RiceWiki - User contributions [en]

Os02g0677300

2014-06-04T02:26:31Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.Gene expression profiling analysis shows that the CBF genes of rice can upstream the express of stress tolerance genes to enhance the cold tolerance of transgenic rice,like OsP5CS,OsLIP5,Os-LIP9,OsRAmy3D and so on.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice<ref name="ref8"/>, <ref name="ref9"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref9"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4[[File: expression.jpg‎‎|left|thumb|350px|Table : Time-course expression of rice genes and candidate downstream genes in the process of acclimation.]], the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref8"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain[1].we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position and a conserved glutamic acid in V19 position, which play important roles in DNA-binding specificity.At the same time,V14 is a great important for the transcriptional activity of CBF protein.

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
9.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-06-04T02:26:08Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.Gene expression profiling analysis shows that the CBF genes of rice can upstream the express of stress tolerance genes to enhance the cold tolerance of transgenic rice,like OsP5CS,OsLIP5,Os-LIP9,OsRAmy3D and so on.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice<ref name="ref8"/>, <ref name="ref9"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref9"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4[[File: expression.jpg‎‎|left|thumb|350px|Table : Time-course expression of rice genes and candidate downstream genes in the process of acclimation.]], the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref8"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain[1].we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position and a conserved glutamic acid in V19 position, which play important roles in DNA-binding specificity.At the same time,V14 is a great important for the transcriptional activity of CBF protein.

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-06-04T02:21:42Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.Gene expression profiling analysis shows that the CBF genes of rice can upstream the express of stress tolerance genes to enhance the cold tolerance of transgenic rice,like OsP5CS,OsLIP5,Os-LIP9,OsRAmy3D and so on.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4[[File: expression.jpg‎‎|left|thumb|150px|Table : Time-course expression of rice genes and candidate downstream genes in the process of acclimation.]], the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref9"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain[1].we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position and a conserved glutamic acid in V19 position, which play important roles in DNA-binding specificity.At the same time,V14 is a great important for the transcriptional activity of CBF protein.

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-06-04T02:16:15Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.Gene expression profiling analysis shows that the CBF genes of rice can upstream the express of stress tolerance genes to enhance the cold tolerance of transgenic rice,like OsP5CS,OsLIP5,Os-LIP9,OsRAmy3D and so on.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4[[File:expression.jpg‎|frame|'''Figure 4''' Time-course expression of rice genes and candidate downstream genes in the process of acclimation], the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref9"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain[1].we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position and a conserved glutamic acid in V19 position, which play important roles in DNA-binding specificity.At the same time,V14 is a great important for the transcriptional activity of CBF protein.

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-06-04T02:14:14Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.Gene expression profiling analysis shows that the CBF genes of rice can upstream the express of stress tolerance genes to enhance the cold tolerance of transgenic rice,like OsP5CS,OsLIP5,Os-LIP9,OsRAmy3D and so on.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4[[File:expression.jpg‎|frame|'''Figure 4''' Time-course expression of rice genes and candidate downstream genes in the process of acclimation, the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref9"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain[1].we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position and a conserved glutamic acid in V19 position, which play important roles in DNA-binding specificity.At the same time,V14 is a great important for the transcriptional activity of CBF protein.

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

File:Expression.jpg

2014-06-04T02:05:42Z

Fengdongmoqing: uploaded a new version of "File:Expression.jpg"

Os02g0677300

2014-05-31T07:17:05Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4, the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref9"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T07:15:28Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4, the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref9"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T07:13:53Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4, the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref9"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.

5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.

6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.

7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.

8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.

9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.

10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T07:11:52Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name="ref5"/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4, the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name="ref9"/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat
cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T07:08:49Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.
CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies <ref name=”ref5”/>. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4, the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes<ref name=”ref9”/>. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat
cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T07:02:43Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref10"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat
cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T07:00:26Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref11"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414.
5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917.
6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919.
7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat
cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197.
8.Kato-Noguchi H. 2008. Low temperature acclimation mediated by ethanol production is essential for chilling tolerance in rice roots. Plant Signal Behav, 3: 202–203.
9.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
10.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:38:25Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>, <ref name="ref6"/>, <ref name="ref7"/>, <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>,<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D<ref name="ref11"/>.The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
5.Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
6.Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
7.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:36:33Z

Fengdongmoqing: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>; <ref name="ref6"/>; <ref name="ref7"/>; <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>;<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
5.Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
6.Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
7.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:34:25Z

Fengdongmoqing: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name="ref1"/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>; <ref name="ref6"/>; <ref name="ref7"/>; <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>;<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
5.Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
6.Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
7.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:32:52Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name="ref1"/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>; <ref name="ref6"/>; <ref name="ref7"/>; <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>;<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
2.Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
4.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
5.Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
6.Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
7.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:29:01Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name="ref1"/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name="ref1"/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name="ref2"/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name="ref3"/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name="ref4"/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name="ref5"/>; <ref name="ref6"/>; <ref name="ref7"/>; <ref name="ref8"/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name="ref9"/>;<ref name="ref10"/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:24:39Z

Fengdongmoqing: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name="ref1"/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:24:01Z

Fengdongmoqing: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name="ref1"/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants<ref name=”ref2”/>.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:23:25Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name=”ref1”/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants<ref name=”ref2”/>.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==

1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:23:10Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name=”ref1”/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants<ref name=”ref2”/>.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.
1. The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T04:22:45Z

Fengdongmoqing: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name=”ref1”/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants<ref name=”ref2”/>.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.
The rice research institute of Sichuan Agricultural University
Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim
Biophys Acta, 1799: 454–462.
Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819.
Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054.
Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763.
Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690.
Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112.
Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T02:20:01Z

Fengdongmoqing: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name=”ref1”/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants<ref name=”ref2”/>.

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T02:13:23Z

Fengdongmoqing: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation(Thomashow, 2010).The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants[1].

===Expression===
Please input expression information here.
CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation<ref name=”ref1”/>. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes <ref name=”ref2”/>. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) <ref name=”ref3”/>. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes <ref name=”ref4”/>. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato<ref name=”ref5”/>; <ref name=”ref6”/>; <ref name=”ref7”/>; <ref name=”ref8”/>. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice <ref name=”ref9”/>;<ref name=”ref10”/>.Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Os02g0677300

2014-05-31T01:21:47Z

Fengdongmoqing: /* Function */

Os02g0677300

2014-05-30T09:11:34Z

Fengdongmoqing: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
OsCBF3

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0677300|
Description = Similar to CRT/DRE binding factor 1|
Version = NM_001054262.1 GI:115447894 GeneID:4330306|
Length = 1272 bp|
Definition = Oryza sativa Japonica Group Os02g0677300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:28539796..28541067|
CDS = 28539841..28540515|
GCID = <gbrowseImage1>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:28539796..28541067
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>|
AA = <aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>|
DNA = <dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054262.1 RefSeq:Os02g0677300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]