RiceWiki - User contributions [en]

Os09g0466400

2014-05-29T02:13:35Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (LOC_Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells[1].

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. We also speculated that it was involved in panicle development(Fig. 1k)[1].

[[File:Example.jpg]]

===Brief introduction to ZF-HD transcription factor gene family===
In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==
Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

You can also add sub-section(s) at will.

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University..

==References==

[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{JaponicaGene|
GeneName = OsZHD1|
Description = Similar to ZF-HD homeobox protein|
Version = NM_001069954.1 GI:115479650 GeneID:4347315|
Length = 1169 bp|
Definition = Oryza sativa Japonica Group Os09g0466400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:18357788..18358956|
CDS = 18358047..18358886|
GCID = <gbrowseImage1>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatga</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIG SRVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNF HRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAA AAGGYPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRF RTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK KLP</aaseq>|
DNA = <dnaseqindica>71..910#aagtgttttcctagctaggtagctagctagctagacaagcttgccggccggccggccggcgacggcgaccatggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatgaccgggagcaaatgcatttgatctcatcgtcggcatgcatgaccaagttgtgggacgacgcatgcatccatgtccatcccaagctagctgagctgatcgaccggccgtggcttagccacccggaccccggtatggtaggtacctgaaccttatttatttagagttggacttaattaattggtggcttaggttaatctgtagcaagagagactgagagagcattcgttctcggctctagtaggtggttctttcttcttttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069954.1 RefSeq:Os09g0466400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 9]]
[[Category:Chromosome 9]]

File:Example.jpg

2014-05-29T02:13:02Z

马爱民: uploaded a new version of "File:Example.jpg": Reverted to version as of 05:46, 28 May 2014

Os09g0466400

2014-05-29T02:07:42Z

马爱民: /* Structured Information */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (LOC_Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells[1].

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. We also speculated that it was involved in panicle development(Fig. 1k)[1].

[[File:mam1234]]

===Brief introduction to ZF-HD transcription factor gene family===
In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==
Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

You can also add sub-section(s) at will.

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University..

==References==

[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{JaponicaGene|
GeneName = OsZHD1|
Description = Similar to ZF-HD homeobox protein|
Version = NM_001069954.1 GI:115479650 GeneID:4347315|
Length = 1169 bp|
Definition = Oryza sativa Japonica Group Os09g0466400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:18357788..18358956|
CDS = 18358047..18358886|
GCID = <gbrowseImage1>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatga</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIG SRVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNF HRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAA AAGGYPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRF RTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK KLP</aaseq>|
DNA = <dnaseqindica>71..910#aagtgttttcctagctaggtagctagctagctagacaagcttgccggccggccggccggcgacggcgaccatggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatgaccgggagcaaatgcatttgatctcatcgtcggcatgcatgaccaagttgtgggacgacgcatgcatccatgtccatcccaagctagctgagctgatcgaccggccgtggcttagccacccggaccccggtatggtaggtacctgaaccttatttatttagagttggacttaattaattggtggcttaggttaatctgtagcaagagagactgagagagcattcgttctcggctctagtaggtggttctttcttcttttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069954.1 RefSeq:Os09g0466400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 9]]
[[Category:Chromosome 9]]

Os09g0466400

2014-05-29T02:04:11Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (LOC_Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells[1].

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. We also speculated that it was involved in panicle development(Fig. 1k)[1].

[[File:mam1234]]

===Brief introduction to ZF-HD transcription factor gene family===
In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==
Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

You can also add sub-section(s) at will.

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University..

==References==

[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{JaponicaGene|
GeneName = Os09g0466400|
Description = Similar to ZF-HD homeobox protein|
Version = NM_001069954.1 GI:115479650 GeneID:4347315|
Length = 1169 bp|
Definition = Oryza sativa Japonica Group Os09g0466400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:18357788..18358956|
CDS = 18358047..18358886|
GCID = <gbrowseImage1>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatga</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIG SRVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNF HRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAA AAGGYPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRF RTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK KLP</aaseq>|
DNA = <dnaseqindica>71..910#aagtgttttcctagctaggtagctagctagctagacaagcttgccggccggccggccggcgacggcgaccatggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatgaccgggagcaaatgcatttgatctcatcgtcggcatgcatgaccaagttgtgggacgacgcatgcatccatgtccatcccaagctagctgagctgatcgaccggccgtggcttagccacccggaccccggtatggtaggtacctgaaccttatttatttagagttggacttaattaattggtggcttaggttaatctgtagcaagagagactgagagagcattcgttctcggctctagtaggtggttctttcttcttttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069954.1 RefSeq:Os09g0466400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 9]]
[[Category:Chromosome 9]]

