http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=CydtaRiceWiki - User contributions [en]2026-05-26T09:02:34ZUser contributionsMediaWiki 1.30.0https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171189Os11g06391002014-05-23T09:55:36Z<p>Cydta: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
All the putative transformants (T0) were first screened for the presence of transgene by PCR. Genomic DNA was isolated from the leaves of putative transformants by using DNeasy Plant Mini Kit (QIAGEN, Cologne, USA) as per manufacturer’s instructions. Three primer sets were designed for the screening of transformants by PCR (Fig. 1a). The first pair of primer, CaPi-F: GAGGAGGTTTCCCGATATTAC and CaPi-R: GGTAGGTTCTCCAACCATTCTG was se-<br />
lected to get amplification of the region between CaMV35S promoter and Pi54 gene with an amplicon size of 1.43 kb. The second pair HyPi-F: CGGTGAGTTCAGGCTTTTTC and Hypi-R: TGCAGTGCTCTCAATTTTGG was designed from within hpt gene to give an amplification of 1 kb. The third pair GUS-F: ATGGTAGATCTGAGGGG and GUS-R: AAGTCGAAGTTCGGCT was designed from within the β-glucuronidase gene with an amplicon of 750 bp. <br />
<br />
[[File:Development of gene construct used in plant transformation.png]]<ref name="ref6" /><br />
<br />
===Evolution===<br />
[[File:Phylogenetic analysis of.png]]<ref name="ref7" /><br />
<br />
Phylogenetic analysis of the Pi54rh with 19 blast resistance genes cloned from rice. Bootstrap values, corresponding to the match times of branching orders (1,000 replicates), are shown at the nodes of each branch point. The unit of branch length is 0.2 nucleotide substitutions per site, as indicated by a bar at the bottom left corner of the tree.<br />
<br />
[[File:Structural components of Pi54 orthologues..png]]<ref name="ref7" /><br />
<br />
Structural components of Pi54 orthologues. '''a''' Nipponbare; '''b''' Tetep ; '''c''' O. rhizomatis and '''d'''<br />
tertiary structure of PI54RH protein generated by homology modelling using Modeller module of Accelrys Discovery Studio Software. CC domain (sky blue), NBS domain (parrot green), LRR domains (violet) and Zn-finger domain (yellow), N indicates amino terminal and C indicates carboxy terminal of PI54RH protein.<br />
<br />
== Detection of callose deposition ==<br />
To analyze this important aspect of defense response by the rice plants and understand about the possible involvement of Pi54 gene in the deposition of callose, 15 m thick transverse sections of leaf epidermis were prepared from the transgenic and non-transgenic plants after 0, 72, 96 and 120 hpi and stained with callose specific aniline blue stain. Stained sections were observed under fluorescent light microscope. Careful histochemical examination of these sections revealed the gradually increasing deposition of callose resulting into thickened cell walls in the plants of transgenic line TP-Pi54-2, which has earlier been found to be highly resistant to M. oryzae.<ref name="ref6" /><br />
<br />
[[File:Effect of blast inoculation on deposition of Callose and other.png]]<ref name="ref6" /><br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6">Amit Kumar Rai;Satya Pal Kumar;Santosh Kumar Gupta;Naveen Gautam;Nagendera Kumar Singh;Tilak Raj Sharma. Functional complementation of rice blast resistance gene Pi-kh(Pi54) conferring resistance to diverse strains of Magnaporthe oryzae, Journal of Plant Biochemistry and Biotechnology, 2011, 20(1): 55-65</ref><br />
* <ref name="ref7">Alok Das;D. Soubam;P. K. Singh;S. Thakur;N. K. Singh;T. R. Sharma. A novel blast resistance gene, Pi54rh cloned from wild species of rice, Oryza rhizomatis confers broad spectrum resistance to Magnaporthe oryzae, Functional & Integrative Genomics, 2012, 12(2): 215-228</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Structural_components_of_Pi54_orthologues..png&diff=171188File:Structural components of Pi54 orthologues..png2014-05-23T09:54:08Z<p>Cydta: Structural components of Pi54 orthologues</p>
<hr />
<div>Structural components of Pi54 orthologues</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171187Os11g06391002014-05-23T09:52:24Z<p>Cydta: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
All the putative transformants (T0) were first screened for the presence of transgene by PCR. Genomic DNA was isolated from the leaves of putative transformants by using DNeasy Plant Mini Kit (QIAGEN, Cologne, USA) as per manufacturer’s instructions. Three primer sets were designed for the screening of transformants by PCR (Fig. 1a). The first pair of primer, CaPi-F: GAGGAGGTTTCCCGATATTAC and CaPi-R: GGTAGGTTCTCCAACCATTCTG was se-<br />
lected to get amplification of the region between CaMV35S promoter and Pi54 gene with an amplicon size of 1.43 kb. The second pair HyPi-F: CGGTGAGTTCAGGCTTTTTC and Hypi-R: TGCAGTGCTCTCAATTTTGG was designed from within hpt gene to give an amplification of 1 kb. The third pair GUS-F: ATGGTAGATCTGAGGGG and GUS-R: AAGTCGAAGTTCGGCT was designed from within the β-glucuronidase gene with an amplicon of 750 bp. <br />
<br />
[[File:Development of gene construct used in plant transformation.png]]<ref name="ref6" /><br />
<br />
===Evolution===<br />
[[File:Phylogenetic analysis of.png]]<ref name="ref7" /><br />
<br />
Phylogenetic analysis of the Pi54rh with 19 blast resistance genes cloned from rice. Bootstrap values, corresponding to the match times of branching orders (1,000 replicates), are shown at the nodes of each branch point. The unit of branch length is 0.2 nucleotide substitutions per site, as indicated by a bar at the bottom left corner of the tree.<br />
