RiceWiki - User contributions [en]

BGIOSGA027603/QuantityDetail

2012-07-27T12:22:51Z

Angie: 1

<table border='1' style='border: solid 1px #8a8a8a;'><tr><th style='border: solid 1px #aaaaaa;'>Contributor</th><th style='border: solid 1px #aaaaaa;'>Edit Quantity</th></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

BGIOSGA027603/QualityDetail

2012-07-27T12:22:51Z

Angie: 1

<table border='1' style='border: solid 1px #8a8a8a;'><tr><th style='border: solid 1px #aaaaaa;'>Contributor</th><th style='border: solid 1px #aaaaaa;'>Edit Quality</th></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

BGIOSGA027603/TimeDetail

2012-07-27T12:22:51Z

Angie: 1

<table border='1' style='border: solid 1px #8a8a8a;'><tr><th style='border: solid 1px #aaaaaa;'>Contributor</th><th style='border: solid 1px #aaaaaa;'>Edit Time</th></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/TimeDetail

2012-07-17T18:16:24Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22 | 2012-07-18 00:12:43 | 2012-07-18 00:28:19 | 2012-07-18 01:52:09 | 2012-07-18 01:56:42 | 2012-07-18 02:06:52 | 2012-07-18 02:10:05 | 2012-07-18 02:14:45
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40 | 2012-07-18 00:18:15
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T18:16:18Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 0.98 | 1 | 1 | 1 | 1 | 1 | 1 | 1
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.91 | 0.6
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 0.95 | -1 | -0.75
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | -0.76
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | -1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | -1 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T18:16:13Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529 | 192 | 42 | 8122 | 17 | 1723 | 24 | 21
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T18:14:45Z

Angie: /* Evolution */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|thumb|150px|''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).'']]

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates predominantly in adult leaves <ref name="ref3" />.

{| style="border-collapse: separate; border-spacing: 0; border-width: 1px; border-style: solid; border-color: #000; padding: 0"
|-
! style="border-style: solid; border-width: 0 1px 1px 0"| Primer
! style="border-style: solid; border-width: 0 1px 1px 0"| Forward primer
! style="border-style: solid; border-width: 0 0 1px 0"| Reverse primer
|-
| style="border-style: solid; border-width: 0 1px 1px 0" rowspan="3"|Gene amplication
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TTTGAAATGCAATGTCGTCCACC-3'(used to amplify exon 1<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GCGCCAATGGGGTAATTAAAACG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-GGCATTCCATTGTTTGTGATTGG-3'(used to amplify exon 2<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TCTGTTCGTTCCGTTTCGTTCCG-3'(used to amplify exon 3<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 0 0" rowspan="2"|RT-PCR
| style="border-style: solid; border-width: 0 1px 0 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 0 0 0 0"| 5'-GTTCGTTCCGTTTCGGTTCCG-3'<ref name="ref3" />
|-
| style="border-style: solid; border-width: 1px 1px 0 0"| 5'-AGCTGGACATGCCCGTGGTC-3'
| style="border-style: solid; border-width: 1px 0 0 0"| 5'-TTGAGCTGCTGTCCGCGAAG-3'<ref name="ref3" />
|}

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" /><ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
*Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
*Honda R&D, Wako Research Center, Wako 351-0193, Japan
*International Rice Research Institute, Manila, DAPO Box 7777, Philippines
*BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan
*Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia
*Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0883800/TimeDetail

2012-07-17T18:11:44Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22 | 2012-07-18 00:12:43 | 2012-07-18 00:28:19 | 2012-07-18 01:52:09 | 2012-07-18 01:56:42 | 2012-07-18 02:06:52 | 2012-07-18 02:10:05
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40 | 2012-07-18 00:18:15
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T18:11:38Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 0.98 | 1 | 1 | 1 | 1 | 1 | 1
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.91 | 0.6
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 0.95 | -1 | -0.75
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | -0.76
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | 0.57 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | -1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T18:11:33Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529 | 192 | 42 | 8122 | 17 | 1723 | 24
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T18:10:05Z

Angie: /* Expression */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|thumb|150px|''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).'']]

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates predominantly in adult leaves <ref name="ref3" />.

