http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=Dangxx 2026-05-24T12:06:46Z User contributions MediaWiki 1.30.0 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184173 2014-06-25T08:37:32Z

<p>Dangxx: /* References */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184172 2014-06-25T08:36:41Z

<p>Dangxx: /* References */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> * &lt;ref name=&quot;ref1&quot;&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184171 2014-06-25T08:35:38Z

<p>Dangxx: /* References */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> * &lt;ref name=&quot;ref1&quot;&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184170 2014-06-25T08:34:52Z

<p>Dangxx: /* References */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184169 2014-06-25T08:33:33Z

<p>Dangxx: /* References */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> * &lt;ref name=&quot;ref1&quot;&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184168 2014-06-25T08:32:54Z

<p>Dangxx: /* Function */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184167 2014-06-25T08:31:40Z

<p>Dangxx: /* Function */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot; /&gt;:&lt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184166 2014-06-25T08:03:16Z

<p>Dangxx: /* Function */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;/ref&gt;&lt;ref&gt;...&lt;/ref&gt;:&lt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184165 2014-06-25T07:55:52Z

<p>Dangxx: /* Annotated Information */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;ref name=&quot;ref1&quot;&gt; &lt;ref name=&quot;ref1&quot;&gt;&lt;ref name=&quot;ref1&quot;&gt; &lt;ref name=&quot;ref1&quot;&gt;&lt;ref name=&quot;ref1&quot;&gt; &lt;ref name=&quot;ref1&quot;&gt; &lt;ref name=&quot;ref1&quot;&gt; &lt;ref name=&quot;ref1&quot;&gt;&lt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 . &lt;/ref&gt; <br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.1.jpg&diff=184164 2014-06-25T07:52:07Z

<p>Dangxx: uploaded a new version of &amp;quot;File:Fig.1.jpg&amp;quot;</p> <hr /> <div>oul1 has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial.<br /> Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184158 2014-06-23T06:57:27Z

<p>Dangxx: /* Expression */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 . &lt;/ref&gt; <br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184157 2014-06-23T06:56:59Z

<p>Dangxx: /* Expression */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 . &lt;/ref&gt; <br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, ''''''OsDIL''''''''Italic text'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=184156 2014-06-23T06:56:39Z

<p>Dangxx: /* Expression */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 . &lt;/ref&gt; <br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, '''OsDIL''' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172641 2014-05-26T03:27:40Z

<p>Dangxx: /* Labs working on this gene */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 . &lt;/ref&gt; <br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172640 2014-05-26T03:27:22Z

<p>Dangxx: /* Labs working on this gene */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 . &lt;/ref&gt; <br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172630 2014-05-26T03:12:02Z

<p>Dangxx: /* Function */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages &lt;ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 . &lt;/ref&gt; <br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172629 2014-05-26T03:10:11Z

<p>Dangxx: /* Function */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot;〉Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .&lt;/ref&gt; .<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172628 2014-05-26T03:09:40Z

<p>Dangxx: /* Function */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;ref name=&quot;ref1&quot;〉&lt;/ref&gt; .<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172626 2014-05-26T02:58:38Z

<p>Dangxx: /* Function */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references1 /&gt; .<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172623 2014-05-26T02:55:57Z

<p>Dangxx: /* Expression */</p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|450px|thumb|center|Fig1]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172620 2014-05-26T02:54:34Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|350px|thumb|left|Fig1]]<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172619 2014-05-26T02:53:33Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene. <br /> [[File:Fig.1.jpg|250px|thumb|left|Fig1]]<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172618 2014-05-26T02:52:53Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.[[File:Fig.1.jpg|150px|thumb|left|Fig1]]<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172617 2014-05-26T02:51:13Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene[[File:Fig.1.jpg|50px]].<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172614 2014-05-26T02:48:54Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene[[File:Fig.1.jpg]].<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.1.jpg&diff=172612 2014-05-26T02:44:32Z

<p>Dangxx: </p> <hr /> <div></div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.1.docx&diff=172610 2014-05-26T02:35:01Z

<p>Dangxx: </p> <hr /> <div>[[File:Fig.1 docx]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.1.docx&diff=172609 2014-05-26T02:33:38Z

<p>Dangxx: </p> <hr /> <div></div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172605 2014-05-26T02:22:59Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172603 2014-05-26T02:20:26Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, we examined the expression of OsDIL at the vegetative stage in response to different stresses. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172602 2014-05-26T02:20:09Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, we examined the expression of OsDIL at the vegetative stage in response to different stresses. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4 ……℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172601 2014-05-26T02:14:39Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, we examined the expression of OsDIL at the vegetative stage in response to different stresses. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4 �C) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172600 2014-05-26T02:08:46Z