<br />
== Detection of callose deposition ==<br />
To analyze this important aspect of defense response by the rice plants and understand about the possible involvement of Pi54 gene in the deposition of callose, 15 m thick transverse sections of leaf epidermis were prepared from the transgenic and non-transgenic plants after 0, 72, 96 and 120 hpi and stained with callose specific aniline blue stain. Stained sections were observed under fluorescent light microscope. Careful histochemical examination of these sections revealed the gradually increasing deposition of callose resulting into thickened cell walls in the plants of transgenic line TP-Pi54-2, which has earlier been found to be highly resistant to M. oryzae.<ref name="ref6" /><br />
<br />
[[File:Effect of blast inoculation on deposition of Callose and other.png]]<ref name="ref6" /><br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6">Amit Kumar Rai;Satya Pal Kumar;Santosh Kumar Gupta;Naveen Gautam;Nagendera Kumar Singh;Tilak Raj Sharma. Functional complementation of rice blast resistance gene Pi-kh(Pi54) conferring resistance to diverse strains of Magnaporthe oryzae, Journal of Plant Biochemistry and Biotechnology, 2011, 20(1): 55-65</ref><br />
* <ref name="ref7">Alok Das;D. Soubam;P. K. Singh;S. Thakur;N. K. Singh;T. R. Sharma. A novel blast resistance gene, Pi54rh cloned from wild species of rice, Oryza rhizomatis confers broad spectrum resistance to Magnaporthe oryzae, Functional & Integrative Genomics, 2012, 12(2): 215-228</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171186Os11g06391002014-05-23T09:51:44Z<p>Cydta: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
All the putative transformants (T0) were first screened for the presence of transgene by PCR. Genomic DNA was isolated from the leaves of putative transformants by using DNeasy Plant Mini Kit (QIAGEN, Cologne, USA) as per manufacturer’s instructions. Three primer sets were designed for the screening of transformants by PCR (Fig. 1a). The first pair of primer, CaPi-F: GAGGAGGTTTCCCGATATTAC and CaPi-R: GGTAGGTTCTCCAACCATTCTG was se-<br />
lected to get amplification of the region between CaMV35S promoter and Pi54 gene with an amplicon size of 1.43 kb. The second pair HyPi-F: CGGTGAGTTCAGGCTTTTTC and Hypi-R: TGCAGTGCTCTCAATTTTGG was designed from within hpt gene to give an amplification of 1 kb. The third pair GUS-F: ATGGTAGATCTGAGGGG and GUS-R: AAGTCGAAGTTCGGCT was designed from within the β-glucuronidase gene with an amplicon of 750 bp. <br />
<br />
[[File:Development of gene construct used in plant transformation.png]]<ref name="ref6" /><br />
<br />
===Evolution===<br />
[[File:Phylogenetic analysis of.png]]<ref name="ref7" /><br />
<br />
Phylogenetic analysis of the Pi54rh with 19 blast resistance genes cloned from rice. Bootstrap values, corresponding to the match times of branching orders (1,000 replicates), are shown at the nodes of each branch point. The unit of branch length is 0.2 nucleotide substitutions per site, as indicated by a bar at the bottom left corner of the tree.<br />
<br />
== Detection of callose deposition ==<br />
To analyze this important aspect of defense response by the rice plants and understand about the possible involvement of Pi54 gene in the deposition of callose, 15 m thick transverse sections of leaf epidermis were prepared from the transgenic and non-transgenic plants after 0, 72, 96 and 120 hpi and stained with callose specific aniline blue stain. Stained sections were observed under fluorescent light microscope. Careful histochemical examination of these sections revealed the gradually increasing deposition of callose resulting into thickened cell walls in the plants of transgenic line TP-Pi54-2, which has earlier been found to be highly resistant to M. oryzae.<ref name="ref6" /><br />
<br />
[[File:Effect of blast inoculation on deposition of Callose and other.png]]<ref name="ref6" /><br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6">Amit Kumar Rai;Satya Pal Kumar;Santosh Kumar Gupta;Naveen Gautam;Nagendera Kumar Singh;Tilak Raj Sharma. Functional complementation of rice blast resistance gene Pi-kh(Pi54) conferring resistance to diverse strains of Magnaporthe oryzae, Journal of Plant Biochemistry and Biotechnology, 2011, 20(1): 55-65</ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Phylogenetic_analysis_of.png&diff=171184File:Phylogenetic analysis of.png2014-05-23T09:49:46Z<p>Cydta: Phylogenetic analysis of the Pi54rh with 19 blast resistance genes cloned from rice. Bootstrap values,</p>
<hr />
<div>Phylogenetic analysis of the Pi54rh with 19 blast resistance genes cloned from rice. Bootstrap values,</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171178Os11g06391002014-05-23T09:46:46Z<p>Cydta: /* Detection of callose deposition */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
All the putative transformants (T0) were first screened for the presence of transgene by PCR. Genomic DNA was isolated from the leaves of putative transformants by using DNeasy Plant Mini Kit (QIAGEN, Cologne, USA) as per manufacturer’s instructions. Three primer sets were designed for the screening of transformants by PCR (Fig. 1a). The first pair of primer, CaPi-F: GAGGAGGTTTCCCGATATTAC and CaPi-R: GGTAGGTTCTCCAACCATTCTG was se-<br />