{| style="border-collapse: separate; border-spacing: 0; border-width: 1px; border-style: solid; border-color: #000; padding: 0"
|-
! style="border-style: solid; border-width: 0 1px 1px 0"| Primer
! style="border-style: solid; border-width: 0 1px 1px 0"| Forward primer
! style="border-style: solid; border-width: 0 0 1px 0"| Reverse primer
|-
| style="border-style: solid; border-width: 0 1px 1px 0" rowspan="3"|Gene amplication
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TTTGAAATGCAATGTCGTCCACC-3'(used to amplify exon 1<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GCGCCAATGGGGTAATTAAAACG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-GGCATTCCATTGTTTGTGATTGG-3'(used to amplify exon 2<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TCTGTTCGTTCCGTTTCGTTCCG-3'(used to amplify exon 3<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 0 0" rowspan="2"|RT-PCR
| style="border-style: solid; border-width: 0 1px 0 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 0 0 0 0"| 5'-GTTCGTTCCGTTTCGGTTCCG-3'<ref name="ref3" />
|-
| style="border-style: solid; border-width: 1px 1px 0 0"| 5'-AGCTGGACATGCCCGTGGTC-3'
| style="border-style: solid; border-width: 1px 0 0 0"| 5'-TTGAGCTGCTGTCCGCGAAG-3'<ref name="ref3" />
|}

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" />.<ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
*Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
*Honda R&D, Wako Research Center, Wako 351-0193, Japan
*International Rice Research Institute, Manila, DAPO Box 7777, Philippines
*BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan
*Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia
*Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0883800/TimeDetail

2012-07-17T18:08:31Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22 | 2012-07-18 00:12:43 | 2012-07-18 00:28:19 | 2012-07-18 01:52:09 | 2012-07-18 01:56:42 | 2012-07-18 02:06:52
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40 | 2012-07-18 00:18:15
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T18:08:25Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 0.98 | 1 | 1 | 1 | 1 | 1
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.91 | 0.6
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 0.95 | -1 | -0.75
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | -0.76
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | 0.61 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T18:08:19Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529 | 192 | 42 | 8122 | 17 | 1723
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T18:06:52Z

Angie: /* Expression */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|thumb|150px|''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).'']]

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates predominantly in adult leaves <ref name="ref3" />.

{| style="border-collapse: separate; border-spacing: 0; border-width: 1px; border-style: solid; border-color: #000; padding: 0"
|-
! style="border-style: solid; border-width: 0 1px 1px 0"| Primer
! style="border-style: solid; border-width: 0 1px 1px 0"| Forward primer
! style="border-style: solid; border-width: 0 0 1px 0"| Reverse primer
|-
| style="border-style: solid; border-width: 0 1px 1px 0" rowspan="3"|gene amplication
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TTTGAAATGCAATGTCGTCCACC-3'(used to amplify exon 1<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GCGCCAATGGGGTAATTAAAACG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-GGCATTCCATTGTTTGTGATTGG-3'(used to amplify exon 2<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TCTGTTCGTTCCGTTTCGTTCCG-3'(used to amplify exon 3<ref name="ref2" />)
|-
| style="border-style: solid; border-width: 0 1px 0 0" rowspan="2"|RT-PCR
| style="border-style: solid; border-width: 0 1px 0 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 0 0 0 0"| 5'-GTTCGTTCCGTTTCGGTTCCG-3'<ref name="ref3" />
|-
| style="border-style: solid; border-width: 1px 1px 0 0"| 5'-AGCTGGACATGCCCGTGGTC-3'
| style="border-style: solid; border-width: 1px 0 0 0"| 5'-TTGAGCTGCTGTCCGCGAAG-3' <ref name="ref3" />
|}

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" />.<ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
*Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
*Honda R&D, Wako Research Center, Wako 351-0193, Japan
*International Rice Research Institute, Manila, DAPO Box 7777, Philippines
*BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan
*Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia
*Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0883800/TimeDetail

2012-07-17T17:58:21Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22 | 2012-07-18 00:12:43 | 2012-07-18 00:28:19 | 2012-07-18 01:52:09 | 2012-07-18 01:56:42
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40 | 2012-07-18 00:18:15
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T17:58:15Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 0.98 | 1 | 1 | 1 | 1
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.91 | 0.6
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 0.95 | -1 | 0.19
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | -0.76
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | 0.68 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T17:58:10Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529 | 192 | 42 | 8122 | 17
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T17:56:42Z

Angie: /* References */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|thumb|150px|''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).'']]

