga tcttgaacaa gtttctttgt ctccaaaacc tagttttgtt acaggtagat 000400 000401 aggcaagagt gggctctccc ccgacgcact agaaatgtcg gatgacagtt ccacagttat cgcattgcct ctctaaaaat 000480 000481 cataattcag cagccaggga gagacaatct cctgatggtc cataaccttg acattaaaag tgttaactga atacagatcc 000560 000561 cagggagaag cagattcttg ggcatgtgtg ttaagagata aaatggcaaa gtatgacttt ccggggtaca cgccacagga 000640 000641 aaaaggaaaa agtctcaggt gggcatgcgt gtaactccct aaacgcactg cgcgtgctca attccaaagg ctaaggaaag 000720 000721 cattgcgcat gcgggaaacc cacgctgagg gaagaatcat gggaaagagg tgagcctgta aagttttagg atcaaggtta 000800 000801 aaggcccttt tttgctctct tctctcttgg accttcaggc gacggcttgg gtatcttcca agcgaatttt cctttctttc 000880 000881 ctgttctttt ttttttttga gacggagtct tgctctgtcg cccaggctgg agtgcagtgg cgtgatgtcg gctcactgca 000960 000961 agctccgcct cccgggttca cgccattctc ctgcttcagc ctcctgagta gctggggcta caggcgcccg ccaccacgcc 001040 001041 cggctaattt ttttgtattt ttttttttag tagagacggg gttccaccgt gttagccagg atggtctcga tttcctgacc 001120 001121 tcgtcatcct cccgccttgg cctcccaaag tgctgggatt acaggcttga gccaccgcgc cccgctcttt cgtgttccaa 001200 001201 aggcttttta aataaacttc cactcctgtc ctggattctg ctttatggcc ctcagtcgaa ttctttcttc tgaggaggca 001280 001281 aggactgaag ttgcttctga ccagtacagg attgggaagg agaaagtcac ttgactcaca ggccaactgc tatggactga 001360 001361 attgtgtctt cccctcatta atatgttgaa accctatcct ccctccaatg tgatggtatt tgcagatggg gcttttggga 001440 001441 agtaatgaag tttagatgag gcatgagggc tggatggata tgatcagatg agtgcccaaa gaagagacac cagagagcta 001520 001521 gcttcttctt tctctttcca cctttacaca ctgagaaaag gccaagtgag cacacaccaa gaaggcagcc atctgcaaac 001600 001601 ccaaggagag agtcctcact agacaccctg ctggtacctt gatcttggac ttctagcctc cagaactgtg agaaataaat 001680 001681 tcctgttgtt caagctagta ttaatacctg gtgttttgtt atggcagcct aagtgactaa gacaccaact taatttactt 001760 001761 agccagggtc aatcagtggt agggcccagg attctg |
Predicted Small Protein
Name | NONHSAT124922_smProtein_191:337 |
Length | 49 |
Molecular weight | 5733.6151 |
Aromaticity | 0.145833333333 |
Instability index | 54.69375 |
Isoelectric point | 9.14849853516 |
Runs | 9 |
Runs residual | 0.0219298245614 |
Runs probability | 0.0374197727139 |
Amino acid sequence | MVWWRKWGWGGCNSLVGLEHRVQMAEFQSFDALLLRRSSKFCREQLCS |
Secondary structure | LEEEEELLLLLLLLHHHHHHHHHHHHHHLHHHHHHHHLHHHHHHHHLL |
PRMN | - |
PiMo | - |