Os09g0466400

2014-05-29T01:56:27Z

马爱民: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (LOC_Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells[1].

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. We also speculated that it was involved in panicle development(Fig. 1k)[1].

[[File:mam123]]

===Brief introduction to ZF-HD transcription factor gene family===
In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==
Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

You can also add sub-section(s) at will.

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University..

==References==

[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{JaponicaGene|
GeneName = Os09g0466400|
Description = Similar to ZF-HD homeobox protein|
Version = NM_001069954.1 GI:115479650 GeneID:4347315|
Length = 1169 bp|
Definition = Oryza sativa Japonica Group Os09g0466400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:18357788..18358956|
CDS = 18358047..18358886|
GCID = <gbrowseImage1>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008402:18357788..18358956
source=RiceChromosome09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatga</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIG SRVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNF HRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAA AAGGYPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRF RTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGK KLP</aaseq>|
DNA = <dnaseqindica>71..910#aagtgttttcctagctaggtagctagctagctagacaagcttgccggccggccggccggcgacggcgaccatggacttcgatgaccatgacgacggcgacgaggagatgccgccgatgccggtgagctcgagctacgagactccgccgcagcatggccttgccggcggtgggatggcgcccaagcctcctggtgagattggcagccgtgtgaagggccccagctgcggtggcggcaggtaccgcgagtgcctcaagaaccacgcggttggcatcggcggccacgccgtggacggctgcggcgagttcatggcggccggcgaggagggcaccatcgacgcgctccgctgcgccgcgtgcaactgccaccgcaacttccaccggaaggagtccgagtcgcttgccggcgagggctcgcccttctccccggccgccgtcgtcccctacggcgccacgccgcaccaccagttctccccgtactaccgcacccctgccggttacctccaccaccaccagcaccacatggccgcggcagccgcggccgccgccgccgcagccggcggctacccgcagcggcccctcgcgctcccgtccacctcccacagcggccgcgacgacggcgacgacctgtccgggatggtggggcccatgtcggcggtggggccgctcagcggcatgtccctcggcgccggcccgtccggctccggctccggcaagaagcggttccgcaccaagttcacccaggagcagaaggacaagatgctggcgttcgccgagcgcgtcgggtggcgcatccagaagcacgacgaggccgccgtgcagcagttctgtgacgaggtcggcgtcaagcgccacgtgctcaaggtgtggatgcacaacaacaagcacaccctgggcaagaagctgccatgaccgggagcaaatgcatttgatctcatcgtcggcatgcatgaccaagttgtgggacgacgcatgcatccatgtccatcccaagctagctgagctgatcgaccggccgtggcttagccacccggaccccggtatggtaggtacctgaaccttatttatttagagttggacttaattaattggtggcttaggttaatctgtagcaagagagactgagagagcattcgttctcggctctagtaggtggttctttcttcttttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069954.1 RefSeq:Os09g0466400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 9]]
[[Category:Chromosome 9]]

Os09g0466400

2014-05-29T01:52:48Z

马爱民: /* Function */

BGIOSGA029617

2014-05-28T09:17:59Z

马爱民: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (LOC_Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

[[File:mam123.jpg]]

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T06:01:43Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

[[File:mam123.jpg]]

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

File:Mam123.jpg

2014-05-28T06:01:16Z

马爱民: Fig. 1 Expression pattern of OsZHD1. a. qRT-PCR of OsZHD1 transcription levels in different organs in WT. GUS activity was detected in GUS lines root (b), seedling (c), leaf sheath (d), leaf blade (e), glumes of young panicle (h) and flowering spikes (i),

Fig. 1 Expression pattern of OsZHD1. a. qRT-PCR of OsZHD1 transcription levels in different organs in WT. GUS activity was detected in GUS lines root (b), seedling (c), leaf sheath (d), leaf blade (e), glumes of young panicle (h) and flowering spikes (i), while not in negative line leaf blade (f), glumes of young panicle (g). qRT-PCR analysis of OsZHD1 expression in WT developing leaves (j) and developing panicles (k).