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates predominantly in adult leaves <ref name="ref3" />.

{| style="border-collapse: separate; border-spacing: 0; border-width: 1px; border-style: solid; border-color: #000; padding: 0"
|-
! style="border-style: solid; border-width: 0 1px 1px 0"| Primer
! style="border-style: solid; border-width: 0 1px 1px 0"| Forward primer
! style="border-style: solid; border-width: 0 0 1px 0"| Reverse primer
|-
| style="border-style: solid; border-width: 1px 1px 1px 0" rowspan="3"|gene amplication
| style="border-style: solid; border-width: 1px 1px 1px 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 1px 0 1px 0"| 5'-TTTGAAATGCAATGTCGTCCACC-3'(used to amplify exon 1)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GCGCCAATGGGGTAATTAAAACG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-GGCATTCCATTGTTTGTGATTGG-3'(used to amplify exon 2)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TCTGTTCGTTCCGTTTCGTTCCG-3'(used to amplify exon 3<ref name="ref2" />.)
|-
| style="border-style: solid; border-width: 0 1px 0 0" rowspan="2"|RT-PCR
| style="border-style: solid; border-width: 0 1px 0 0"| 5'-CAACTCACTCCCGCTCAACACAGC- 3'(located 22-bp upstream from the translation start)
| style="border-style: solid; border-width: 0 0 0 0"| 5'-GTTCGTTCCGTTTCGGTTCCG- 3'(eight-bp downstream from the TGA stop codon <ref name="ref2" />.)
|-
| style="border-style: solid; border-width: 1px 1px 0 0"| 5'-AGCTGGACATGCCCGTGGTC-3'
| style="border-style: solid; border-width: 1px 0 0 0"| 5'-TTGAGCTGCTGTCCGCGAAG-3' <ref name="ref3" />.
|}

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" />.<ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
*Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
*Honda R&D, Wako Research Center, Wako 351-0193, Japan
*International Rice Research Institute, Manila, DAPO Box 7777, Philippines
*BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan
*Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia
*Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0883800/TimeDetail

2012-07-17T17:53:48Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22 | 2012-07-18 00:12:43 | 2012-07-18 00:28:19 | 2012-07-18 01:52:09
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40 | 2012-07-18 00:18:15
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T17:53:42Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 0.98 | 1 | 1 | 1
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.91 | 0.6
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 0.95 | -0.73 | 0.22
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | -0.76
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | 0.79 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T17:53:36Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529 | 192 | 42 | 8122
</td></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T17:52:09Z

Angie: /* Expression */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|thumb|150px|''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).'']]

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates predominantly in adult leaves <ref name="ref3" />.

{| style="border-collapse: separate; border-spacing: 0; border-width: 1px; border-style: solid; border-color: #000; padding: 0"
|-
! style="border-style: solid; border-width: 0 1px 1px 0"| Primer
! style="border-style: solid; border-width: 0 1px 1px 0"| Forward primer
! style="border-style: solid; border-width: 0 0 1px 0"| Reverse primer
|-
| style="border-style: solid; border-width: 1px 1px 1px 0" rowspan="3"|gene amplication
| style="border-style: solid; border-width: 1px 1px 1px 0"| 5'-CAACTCACTCCCGCTCAACACAGC-3'
| style="border-style: solid; border-width: 1px 0 1px 0"| 5'-TTTGAAATGCAATGTCGTCCACC-3'(used to amplify exon 1)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GCGCCAATGGGGTAATTAAAACG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-GGCATTCCATTGTTTGTGATTGG-3'(used to amplify exon 2)
|-
| style="border-style: solid; border-width: 0 1px 1px 0"| 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3'
| style="border-style: solid; border-width: 0 0 1px 0"| 5'-TCTGTTCGTTCCGTTTCGTTCCG-3'(used to amplify exon 3<ref name="ref2" />.)
|-
| style="border-style: solid; border-width: 0 1px 0 0" rowspan="2"|RT-PCR
| style="border-style: solid; border-width: 0 1px 0 0"| 5'-CAACTCACTCCCGCTCAACACAGC- 3'(located 22-bp upstream from the translation start)
| style="border-style: solid; border-width: 0 0 0 0"| 5'-GTTCGTTCCGTTTCGGTTCCG- 3'(eight-bp downstream from the TGA stop codon <ref name="ref2" />.)
|-
| style="border-style: solid; border-width: 1px 1px 0 0"| 5'-AGCTGGACATGCCCGTGGTC-3'
| style="border-style: solid; border-width: 1px 0 0 0"| 5'-TTGAGCTGCTGTCCGCGAAG-3' <ref name="ref3" />.
|}