lected to get amplification of the region between CaMV35S promoter and Pi54 gene with an amplicon size of 1.43 kb. The second pair HyPi-F: CGGTGAGTTCAGGCTTTTTC and Hypi-R: TGCAGTGCTCTCAATTTTGG was designed from within hpt gene to give an amplification of 1 kb. The third pair GUS-F: ATGGTAGATCTGAGGGG and GUS-R: AAGTCGAAGTTCGGCT was designed from within the β-glucuronidase gene with an amplicon of 750 bp. <br />
<br />
[[File:Development of gene construct used in plant transformation.png]]<ref name="ref6" /><br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
<br />
<br />
== Detection of callose deposition ==<br />
To analyze this important aspect of defense response by the rice plants and understand about the possible involvement of Pi54 gene in the deposition of callose, 15 m thick transverse sections of leaf epidermis were prepared from the transgenic and non-transgenic plants after 0, 72, 96 and 120 hpi and stained with callose specific aniline blue stain. Stained sections were observed under fluorescent light microscope. Careful histochemical examination of these sections revealed the gradually increasing deposition of callose resulting into thickened cell walls in the plants of transgenic line TP-Pi54-2, which has earlier been found to be highly resistant to M. oryzae.<ref name="ref6" /><br />
<br />
[[File:Effect of blast inoculation on deposition of Callose and other.png]]<ref name="ref6" /><br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6">Amit Kumar Rai;Satya Pal Kumar;Santosh Kumar Gupta;Naveen Gautam;Nagendera Kumar Singh;Tilak Raj Sharma. Functional complementation of rice blast resistance gene Pi-kh(Pi54) conferring resistance to diverse strains of Magnaporthe oryzae, Journal of Plant Biochemistry and Biotechnology, 2011, 20(1): 55-65</ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171177Os11g06391002014-05-23T09:46:33Z<p>Cydta: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
All the putative transformants (T0) were first screened for the presence of transgene by PCR. Genomic DNA was isolated from the leaves of putative transformants by using DNeasy Plant Mini Kit (QIAGEN, Cologne, USA) as per manufacturer’s instructions. Three primer sets were designed for the screening of transformants by PCR (Fig. 1a). The first pair of primer, CaPi-F: GAGGAGGTTTCCCGATATTAC and CaPi-R: GGTAGGTTCTCCAACCATTCTG was se-<br />
lected to get amplification of the region between CaMV35S promoter and Pi54 gene with an amplicon size of 1.43 kb. The second pair HyPi-F: CGGTGAGTTCAGGCTTTTTC and Hypi-R: TGCAGTGCTCTCAATTTTGG was designed from within hpt gene to give an amplification of 1 kb. The third pair GUS-F: ATGGTAGATCTGAGGGG and GUS-R: AAGTCGAAGTTCGGCT was designed from within the β-glucuronidase gene with an amplicon of 750 bp. <br />
<br />
[[File:Development of gene construct used in plant transformation.png]]<ref name="ref6" /><br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
<br />
<br />
== Detection of callose deposition ==<br />
To analyze this important aspect of defense response by the rice plants and understand about the possible involvement of Pi54 gene in the deposition of callose, 15 m thick transverse sections of leaf epidermis were prepared from the transgenic and non-transgenic plants after 0, 72, 96 and 120 hpi and stained with callose specific aniline blue stain. Stained sections were observed under fluorescent light microscope. Careful histochemical examination of these sections revealed the gradually increasing deposition of callose resulting into thickened cell walls in the plants of transgenic line TP-Pi54-2, which has earlier been found to be highly resistant to M. oryzae.<ref name="ref6" /><br />
[[File:Effect of blast inoculation on deposition of Callose and other.png]]<ref name="ref6" /><br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6">Amit Kumar Rai;Satya Pal Kumar;Santosh Kumar Gupta;Naveen Gautam;Nagendera Kumar Singh;Tilak Raj Sharma. Functional complementation of rice blast resistance gene Pi-kh(Pi54) conferring resistance to diverse strains of Magnaporthe oryzae, Journal of Plant Biochemistry and Biotechnology, 2011, 20(1): 55-65</ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Effect_of_blast_inoculation_on_deposition_of_Callose_and_other.png&diff=171176File:Effect of blast inoculation on deposition of Callose and other.png2014-05-23T09:46:09Z<p>Cydta: Effect of blast inoculation on deposition of Callose and other auto-fluorescent compounds</p>
<hr />
<div>Effect of blast inoculation on deposition of Callose and other auto-fluorescent compounds</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171173Os11g06391002014-05-23T09:42:00Z<p>Cydta: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
All the putative transformants (T0) were first screened for the presence of transgene by PCR. Genomic DNA was isolated from the leaves of putative transformants by using DNeasy Plant Mini Kit (QIAGEN, Cologne, USA) as per manufacturer’s instructions. Three primer sets were designed for the screening of transformants by PCR (Fig. 1a). The first pair of primer, CaPi-F: GAGGAGGTTTCCCGATATTAC and CaPi-R: GGTAGGTTCTCCAACCATTCTG was se-<br />
lected to get amplification of the region between CaMV35S promoter and Pi54 gene with an amplicon size of 1.43 kb. The second pair HyPi-F: CGGTGAGTTCAGGCTTTTTC and Hypi-R: TGCAGTGCTCTCAATTTTGG was designed from within hpt gene to give an amplification of 1 kb. The third pair GUS-F: ATGGTAGATCTGAGGGG and GUS-R: AAGTCGAAGTTCGGCT was designed from within the β-glucuronidase gene with an amplicon of 750 bp. <br />