BGIOSGA029617

2014-05-28T05:59:40Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.
[[File:mam123.jpg]]

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

File:Example.jpg

2014-05-28T05:59:06Z

马爱民: uploaded a new version of "File:Example.jpg": Fig. 1 Expression pattern of OsZHD1. a. qRT-PCR of OsZHD1 transcription levels in different organs in WT. GUS activity was detected in GUS lines root (b), seedling (c), leaf sheath (d), leaf blad

BGIOSGA029617

2014-05-28T05:57:07Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.
[[File:123.jpg]]

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

File:Example.jpg

2014-05-28T05:56:09Z

马爱民: uploaded a new version of "File:Example.jpg": Reverted to version as of 05:54, 28 May 2014

File:Example.jpg

2014-05-28T05:55:10Z

马爱民: uploaded a new version of "File:Example.jpg": Reverted to version as of 05:46, 28 May 2014

File:Example.jpg

2014-05-28T05:54:58Z

马爱民: uploaded a new version of "File:Example.jpg": Reverted to version as of 05:46, 28 May 2014

File:Example.jpg

2014-05-28T05:54:30Z

马爱民: uploaded a new version of "File:Example.jpg": Reverted to version as of 05:46, 28 May 2014

File:Example.jpg

2014-05-28T05:54:13Z

马爱民: uploaded a new version of "File:Example.jpg": 123.jpg

BGIOSGA029617

2014-05-28T05:52:10Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.
[[File:Example.jpg]]

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:49:59Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

File:Example.jpg

2014-05-28T05:46:07Z

BGIOSGA029617

2014-05-28T05:43:14Z

马爱民: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.
[[File:Example.jpg]]

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:34:27Z

马爱民: /* Structured Information */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = ''OsZHD1''|
Description =Zinc finger homeobox transcription factor|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:33:08Z

马爱民: /* Structured Information */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = BGIOSGA029617|
Description = ''OsZHD1''|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:30:36Z

马爱民: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.

[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.

[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.

[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.

[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.

[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = BGIOSGA029617|
Description = Putative uncharacterized protein|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:30:09Z

马爱民: /* ZF-HD members in rice */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group

LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group

BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.
[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.
[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.
[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.
[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.
[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = BGIOSGA029617|
Description = Putative uncharacterized protein|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:29:53Z

马爱民: /* ZF-HD members in rice */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group
LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1

Indica Group
BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.
[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.
[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.
[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.
[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.
[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = BGIOSGA029617|
Description = Putative uncharacterized protein|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:28:46Z

马爱民: /* Annotated Information */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

== Brief introduction to ZF-HD transcription factor gene family ==

In plant, the Zn finger homeodomain protein (ZF-HD) which is a class of homeobox TFs was first characterized in Flaveria trinervia (Asteraceae) by the presence of two highly conserved zinc finger-like motifs upstream of a HD[2]. To distinguish it from the unrelated zinc finger class of HD proteins, called ZF, found in animals[3], “PLINC” is proposed to be nominated as plant zinc finger[4].
Expression of PLINC genes is inducible by dehydration, salt stress and abscisic acid[5]. Microarray analysis of transgenic plants overexpressing PLINC gene revealed that several stress-inducible genes were upregulated, and these transgenic plants exhibited a strong drought-tolerant phenotype. Expression of two soybean PLINC proteins has been shown to be induced by pathogen stimulation[6]. These findings suggest that PLINC proteins play an important role against abiotic stress responses.
PLINC genes are found in flowering plants, Selaginella and moss but not in unicellular green algae or in red algae[4], suggesting that this class originated within the Streptophyta clade and that it was already present in the last common ancestor of moss and vascular plants.