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" />.<ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
*Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
*Honda R&D, Wako Research Center, Wako 351-0193, Japan
*International Rice Research Institute, Manila, DAPO Box 7777, Philippines
*BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan
*Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia
*Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0883800/TimeDetail

2012-07-17T16:29:55Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22 | 2012-07-18 00:12:43 | 2012-07-18 00:28:19
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40 | 2012-07-18 00:18:15
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T16:29:49Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.91 | 0.9
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 0.95 | -0.85 | 0.27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | -0.76
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 0.98 | 1 | 1
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | 0.96 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T16:29:44Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529 | 192 | 42
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174 | 1
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T16:28:19Z

Angie: /* Labs working on this gene */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|thumb|150px|''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).'']]

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates
predominantly in adult leaves <ref name="ref3" />.

Primers for gene amplication: forward primer, 5'-CAACTCACTCCCGCTCAACACAGC-3', and reverse primer, 5'-TTTGAAATGCAATGTCGTCCACC-3' were used to amplify exon 1; forward primer, 5'-GCGCCAATGGGGTAATTAAAACG-3' and reverse primer, 5'-GGCATTCCATTGTTTGTGATTGG-3' were used for exon 2; forward primer, 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3' and reverse primer, 5'-TCTGTTCGTTCCGTTTCGTTCCG-3' were used for exon 3 <ref name="ref2" />.

Primers for RT-PCR: forward primer 5'-CAACTCACTCCCGCTCAACACAGC- 3' located 22-bp upstream from the translation start, and a reverse primer 5'-GTTCGTTCCGTTTCGGTTCCG- 3' eight-bp downstream from the TGA stop codon <ref name="ref2" />.

Primers for RT-PCR: forward primer: 5'-AGCTGGACATGCCCGTGGTC-3' and reverse primer : 5'-TTGAGCTGCTGTCCGCGAAG-3' <ref name="ref3" />.

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" />.<ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
*Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
*Honda R&D, Wako Research Center, Wako 351-0193, Japan
*International Rice Research Institute, Manila, DAPO Box 7777, Philippines
*BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan
*Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia
*Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0883800/TimeDetail

2012-07-17T16:14:19Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22 | 2012-07-18 00:12:43
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T16:14:13Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.99 | 0.87
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 1 | -0.88 | 0.5
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | -0.76
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 1 | 1
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -0.91
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | 0.96
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T16:14:07Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529 | 192
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T16:12:43Z

Angie: /* Function */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|thumb|100px|''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).'']]

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates
predominantly in adult leaves <ref name="ref3" />.

Primers for gene amplication: forward primer, 5'-CAACTCACTCCCGCTCAACACAGC-3', and reverse primer, 5'-TTTGAAATGCAATGTCGTCCACC-3' were used to amplify exon 1; forward primer, 5'-GCGCCAATGGGGTAATTAAAACG-3' and reverse primer, 5'-GGCATTCCATTGTTTGTGATTGG-3' were used for exon 2; forward primer, 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3' and reverse primer, 5'-TCTGTTCGTTCCGTTTCGTTCCG-3' were used for exon 3 <ref name="ref2" />.

Primers for RT-PCR: forward primer 5'-CAACTCACTCCCGCTCAACACAGC- 3' located 22-bp upstream from the translation start, and a reverse primer 5'-GTTCGTTCCGTTTCGGTTCCG- 3' eight-bp downstream from the TGA stop codon <ref name="ref2" />.

Primers for RT-PCR: forward primer: 5'-AGCTGGACATGCCCGTGGTC-3' and reverse primer : 5'-TTGAGCTGCTGTCCGCGAAG-3' <ref name="ref3" />.