<br />
[[File:Development of gene construct used in plant transformation.png]]<ref name="ref6" /><br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6">Amit Kumar Rai;Satya Pal Kumar;Santosh Kumar Gupta;Naveen Gautam;Nagendera Kumar Singh;Tilak Raj Sharma. Functional complementation of rice blast resistance gene Pi-kh(Pi54) conferring resistance to diverse strains of Magnaporthe oryzae, Journal of Plant Biochemistry and Biotechnology, 2011, 20(1): 55-65</ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171172Os11g06391002014-05-23T09:39:57Z<p>Cydta: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
All the putative transformants (T0) were first screened for the presence of transgene by PCR. Genomic DNA was isolated from the leaves of putative transformants by using DNeasy Plant Mini Kit (QIAGEN, Cologne, USA) as per manufacturer’s instructions. Three primer sets were designed for the screening of transformants by PCR (Fig. 1a). The first pair of primer, CaPi-F: GAGGAGGTTTCCCGATATTAC and CaPi-R: GGTAGGTTCTCCAACCATTCTG was se-<br />
lected to get amplification of the region between CaMV35S promoter and Pi54 gene with an amplicon size of 1.43 kb. The second pair HyPi-F: CGGTGAGTTCAGGCTTTTTC and Hypi-R: TGCAGTGCTCTCAATTTTGG was designed from within hpt gene to give an amplification of 1 kb. The third pair GUS-F: ATGGTAGATCTGAGGGG and GUS-R: AAGTCGAAGTTCGGCT was designed from within the β-glucuronidase gene with an amplicon of 750 bp. <br />
<br />
[[File:Development of gene construct used in plant transformation.png]]<ref name="ref6" /><br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Development_of_gene_construct_used_in_plant_transformation.png&diff=171171File:Development of gene construct used in plant transformation.png2014-05-23T09:39:51Z<p>Cydta: Development of gene construct used in plant transformation
and the production of transgenic rice plants.</p>
<hr />
<div>Development of gene construct used in plant transformation<br />
and the production of transgenic rice plants.</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171135Os11g06391002014-05-23T08:52:56Z<p>Cydta: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
[[File:Gene ontology score-based categorization of differen-.png]]<ref name="ref5" /><br />
<br />
Adopting a stringent criterion for the expression fold change value (FCA) of >2.0 and the P value <0.05, a total of 1154 differentially expressed genes were identified in TP-Pi54 plants. Of these, 587 were up-regulated, whereas 567 genes were found to be down-regulated. All the genes that showed differential expression in the transgenic blast-resistant line TP-Pi54 were clustered and functionally annotated. The level of expression of these genes in TP-Pi54 plants was compared with that in TP plants. Based on K-means clustering, the functionally annotated genes were classified into eight different clusters. These genes were also analysed on the basis of their Gene Ontology (GO) score into three main GO categories, including biological process (BP), molecular function (MF), and cellular component (CC).<br />
<br />
[[File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png]] <ref name="ref5" /><br />
<br />
The number of genes was finalized using the filtering criteria of fold change >2.0 and P-value correction <¼0.05 by FDR (Benjamini-Hochberg). Genes were classified into 16 different categories based on Gene Ontology. The number of up- and down-regulated genes for each functional category is shown in the histogram. The functional categories are: A, binding; B, catalytic activity; C, transporter activity; D, transcription regulator activity; E, molecular transducer activity; F, antioxidant activity; G, metabolic processes; H, cellular processes; I, biological regulation; J, establishment of localization; K, response to stimulus; L, anatomical structure function; M, cell part; N, organelle; O, organelle part; and P, molecular complex. (A) Up-regulated genes, (B) Down-regulated genes.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Functional_categorization_of_genes_differentially_expressed_in_the_TP-Pi54_line.png&diff=171134File:Functional categorization of genes differentially expressed in the TP-Pi54 line.png2014-05-23T08:51:30Z<p>Cydta: Functional categorization of genes differentially expressed in the TP-Pi54 line</p>
<hr />
<div>Functional categorization of genes differentially expressed in the TP-Pi54 line</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Gene_ontology_score-based_categorization_of_differen-.png&diff=171128File:Gene ontology score-based categorization of differen-.png2014-05-23T08:45:17Z<p>Cydta: Gene ontology score-based categorization of differentially regulated genes</p>
<hr />
<div>Gene ontology score-based categorization of differentially regulated genes</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171070Os11g06391002014-05-23T04:44:13Z<p>Cydta: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref5" /><br />
<br />