== ZF-HD members in rice ==

Japonica Group
LOC_Os01g44430.1 LOC_Os02g47770.1 LOC_Os03g50920.1 LOC_Os04g35500.1
LOC_Os05g50310.1 LOC_Os06g23030.1 LOC_Os08g34010.1 LOC_Os08g37400.1
LOC_Os09g24810.1 LOC_Os09g24820.1 LOC_Os09g29130.1 LOC_Os11g03420.1
LOC_Os11g13930.1 LOC_Os12g03110.1 LOC_Os12g10630.1
Indica Group
BGIOSGA00115 BGIOSGA005769 BGIOSGA013464 BGIOSGA015067
BGIOSGA015069 BGIOSGA020427 BGIOSGA026798 BGIOSGA026924
BGIOSGA028731 BGIOSGA029617 BGIOSGA029765 BGIOSGA030752
BGIOSGA034224 BGIOSGA034718 BGIOSGA036923

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.
[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.
[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.
[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.
[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.
[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = BGIOSGA029617|
Description = Putative uncharacterized protein|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:26:38Z

马爱民: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Leaf rolling is considered as an important agronomic trait in rice (Oryza sativa L.), but little is known on the molecular mechanism of rice leaf rolling. OsZHD1 (Os09g29130) encodes a ZF-HD class homeobox transcription factor, and its overexpression is responsible for a novel abaxially curled and drooping leaf mutant Abaxially Curled and drooping Leaf-Dominant (ACL-D). Histological analysis indicated that the number of bulliform cells was increased in both ACL-D and OsZHD1 artificial overexpression lines. Moreover, the arrangement of bulliform cells became abnormal. These results demonstrated that OsZHD1 plays an important role in rice morphogenesis, especially the formation and distribution of bulliform cells

===Expression===
qRT -PCR analysis revealed the expression of OsZHD1 in various tissues, including 14-day-old green seedlings, mature leaf blade, leaf sheath, internode, node, pulvinus, root, and young panicle, with relatively high expression in seedlings and leaf sheath (Fig. 1a). Furthermore, the β-glucuronidase (GUS) activity could be detected in the root, seedlings, leaf sheath, pulvinus, leaf blade, and spikelet in transgenic plants carrying an OsZHD1 promoter-GUS reporter gene, the GUS activity of both root and young spikelet was obviously weaker than other tissues, which was consistent with the result of qRT-PCR. The expression of OsZHD1 increased as leaf development processed (Fig. 1j), suggesting that it might have an important function in leaf development. It was also speculated that it was involved in panicle development.

==Labs working on this gene==
National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University.

==References==
[1] Xu Y, Wang Y H, Long Q Z, et al. Overexpression of OsZHD1, a zinc finger homeodomain class homeobox transcription factor, induces abaxially curled and drooping leaf in rice[J]. Planta, 2014, 239: 803-816.
[2] Windhovel A, Hein I, Dabrowa R, Stockhaus J. Characterization of a novel class of plant homeodomain proteins that bind to the C4 phosphoenolpyruvate carboxylase gene of Flaveria trinervia[J]. Plant molecular biology, 2001, 45(2): 201-214.
[3] Bürglin T R. A comprehensive classification of homeobox genes[M]. In: Duboule D (ed) Guidebook to the homeobox genes. pp. 25-71. Oxford: Oxford University Press.
[4] Mukherjee K, Brocchieri L, Burglin T R. A comprehensive classification and evolutionary analysis of plant homeobox genes[J]. Molecular biology and evolution, 2009, 26(12):2775-2794.
[5] Tran L S, Nakashima K, Sakuma Y, et al. Co-expression of the stress-inducible zinc finger homeodomain ZFHD1 and NAC transcription factors enhances expression of the ERD1 gene in Arabidopsis[J]. The plant journal, 2007, 49(1): 46-63.
[6] Park H C, Kim M L, Lee S M, et al. Pathogen-induced binding of the soybean zinc finger homeodomain proteins GmZF-HD1 and GmZF-HD2 to two repeats of ATTA homeodomain binding site in the calmodulin isoform 4 (GmCaM4) promoter[J]. Nucleic Acids Research, 2007, 35(11): 3612-3623.