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" />.<ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
Honda R&D, Wako Research Center, Wako 351-0193, Japan

International Rice Research Institute, Manila, DAPO Box 7777, Philippines

BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan

Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia

Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0883800/TimeDetail

2012-07-17T16:06:58Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Time</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 2012-07-12 21:25:12 | 2012-07-15 19:39:58 | 2012-07-15 20:25:12
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 2012-07-06 20:02:20 | 2012-07-06 20:12:16 | 2012-07-06 20:16:00 | 2012-07-06 20:19:26 | 2012-07-06 20:24:50 | 2012-07-06 20:41:03 | 2012-07-13 06:03:25 | 2012-07-13 06:52:26 | 2012-07-13 06:58:33 | 2012-07-13 07:01:13 | 2012-07-15 04:58:39 | 2012-07-15 20:57:35 | 2012-07-15 21:05:27
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 2012-07-12 18:52:58 | 2012-07-12 18:54:16 | 2012-07-12 18:56:29 | 2012-07-12 19:16:57 | 2012-07-12 19:24:50 | 2012-07-12 19:28:53 | 2012-07-12 19:36:54 | 2012-07-12 20:07:34 | 2012-07-12 20:36:30 | 2012-07-12 20:54:41 | 2012-07-12 23:36:21 | 2012-07-13 00:40:38 | 2012-07-13 01:02:33 | 2012-07-13 17:39:55 | 2012-07-14 01:09:09 | 2012-07-14 01:25:38 | 2012-07-14 01:27:34
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 2012-07-08 23:02:25 | 2012-07-09 02:52:45 | 2012-07-15 03:46:31
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 2012-07-18 00:05:22
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 2012-07-12 22:08:24 | 2012-07-12 22:10:12 | 2012-07-12 22:17:49 | 2012-07-12 22:42:30 | 2012-07-17 23:38:40
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 2012-07-06 20:09:27 | 2012-07-07 19:48:44 | 2012-07-07 19:52:41 | 2012-07-07 19:59:19 | 2012-07-07 20:02:51 | 2012-07-07 20:19:50 | 2012-07-07 20:26:03 | 2012-07-16 20:40:04
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QualityDetail

2012-07-17T16:06:52Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quality</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 0.49 | 0.99 | 0.85
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 0.14 | -0.54 | -0.15 | 0.01 | -0.15 | 0.79 | -0.19 | 0.17 | 0.16 | -0.12 | 1 | -0.88 | 0.67
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> -1 | -1 | 0.04 | 0.13 | -0.08 | -0.02 | -0.09 | 0.05 | -0.01 | 0.02 | -0.01 | 0.01 | 0.29 | -0.1 | 0.18 | 0.54 | 0.84
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> -1 | 0.37 | -0.92
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 1
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> -0.5 | -1 | -1 | -0.43 | 0.95
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 0.55 | -0.86 | 0.7 | -0.17 | -1 | -1 | -1 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800/QuantityDetail

2012-07-17T16:06:47Z

Angie: 1

<table border="1"><tr><th>Contributor</th><th>Edit Quantity</th></tr><tr><td>[[Special:ScienceReward|Hao Wu]]
</td><td> 6523 | 638 | 2668
</td></tr><tr><td>[[Special:ScienceReward|Dawei Huang]]
</td><td> 4043 | 1071 | 585 | 180 | 240 | 3675 | 1973 | 5470 | 17 | 68 | 1950 | 306 | 646
</td></tr><tr><td>[[Special:ScienceReward|Lina Ma]]
</td><td> 3984 | 17 | 2428 | 5114 | 2278 | 2800 | 60 | 1360 | 5777 | 4092 | 68 | 7604 | 6969 | 376 | 6991 | 6555 | 109
</td></tr><tr><td>[[Special:ScienceReward|Rice2012]]
</td><td> 25 | 1939 | 75
</td></tr><tr><td>[[Special:ScienceReward|Ang Li]]
</td><td> 529
</td></tr><tr><td>[[Special:ScienceReward|Chao Xu]]
</td><td> 552 | 72 | 2 | 524 | 174
</td></tr><tr><td>[[Special:ScienceReward|sangjian]]
</td><td> 90 | 5992 | 6388 | 52 | 24 | 52 | 25 | 1
</td></tr></table>
Each contributor may involve multiple revisions, which are separated by '|'.

Os01g0883800

2012-07-17T16:05:22Z

Angie: /* Function */

The rice ''semidwarf-1 (sd1)'' is well known as the "green revolution gene" and controls the plant height of rice.

== Annotated Information ==
=== Function ===
[[File:Example.jpg|right|200px]] ''Semidwarf VS. normal-type rice plants at ripening (from reference <ref name="ref3" />).''