The transgenic lines continually show a high degree of resistance and hypersensitive response to the blast pathogen in the fifth generation as well. Typical blast lesions as observed in the non-transgenic susceptible rice line Taipei 309 (TP). No such disease symptoms were observed in the resistant transgenic line (TP-Pi54); hypersensitive response (HR) was observed in the TP-Pi54 line.<ref name="ref5" /><br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171069Os11g06391002014-05-23T04:41:45Z<p>Cydta: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref3" /><br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5">Santosh Kumar Gupta;Amit Kumar Rai;Shamsher Singh Kanwar;Duni Chand;Nagendera Kumar Singh;Tilak Raj Sharma. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice, Journal of Experimental Botany, 2012, 63(2): 757-772</ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171068Os11g06391002014-05-23T04:40:52Z<p>Cydta: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref3" /><br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171067Os11g06391002014-05-23T04:40:36Z<p>Cydta: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
[[File:Functional analysis of differentially regulated genes of.png]]<ref name="ref3" /><br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Functional_analysis_of_differentially_regulated_genes_of.png&diff=171066File:Functional analysis of differentially regulated genes of.png2014-05-23T04:39:48Z<p>Cydta: Functional analysis of differentially regulated genes of TP-Pi54</p>
<hr />
<div>Functional analysis of differentially regulated genes of TP-Pi54</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171064Os11g06391002014-05-23T04:36:21Z<p>Cydta: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.<br />
<br />
2.Department of Biotechnology, Himachal Pradesh University, India.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171062Os11g06391002014-05-23T04:33:33Z<p>Cydta: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4">Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular<br />
mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133. </ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171060Os11g06391002014-05-23T04:31:51Z<p>Cydta: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India <ref name="ref4" />.<br />
<br />
<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171059Os11g06391002014-05-23T04:29:07Z<p>Cydta: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3">Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121. </ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171058Os11g06391002014-05-23T04:28:16Z<p>Cydta: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />. The expression<br />
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied <ref name="ref3" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3"></ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171057Os11g06391002014-05-23T04:25:52Z<p>Cydta: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref><br />
* <ref name="ref3"></ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171056Os11g06391002014-05-23T04:24:29Z<p>Cydta: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response <ref name="ref2" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2"></ref><br />
* <ref name="ref3"></ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171055Os11g06391002014-05-23T04:20:08Z<p>Cydta: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />.<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2"></ref><br />
* <ref name="ref3"></ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171054Os11g06391002014-05-23T04:19:14Z<p>Cydta: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Rice blast resistance-k<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US <ref name="ref1" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2"></ref><br />
* <ref name="ref3"></ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171053Os11g06391002014-05-23T04:18:30Z<p>Cydta: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Rice blast resistance-k<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US (Costanzo and Jia, 2010; Rai et al., 2011).<br />
<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref><br />
* <ref name="ref2"></ref><br />
* <ref name="ref3"></ref><br />
* <ref name="ref4"></ref><br />
* <ref name="ref5"></ref><br />
* <ref name="ref6"></ref><br />
* <ref name="ref7"></ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0639100&diff=171052Os11g06391002014-05-23T04:16:53Z<p>Cydta: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
This gene(''Pikh; Pi54; Pi54rh'') confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.<br />
===Function===<br />
Rice blast resistance-k<br />
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US (Costanzo and Jia, 2010; Rai et al., 2011).<br />
<br />
<br />
===Expression===<br />
editing<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0639100|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001189745.1 GI:297728620 GeneID:9272143|<br />
Length = 1021 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0639100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:27105883..27106903|<br />
CDS = 27105883..27106477,27106689..27106903|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:27105883..27106903<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq>|<br />
AA = <aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq>|<br />
DNA = <dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001189745.1 RefSeq:Os11g0639100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171044Os06g02867002014-05-23T03:12:30Z<p>Cydta: /* References */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />.<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
== Pi2/9 locus ==<br />