==Structured Information==
{{IndicaGene|
GeneName = BGIOSGA029617|
Description = Putative uncharacterized protein|
Definition = Oryza sativa Indica Group BGIOSGA029617, complete gene.|
tag = OJ1005_D12.28|
tid = BGIOSGA029617-TA|
pid = BGIOSGA029617-PA|
Length = 840|
Source = Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Indica Chromosome 9|Chromosome 9]]|
AP = Chromosome 9:16349452..16350291|
CDS = 16349452..16350291|
GCID = <gbrowseImage1>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=IndicaChromosome09:16349452..16350291
source=RiceIndica09
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</cdnaseq>|
AA = <aaseq>MDFDDHDDGDEEMPPMPVSSSYETPPQHGLAGGGMAPKPPGEIGSHVKGPSCGGGRYRECLKNHAVGIGGHAVDGCGEFMAAGEEGTIDALRCAACNCHRNFHRKESESLAGEGSPFSPAAVVPYGATPHHQFSPYYRTPAGYLHHHQHHMAAAAAAAAAAAGGHPQRPLALPSTSHSGRDDGDDLSGMVGPMSAVGPLSGMSLGAGPSGSGSGKKRFRTKFTQEQKDKMLAFAERVGWRIQKHDEAAVQQFCDEVGVKRHVLKVWMHNNKHTLGKKLP</aaseq>|
DNA = <dnaseqindica>1..840#ATGGACTTCGATGACCATGACGACGGCGACGAGGAGATGCCGCCGATGCCGGTGAGCTCGAGCTACGAGACTCCGCCGCAGCATGGCCTTGCCGGCGGTGGGATGGCGCCCAAGCCTCCTGGTGAGATTGGCAGCCATGTGAAGGGCCCCAGCTGCGGTGGCGGCAGGTACCGCGAGTGCCTCAAGAACCACGCGGTTGGCATCGGCGGCCACGCCGTGGACGGCTGCGGCGAGTTCATGGCGGCCGGCGAGGAGGGCACCATCGACGCGCTCCGCTGCGCCGCGTGCAACTGCCACCGCAACTTCCACCGGAAGGAGTCCGAGTCGCTCGCCGGCGAGGGCTCGCCCTTCTCCCCGGCCGCCGTCGTCCCCTACGGCGCCACGCCGCACCACCAGTTCTCCCCGTACTACCGCACCCCTGCCGGTTACCTCCACCACCACCAGCACCACATGGCCGCGGCAGCCGCGGCCGCCGCCGCTGCAGCCGGCGGCCACCCGCAGCGGCCCCTCGCGCTCCCGTCCACCTCCCACAGCGGCCGCGACGACGGCGACGACCTGTCCGGGATGGTGGGGCCCATGTCGGCGGTGGGGCCGCTCAGCGGCATGTCCCTCGGCGCCGGCCCGTCCGGCTCCGGCTCCGGCAAGAAGCGGTTCCGCACCAAGTTCACCCAGGAGCAGAAGGACAAGATGCTGGCGTTCGCCGAGCGCGTCGGGTGGCGCATCCAGAAGCACGACGAGGCCGCCGTGCAGCAGTTCTGCGACGAGGTCGGCGTCAAGCGCCACGTGCTCAAGGTGTGGATGCACAACAACAAGCACACCCTGGGCAAGAAGCTGCCATGA</dnaseqindica>|
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA029617 EnsemblPlants:BGIOSGA029617]|
}}
[[Category:Genes]]
[[Category:Indica mRNA]]
[[Category:Oryza Sativa Indica Group]]
[[Category:Indica Genes]]
[[Category:Indica Chromosome 9]]
[[Category:Chromosome 9]]

BGIOSGA029617

2014-05-28T05:26:19Z

马爱民: /* Labs working on this gene */

BGIOSGA029617

2014-05-28T05:25:59Z

马爱民: /* Expression */

BGIOSGA029617

2014-05-28T05:23:56Z

马爱民: /* Expression */

BGIOSGA029617

2014-05-28T05:21:36Z

马爱民: /* Expression */

BGIOSGA029617

2014-05-28T05:17:31Z

马爱民: /* Annotated Information */