This gene is originally derived from the Chinese cultivar Dee-Geo-Woo-Gen(DGWG). It encodes an oxidase enzyme involved in the biosynthesis of gibberellin, which is a plant growth hormone. The rice genome carries at least two GA20ox genes (GA20ox-1 and GA20ox-2).SD1 corresponds to GA20ox-2. Mutation of SD1 will cause a semi-dwarf phenotype of rice without seed yield being affected <ref name="ref1" />. It is not surprising that a rice semidwarfing gene encodes GA20-ox since successful production of semidwarf plants using antisense or overexpressed GA20-ox genes has been reported in Arabidopsis, Solanum dulcamara, potato, and lettuce <ref name="ref3" />.

It is a key enzyme in the biosynthesis of gibberellin that catalyses the three steps GA53->GA44->GA19->GA20. Impaired GA 20-oxidase activity will cause elevated content of GA53, and reduced amount of G20 <ref name="ref1" />.<ref name="ref2" />. However, there is slight difference between different strains. The extent of GA1 is lower in Doongara (semi-dwarf rice strain) when compared with Kyeema (tall), while there is no significant difference between Calrose76 (semi-dwarf rice strain) and Calrose (tall). Calrose76 has lower contents of GA44 and of GA19 than Calrose, while there is no significant difference between Doongara (semi-dwarf rice strain) and Kyeema (tall) <ref name="ref2" />.

GO asignment(s): GO:0005506, GO:0016216, GO:0017000

=== Mutation ===
‘dee-geo-woo-gen’ (semi-dwarf rice strain): A 383-base-pair deletion from the genome (A 280-bp deletion within the coding region), which induces a frameshift that creates a stop codon in SD1, may be related with the semi-dwarf phenotype <ref name="ref1" /><ref name="ref2" />.

Calrose76 (semi-dwarf rice strain): The DNA sequence of Calrose76 is identical to Calrose (tall) except for a C to T transition at position 798 that resulted in a change of the predicted amino acid leucine (Leu-266) in Calrose to phenylalanine in Calrose76 <ref name="ref2" />.

=== Expression ===
This gene is strongly expressed in the leaf blade, stem and unopened flower, whereas GA20ox-1 is predominantly expressed in the unopened flower <ref name="ref1" />.

Among the DGWG-type sd-1 mutants, IR24 and Habataki have little transcript of this gene, while Milyang 23 expresses a normal or greater amount of truncated transcript. No significant difference is observed between Calrose and its single-nucleotide-substitution mutant Calrose 76 <ref name="ref3" />.

Analysis of the tissue- and stage-specificity of transcription of sd1 in Nipponbare revealed that this
gene was expressed within 48 hr after sowing, as well as in 10-day-old plants, 30-day-old leaves, and flowering panicles; no transcription is detected in 24-hr-old seedlings or in 14-day-old roots. Transcript accumulates
predominantly in adult leaves <ref name="ref3" />.

Primers for gene amplication: forward primer, 5'-CAACTCACTCCCGCTCAACACAGC-3', and reverse primer, 5'-TTTGAAATGCAATGTCGTCCACC-3' were used to amplify exon 1; forward primer, 5'-GCGCCAATGGGGTAATTAAAACG-3' and reverse primer, 5'-GGCATTCCATTGTTTGTGATTGG-3' were used for exon 2; forward primer, 5'-GTTTGTCCTTGTCGCGTTGCTCAG-3' and reverse primer, 5'-TCTGTTCGTTCCGTTTCGTTCCG-3' were used for exon 3 <ref name="ref2" />.

Primers for RT-PCR: forward primer 5'-CAACTCACTCCCGCTCAACACAGC- 3' located 22-bp upstream from the translation start, and a reverse primer 5'-GTTCGTTCCGTTTCGGTTCCG- 3' eight-bp downstream from the TGA stop codon <ref name="ref2" />.

Primers for RT-PCR: forward primer: 5'-AGCTGGACATGCCCGTGGTC-3' and reverse primer : 5'-TTGAGCTGCTGTCCGCGAAG-3' <ref name="ref3" />.

=== Evolution ===
This gene is conserved in ''Arabidopsis'' (47% identity) and pea(50% identity). GA20ox-2 shows 47.8% identity to
GA20ox-1 in rice. There are at least three GA20-ox genes in Arabidopsis <ref name="ref1" />.<ref name="ref2" />.