<p>Dangxx: </p> <hr /> <div>''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172425 2014-05-25T14:53:14Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172421 2014-05-25T14:51:18Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein.<br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' (Os10g0148000) was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172417 2014-05-25T14:49:01Z

<p>Dangxx: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt; [1].<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172416 2014-05-25T14:48:24Z

<p>Dangxx: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt;1.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172415 2014-05-25T14:48:01Z

<p>Dangxx: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references 1/&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172414 2014-05-25T14:47:42Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages&lt;references /&gt;.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172412 2014-05-25T14:46:09Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt; Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253 .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172409 2014-05-25T14:45:27Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253...&lt;/ref&gt; .<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172408 2014-05-25T14:44:39Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt;Guo, C., et al. (2013). &quot;The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages.&quot; Plant Mol Biol 82(3): 239-253.<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172406 2014-05-25T14:42:04Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;ref&gt;...&lt;/ref&gt;<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172401 2014-05-25T14:25:21Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP. ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed<br /> less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages.<br /> <br /> ===Expression===<br /> ''OsDIL'' (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172391 2014-05-25T13:54:17Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> OsDIL is short for Oryza sativa Drought-Induced LTP.OsDIL (Os10g0148000) encoding a lipid transfer protein. Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and reproductive stages.<br /> <br /> ===Expression===<br /> OsDIL (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=172386 2014-05-25T13:45:26Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.plays a role in drought tolerance<br /> at vegetative and reproductive stages<br /> <br /> ===Expression===<br /> OsDIL (Os10g0148000) encoding a lipid transfer protein, OsDIL has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs.<br /> dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family (Fig. S2A).<br /> <br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0148000&diff=171877 2014-05-24T13:04:46Z

<p>Dangxx: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.plays a role in drought tolerance<br /> at vegetative and reproductive stages<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os10g0148000|<br /> Description = Plant lipid transfer/seed storage/trypsin-alpha amylase inhibitor domain containing protein|<br /> Version = NM_001070697.2 GI:297610101 GeneID:4348109|<br /> Length = 1111 bp|<br /> Definition = Oryza sativa Japonica Group Os10g0148000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|<br /> AP = Chromosome 10:2864478..2865588|<br /> CDS = 2864524..2864871|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008403:2864478..2865588<br /> source=RiceChromosome10<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MSQLKSSSLAALLIFLLAVFTTAAAAAGTECQNDVEVLKTTCYK FVEKDGPKLQPSPDCCTSMKGVNVPCVCTYLGSPGVRDNINMDKVFYVTKQCGIAIPG NCGGEQASLDWPH&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;47..394#ttaatcagagaagttcaagatatcagaaagaacaacacataccaggatgtctcagctcaagtcttctagcctggctgcactgctgatcttcctcctggcagtgttcaccactgcagcagcagcggcaggtacagaatgccagaacgatgtcgaggtgctgaagacaacctgctacaagttcgttgagaaggacgggccgaagctgcagccatcacctgactgctgcacctccatgaagggcgtcaacgtgccctgcgtctgcacctacctgggcagcccaggcgtcagggacaacatcaacatggataaggtgttctatgtcaccaagcagtgtggcatcgccatccccgggaactgcggaggtgagcaggcttcacttgattggccacactgatcacctgggtaagaactgacaataacacgccggctcctctggattgcgacttccagtggggcccaggtgtcggtgtcagctgggtaagttggtgtcatctggtatgggaaactttgatgttttgtacatgtggtggtgctcttgtcaacattatatagataaggagagaataggacaaacatgacgcttgaatagcagaagagaagttctatccagcaatatcaaaagtacagctgtcattttcaaaaaatgtaaaacaaaaataaaacgaaaaacccactatactagtgccaataaaagaagaaacaaaagagaactacattattgtcaatgccatttgttgatgttattattacttttgtttataagaataacaattgtacttataaggcctacgatttattacaggatccaaggtctaaaacaagaactgattgacttggtgaagttggctgacaaaagcaaggcacctagcagttgcacggctgatataggtaaataatgttggtcaacttttagagtacacggattgtacgtcaaccttcagcatgttgtgataacaaaatatgtatcaatgatggttgtctatatacactgaaaatgcaagagtatttttaaatcacatgttgtattgagtattgacccagctatcaactgtttgttgatgtgccctgttccttagtctgataaatgctaatatagcacattgctaaaagc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001070697.2 RefSeq:Os10g0148000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 10]]<br /> [[Category:Chromosome 10]]</div>

Dangxx