Utilization of broad-spectrum resistance (R) genes is an effective and economical strategy to control the fungal pathogen Magnaporthe oryzae, the causal agent of the rice blast disease. Among the cloned blast resistance genes, Pi9, Pi2 and Piz-t confer broad-spectrum resistance to diverse M. oryzae isolates and were isolated from the Pi2/9 locus on chromosome 6. Identification and isolation of additional R genes with different resistance spectra from this locus will provide novel genetic resources for better control of this important rice disease.<ref name="ref8" /><br />
<br />
[[File:Genetic and physical maps around the Pi2-2 locus.png]]<ref name="ref8" /><br />
Genetic and physical maps around the Pi2-2 locus. (A) A high resolution map of Pi2-2. The numbers in parentheses above the map indicate the numbers of recombinants detected in the mapping population. (B) A virtual contig map spanning the Pi2-2 locus based on information of Nipponbare BACs released by RGRP (Rice Genome Research Program). (C) The position of the three NBS-LRR genes in the 270-kb contig. NIP, nitrite-induced protein. R1-R3, three putative NBS-LRR genes at Pi2/9 locus.<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
7.Rice Research Institute, Guangdong Academy of Agricultural Sciences, Guangzhou, Guangdong, China<br />
<br />
8.Plant Protection Research Institute, Guangdong Academy of Agricultural Sciences<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
* <ref name="ref8">Nan Jiang;zhiqiang Li;Jun Wu;Yue Wang;Lijun Wu;Suhua Wang;Ting Wen;Yi Liang;Pinyong Sun;Jinling Liu;Liangying Dai;Zhilong Wang;Chao Wang;Meizhong Luo;Xionglun Liu;Guo-Liang Wang;Dan Wang. Molecular mapping of the Pi2/9 allelic gene Pi2-2 conferring broad-spectrum resistance to Magnaporthe oryzae in the rice cultivar Jefferson, Rice, 2012, 5: 29</ref><br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171042Os06g02867002014-05-23T03:11:17Z<p>Cydta: /* Pi2/9 locus */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />.<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
== Pi2/9 locus ==<br />
Utilization of broad-spectrum resistance (R) genes is an effective and economical strategy to control the fungal pathogen Magnaporthe oryzae, the causal agent of the rice blast disease. Among the cloned blast resistance genes, Pi9, Pi2 and Piz-t confer broad-spectrum resistance to diverse M. oryzae isolates and were isolated from the Pi2/9 locus on chromosome 6. Identification and isolation of additional R genes with different resistance spectra from this locus will provide novel genetic resources for better control of this important rice disease.<ref name="ref8" /><br />
<br />
[[File:Genetic and physical maps around the Pi2-2 locus.png]]<ref name="ref8" /><br />
Genetic and physical maps around the Pi2-2 locus. (A) A high resolution map of Pi2-2. The numbers in parentheses above the map indicate the numbers of recombinants detected in the mapping population. (B) A virtual contig map spanning the Pi2-2 locus based on information of Nipponbare BACs released by RGRP (Rice Genome Research Program). (C) The position of the three NBS-LRR genes in the 270-kb contig. NIP, nitrite-induced protein. R1-R3, three putative NBS-LRR genes at Pi2/9 locus.<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
7.Rice Research Institute, Guangdong Academy of Agricultural Sciences, Guangzhou, Guangdong, China<br />
<br />
8.Plant Protection Research Institute, Guangdong Academy of Agricultural Sciences<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
<br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171040Os06g02867002014-05-23T03:09:59Z<p>Cydta: /* Nucleotide Polymorphism of the Pi9 Alleles */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />.<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
== Pi2/9 locus ==<br />
Utilization of broad-spectrum resistance (R) genes is an effective and economical strategy to control the fungal pathogen Magnaporthe oryzae, the causal agent of the rice blast disease. Among the cloned blast resistance genes, Pi9, Pi2 and Piz-t confer broad-spectrum resistance to diverse M. oryzae isolates and were isolated from the Pi2/9 locus on chromosome 6. Identification and isolation of additional R genes with different resistance spectra from this locus will provide novel genetic resources for better control of this important rice disease.<br />
<br />
[[File:Genetic and physical maps around the Pi2-2 locus.png]]<br />
Genetic and physical maps around the Pi2-2 locus. (A) A high resolution map of Pi2-2. The numbers in parentheses above the map indicate the numbers of recombinants detected in the mapping population. (B) A virtual contig map spanning the Pi2-2 locus based on information of Nipponbare BACs released by RGRP (Rice Genome Research Program). (C) The position of the three NBS-LRR genes in the 270-kb contig. NIP, nitrite-induced protein. R1-R3, three putative NBS-LRR genes at Pi2/9 locus.<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
7.Rice Research Institute, Guangdong Academy of Agricultural Sciences, Guangzhou, Guangdong, China<br />
<br />
8.Plant Protection Research Institute, Guangdong Academy of Agricultural Sciences<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
<br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Genetic_and_physical_maps_around_the_Pi2-2_locus.png&diff=171038File:Genetic and physical maps around the Pi2-2 locus.png2014-05-23T03:09:03Z<p>Cydta: Genetic and physical maps around the Pi2-2 locus.</p>
<hr />
<div> Genetic and physical maps around the Pi2-2 locus.</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171027Os06g02867002014-05-23T02:55:35Z<p>Cydta: /* Labs working on this gene */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />.<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
7.Rice Research Institute, Guangdong Academy of Agricultural Sciences, Guangzhou, Guangdong, China<br />
<br />
8.Plant Protection Research Institute, Guangdong Academy of Agricultural Sciences<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
<br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171025Os06g02867002014-05-23T02:55:22Z<p>Cydta: /* Labs working on this gene */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />.<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
7.Rice Research Institute, Guangdong Academy of Agricultural Sciences, Guangzhou, Guangdong, China<br />
8.Plant Protection Research Institute, Guangdong Academy of Agricultural Sciences<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
<br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171024Os06g02867002014-05-23T02:55:07Z<p>Cydta: /* Labs working on this gene */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />.<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
7.Rice Research Institute, Guangdong Academy of Agricultural Sciences, Guangzhou, Guangdong, China<br />
<br />
8.Plant Protection Research Institute, Guangdong Academy of Agricultural Sciences<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
<br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171020Os06g02867002014-05-23T02:48:59Z<p>Cydta: /* Evolution */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program <ref name="ref7" />.<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
<br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171019Os06g02867002014-05-23T02:48:33Z<p>Cydta: /* References */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program (Hall 1999).<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
* <ref name="ref7">Hall TA (1999) BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl Acids Symp Series 41:95–98</ref><br />
<br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171016Os06g02867002014-05-23T02:46:55Z<p>Cydta: /* Evolution */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously <ref name="ref6" />, '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program (Hall 1999).<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171012Os06g02867002014-05-23T02:45:05Z<p>Cydta: /* References */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously (Zhou et al. 2007), '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program (Hall 1999).<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
* <ref name="ref5"> Liangying D, Jun W, Xunbo L, Xuejun W, Xionglun L, Chatchawan J, Dave K, Yeisoo Y, Rod A. W, Bin H, Bo Z, Guo-Liang W. Genomic structure and evolution of the Pi2/9 locus in wild rice species, Theoretical and Applied Genetics, 2010, 121(2): 295-309</ref><br />
* <ref name="ref6">Zhou B, Dolan M, Sakai H, Wang GL (2007) The genomic dynamics and evolutionary mechanism of the Pi2/9 locus in rice. Mol Plant Microbe Interact 20:63–71</ref><br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=171006Os06g02867002014-05-23T02:37:41Z<p>Cydta: /* Evolution */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
The number of Pi2/9 family members in the four wild species ranges from two copies to 12 copies. Although these genes are conserved in structure and categorized into the same subfamily, sequence duplications and subsequent inversions or uneven crossing overs were observed, suggesting that the locus in diVerent wild species has undergone dynamic changes. <ref name="ref5" /><br />
<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
[[File:Genome organization of the Pi29 locus in four wild species.png]]<ref name="ref5" /><br />
<br />
The Pi2/9 gene family members are indicated by the arrows with the transcriptional direction. The family members within a same vertical group (VG) are indicated with the same color. The VG4 in which the three cloned resistance genes (Pi2, Pi9 and Piz-t) are located is highlighted by dashed lines in brown between diVerent species. The non-Pi2/9 homologues are indicated with rectangles. NIP nitrate-induced protein gene, PK protein kinase gene, UDP-T UDP-glycosyltrans-ferase-like protein, UTP UTP-glycosyltransferase-like protein. '''a''' The Pi2/9 locus in the cultivated rice line Nipponbare. Nbs3-OS-NPB was indicated in a Wlled gray arrow, which shows a signiWcant diVerence with other NBS-LRR genes as discussed previously (Zhou et al. 2007), '''b''' The Pi2/9 locus in O. nivara, '''c''' The Pi2/9 locus in O. punctata, '''d''' the Pi2/9 locus in the BB subgenome of O. minuta, '''e''' The Pi2/9 locus in the CC subgenome of O. minuta, '''f''' the Pi2/9 locus in O. oYcinalis. The Wgure was drawn with the BioEdit program (Hall 1999).<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Genome_organization_of_the_Pi29_locus_in_four_wild_species.png&diff=171002File:Genome organization of the Pi29 locus in four wild species.png2014-05-23T02:31:31Z<p>Cydta: Genome organization of the Pi29 locus in four wild species</p>
<hr />
<div>Genome organization of the Pi29 locus in four wild species</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=170989Os06g02867002014-05-23T02:22:15Z<p>Cydta: /* Nucleotide Polymorphism of the Pi9 Alleles */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria <ref name="ref4" />. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=170986Os06g02867002014-05-23T02:21:03Z<p>Cydta: /* References */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria (Yang et al. 2008). The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much<br />
higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816) (Table 2; Fig. 2). Both values are similar in cultivated rice and wild rice groups (Table 2; Fig. 2). These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
* <ref name="ref4">Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177</ref><br />
<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=170983Os06g02867002014-05-23T02:19:46Z<p>Cydta: /* Evolution */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
<br />
<br />
== Nucleotide Polymorphism of the Pi9 Alleles ==<br />
<br />
[[File:Nucleotide polymorphism of the Pi9 alleles.png]]<ref name="ref3" /><br />
<br />
Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria (Yang et al. 2008). The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much<br />
higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816) (Table 2; Fig. 2). Both values are similar in cultivated rice and wild rice groups (Table 2; Fig. 2). These results suggest that the LRR domain is important in the variation of the Pi9 alleles.<br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Nucleotide_polymorphism_of_the_Pi9_alleles.png&diff=170981File:Nucleotide polymorphism of the Pi9 alleles.png2014-05-23T02:12:47Z<p>Cydta: Nucleotide polymorphism of the Pi9 alleles
S number of polymorphic or segregating sites; π nucleotide diversity, the average number of nucleotide differences per site between two sequences; θ Watterson's nucleotide diversity estimator based on silent si</p>
<hr />
<div>Nucleotide polymorphism of the Pi9 alleles<br />
S number of polymorphic or segregating sites; π nucleotide diversity, the average number of nucleotide differences per site between two sequences; θ Watterson's nucleotide diversity estimator based on silent site; Tajima's D Tajima's D statistic (1989) based on the differences between the number of segregating sites and the average number of nucleotide differences</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=170978Os06g02867002014-05-23T02:06:39Z<p>Cydta: /* Evolution */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
<br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0286700&diff=170977Os06g02867002014-05-23T02:06:14Z<p>Cydta: /* Evolution */</p>
<hr />
<div>This is a broad-spectrum resistance(R) gene to rice blast<br />
==Annotated Information==<br />
尼松伟<br />
===Function===<br />
<br />
Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.<br />
<br />
The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop <ref name="ref1" />and is best combated by the deployment of genetic resistance <ref name="ref2" />.<br />
<br />
<br />
===Expression===<br />
editing<br />
We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.<br />
<br />
===Evolution===<br />
[[File:Selection of the Pi9 Alleles.png]]<ref name="ref3" /><br />
To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.<ref name="ref3" /><br />
<br />
<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
1.National Key Laboratory of Crop Genetic Improvement,<br />
2.National Center of Plant Gene Research and National<br />
3.Center of Crop Molecular Breeding, Huazhong<br />
4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan<br />
6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning<br />
<br />
==References==<br />
Please input cited references here.<br />
1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850.<br />
2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302<br />
3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688<br />
4. Zhao P，Feng R.R，Xiao Q Zh，Yang P.Zh，Lin. W，Liu P.Q，Li.RB,2013,Pyramiding brown planthopper genes, bph20（t）and bph21（t）,and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture，44（6）：885-892<br />
<br />
<references><br />
* <ref name="ref1">Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201</ref><br />
* <ref name="ref2">Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528</ref><br />
* <ref name="ref3">J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os06g0286700|<br />
Description = Similar to NBS-LRR disease resistance protein homologue|<br />
Version = NM_001063943.1 GI:115467617 GeneID:4340778|<br />
Length = 2957 bp|<br />
Definition = Oryza sativa Japonica Group Os06g0286700, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br />
AP = Chromosome 6:10386510..10389466|<br />
CDS = 10386510..10386566,10386662..10389466|<br />
GCID = <gbrowseImage1><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008399:10386510..10389466<br />
source=RiceChromosome06<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>|<br />
AA = <aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>|<br />
DNA = <dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063943.1 RefSeq:Os06g0286700]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 6]]<br />
[[Category:Chromosome 6]]</div>Cydtahttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Selection_of_the_Pi9_Alleles.png&diff=170973File:Selection of the Pi9 Alleles.png2014-05-23T01:55:48Z<p>Cydta: Sliding window analysis of nucleotide diversity (π) of the Pi9 Alleles.</p>
<hr />
<div>Sliding window analysis of nucleotide diversity (π) of the Pi9 Alleles.</div>Cydta