=== Knowledge Extension ===
The wheat green-revolution gene Rht (for ‘reduced height’)<ref name="ref4" /> is a gain-of-function allele caused by a mutation in a transcription factor that is associated with the gibberellin signalling pathway. As wheat has a hexaploid genome, it does not contain recessive alleles such as sd1 in rice that might otherwise be used to produce a semi-dwarf strain of wheat. Although the genetic and biochemical functions of the rice SD1 and wheat RHT proteins are completely different (that is, recessive versus dominant, loss-of-function versus gain-offunction events, enzyme versus transcription factor, respectively), the products of both genes are linked with gibberellin malfunction <ref name="ref1" />.

== Labs working on this gene ==
Bioscience Center, and Graduate School of Bioagricultural Science, Nagoya University, Nagoya 464-8601, Japan
Honda R&D, Wako Research Center, Wako 351-0193, Japan

International Rice Research Institute, Manila, DAPO Box 7777, Philippines

BioResources Center, and Plant Molecular Biology Laboratory, Riken, Tsukuba 305-0074, Japan

Division of Plant Industry, Commonwealth Scientific and Industrial Research Organization, GPO Box 1600, Canberra ACT 2601, Australia

Plant Genome Center, 1-25-2 Kannondai, Tsukuba, Ibaraki 305-0856, Japan

== References ==
<references>
<ref name="ref1">Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.</ref>
<ref name="ref2">Spielmeyer W, Ellis MH, Chandler PM (2002) Semidwarf (sd-1), "green revolution" rice, contains a defective gibberellin 20-oxidase gene. Proc Natl Acad Sci U S A 99: 9043-9048.</ref>
<ref name="ref3">Monna L, Kitazawa N, Yoshino R, Suzuki J, Masuda H, et al. (2002) Positional cloning of rice semidwarfing gene, sd-1: rice "green revolution gene" encodes a mutant enzyme involved in gibberellin synthesis. DNA Res 9: 11-17.</ref>
<ref name="ref4">Peng J, Richards DE, Hartley NM, Murphy GP, Devos KM, et al. (1999) 'Green revolution' genes encode mutant gibberellin response modulators. Nature 400: 256-261..</ref>
</references>

== Structured Information ==
{{JaponicaGene|
GeneName = Os01g0883800|
Description = Gibberellin 20 oxidase 2 (EC 1.14.11.-) (Gibberellin C-20 oxidase 2) (GA 20-oxidase 2) (Os20ox2) (Semidwarf-1 protein)|
Version = NM_001051549.1 GI:115441468 GeneID:4325003|
Length = 2743 bp|
Definition = Oryza sativa Japonica Group Os01g0883800, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:40138313..40141055|
CDS = 40138313..40138869,40138972..40139293,40140765..40141055|
GCID = <gbrowseImage1>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:40138313..40141055
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</cdnaseq>|
AA = <aaseq>MVAEHPTPPQPHQPPPMDSTAGSGIAAPAAAAVCDLRMEPKIPE PFVWPNGDARPASAAELDMPVVDVGVLRDGDAEGLRRAAAQVAAACATHGFFQVSEHG VDAALARAALDGASDFFRLPLAEKRRARRVPGTVSGYTSAHADRFASKLPWKETLSFG FHDRAAAPVVADYFSSTLGPDFAPMGRVYQKYCEEMKELSLTIMELLELSLGVERGYY REFFADSSSIMRCNYYPPCPEPERTLGTGPHCDPTALTILLQDDVGGLEVLVDGEWRP VSPVPGAMVINIGDTFMALSNGRYKSCLHRAVVNQRRERRSLAFFLCPREDRVVRPPP SAATPQHYPDFTWADLMRFTQRHYRADTRTLDAFTRWLAPPAADAAATAQVEAAS</aaseq>|
DNA = <dnaseqindica>1..557#660..981#2453..2743#atggtggccgagcaccccacgccaccacagccgcaccaaccaccgcccatggactccaccgccggctctggcattgccgccccggcggcggcggcggtgtgcgacctgaggatggagcccaagatcccggagccattcgtgtggccgaacggcgacgcgaggccggcgtcggcggcggagctggacatgcccgtggtcgacgtgggcgtgctccgcgacggcgacgccgaggggctgcgccgcgccgcggcgcaggtggccgccgcgtgcgccacgcacgggttcttccaggtgtccgagcacggcgtcgacgccgctctggcgcgcgccgcgctcgacggcgccagcgacttcttccgcctcccgctcgccgagaagcgccgcgcgcgccgcgtcccgggcaccgtgtccggctacaccagcgcccacgccgaccgcttcgcctccaagctcccatggaaggagaccctctccttcggcttccacgaccgcgccgccgcccccgtcgtcgccgactacttctccagcaccctcggccccgacttcgcgccaatggggtaattaaaacgatggtggacgacattgcatttcaaattcaaaacaaattcaaaacacaccgaccgagattatgctgaattcaaacgcgtttgtgcgcgcaggagggtgtaccagaagtactgcgaggagatgaaggagctgtcgctgacgatcatggaactcctggagctgagcctgggcgtggagcgaggctactacagggagttcttcgcggacagcagctcaatcatgcggtgcaactactacccgccatgcccggagccggagcggacgctcggcacgggcccgcactgcgaccccaccgccctcaccatcctcctccaggacgacgtcggcggcctcgaggtcctcgtcgacggcgaatggcgccccgtcagccccgtccccggcgccatggtcatcaacatcggcgacaccttcatggtaaaccatctcctattctcctctcctctgttctcctctgcttcgaagcaacagaacaagtaattcaagcttttttttctctctcgcgcgaaattgacgagaaaaataagatcgtggtaggggcggggctttcagctgaaagcgggaagaaaccgacctgacgtgatttctctgttccaatcacaaacaatggaatgccccactcctccatgtgttatgatttatctcacatcttatagttaataggagtaagtaacaagctacttttttcatattatagttcgtttgattttttttttttaaagtttttttagttttatccaaatttattgaaaaacttagcaacgtttataataccaaattagtctcatttagtttaatattgtatatattttgataatatatttatgttatattaaaaatattactatatttttctataaacattattaaaagccatttataatataaaatggaaggagtaattaatatggatctcccccgacatgagaatattttccgatggtgtgacgacgccatgtaagcttcggtgggcctggacggccagaggtgccaacagccacgtccaacaacccctgggtccccccctaacactccaaacagtagtgagtagtgtctcgtcgcgttttagtatttgatgacaaacaaagtgtgagttgagttagccaccaccaacttgcacacgagcacatacatttgtgtccattctcgccagtcacttccatctctagtcctaactcctatctagcgatgtaagcggataatttcatcatccgtatataaacctgtttgttatagttaatttcctatataatactataacagtatacattttaaaagaaaacaaaattaggataaacaggccctgctcctatccatccatggcacttggaaggaccagactcggtcatgccatgccaagccaagatatgggttatggaagagtagagaagaggagagatgagagataagcatgcgttctcctcctcgttggatgtgtattttggagggatttgtgtagtagtagcagcggcgccgcggggacggatgcggatggtggcgctttcggtggcgttttcccgggggggttttggtttggcgcttgggggggatggcatggcgcggcgtgcggctgcacgccacacacacgcgcgcgcacgcacgtacgtcgtcgtcgccgcgggcggacggtagcttagggtggtgtgttccgcgcgcgggcgcggattgttccatgccgatcgatttggcgccaccctcgccgcggctcttgtcgcgtcgtgcgcctctctcgcgcggtttgtccttgtcgcgttgctcagccggcgacgggggcacggacattggcgatgtagccctgcacgtgtcggcctctccgttgatgaatgatgatgtatgtatgtatttttttttgtctgaaggaatttgtggggaattgttgtgtgtgcaggcgctgtcgaacgggaggtataagagctgcctgcacagggcggtggtgaaccagcggcgggagcggcggtcgctggcgttcttcctgtgcccgcgggaggacagggtggtgcggccgccgccgagcgccgccacgccgcagcactacccggacttcacctgggccgacctcatgcgcttcacgcagcgccactaccgcgccgacacccgcacgctcgacgccttcacgcgctggctcgcgccgccggccgccgacgccgccgcgacggcgcaggtcgaggcggccagctga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051549.1 RefSeq:Os01g0883800]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:Consensus icon.png

2012-07-14T19:00:33Z

Angie: