RiceWiki - User contributions [en]

Os01g0733200

2014-05-31T03:56:05Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]
=== Knowledge Extension ===
A typical Hsf protein contains a modular structure with an N-terminal DNA-binding domain (DBD), an adjacent bipartite oligomerization domain composed of heptads repeat of hydrophobic amino acid residues (HR-A/B), a nuclear localization signal (NLS) essential for nuclear uptake of the protein, a nuclear export signal (NES),and in many cases a less conserved C-terminal activation domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids (AHA) that have been reported
to be crucial for activation function<ref name="ref4" />.Based on the conservative DBD and the HR-A/B regions, 21 putative Hsfs from the Arabidopsis,23 from rice, and 18 from tomato have been identified through the genome-wide analysis. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
their protein structures<ref name="ref4" />.HsfA and HsfC have insertions of 21 and 7 amino acids, between the hydrophobic regions HR-A and HR-B,respectively. HsfB and HsfC are also characterized bylack of AHA motifs in their C-terminal regions(CTRs).

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany

Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany

CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France

State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China

National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China

State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China

Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

Biocenter of the Goethe University, Frankfurt/Main, Germany
==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
<ref name="ref4">Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A.,Scharf, K.D. et al.(2001)Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?Cell Stress Chaperones 6:177-89.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>
1 mmggeckvhq lqaagdggpg avapfvaktf hmvsdpstna vvrwggagnt flvldpaafs
61 dfllpsyfkh rnfasfvrql ntygfrkvdp drwefahesf lrgqaqllpr ivrkkkkgga
121 apgcrelcee geevrgtiea vqrlreeqrg meeelqamdq rlraaesrpg qmmaflakla
181 depgvvlram lakkeelaaa gnngsdpckr rrigadtgrg gvatggdaae maqsrgtvpf
241 pfsvlgqvfy</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-30T15:19:10Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions.In contrast to class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]
=== Knowledge Extension ===
A typical Hsf protein contains a modular structure with an N-terminal DNA-binding domain (DBD), an adjacent bipartite oligomerization domain composed of heptads repeat of hydrophobic amino acid residues (HR-A/B), a nuclear localization signal (NLS) essential for nuclear uptake of the protein, a nuclear export signal (NES),and in many cases a less conserved C-terminal activation domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids (AHA) that have been reported
to be crucial for activation function<ref name="ref4" />.Based on the conservative DBD and the HR-A/B regions, 21 putative Hsfs from the Arabidopsis,23 from rice, and 18 from tomato have been identified through the genome-wide analysis. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
their protein structures<ref name="ref4" />.HsfA and HsfC have insertions of 21 and 7 amino acids, between the hydrophobic regions HR-A and HR-B,respectively. HsfB and HsfC are also characterized bylack of AHA motifs in their C-terminal regions(CTRs).

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany

Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany

CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France

State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China

National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China

State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China

Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

Biocenter of the Goethe University, Frankfurt/Main, Germany
==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
<ref name="ref4">Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A.,Scharf, K.D. et al.(2001)Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?Cell Stress Chaperones 6:177-89.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>
1 mmggeckvhq lqaagdggpg avapfvaktf hmvsdpstna vvrwggagnt flvldpaafs
61 dfllpsyfkh rnfasfvrql ntygfrkvdp drwefahesf lrgqaqllpr ivrkkkkgga
121 apgcrelcee geevrgtiea vqrlreeqrg meeelqamdq rlraaesrpg qmmaflakla
181 depgvvlram lakkeelaaa gnngsdpckr rrigadtgrg gvatggdaae maqsrgtvpf
241 pfsvlgqvfy</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-30T14:46:24Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]
=== Knowledge Extension ===
A typical Hsf protein contains a modular structure with an N-terminal DNA-binding domain (DBD), an adjacent bipartite oligomerization domain composed of heptads repeat of hydrophobic amino acid residues (HR-A/B), a nuclear localization signal (NLS) essential for nuclear uptake of the protein, a nuclear export signal (NES),and in many cases a less conserved C-terminal activation domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids (AHA) that have been reported
to be crucial for activation function<ref name="ref4" />.Based on the conservative DBD and the HR-A/B regions, 21 putative Hsfs from the Arabidopsis,23 from rice, and 18 from tomato have been identified through the genome-wide analysis. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
their protein structures<ref name="ref4" />.HsfA and HsfC have insertions of 21 and 7 amino acids, between the hydrophobic regions HR-A and HR-B,respectively. HsfB and HsfC are also characterized bylack of AHA motifs in their C-terminal regions(CTRs).

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany

Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany

CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France

State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China

National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China

State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China

Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

Biocenter of the Goethe University, Frankfurt/Main, Germany
==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
<ref name="ref4">Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A.,Scharf, K.D. et al.(2001)Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?Cell Stress Chaperones 6:177-89.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>
1 mmggeckvhq lqaagdggpg avapfvaktf hmvsdpstna vvrwggagnt flvldpaafs
61 dfllpsyfkh rnfasfvrql ntygfrkvdp drwefahesf lrgqaqllpr ivrkkkkgga
121 apgcrelcee geevrgtiea vqrlreeqrg meeelqamdq rlraaesrpg qmmaflakla
181 depgvvlram lakkeelaaa gnngsdpckr rrigadtgrg gvatggdaae maqsrgtvpf
241 pfsvlgqvfy</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-29T08:57:52Z

FuhinWong: /* Knowledge Extension */

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]
=== Knowledge Extension ===
A typical Hsf protein contains a modular structure with an N-terminal DNA-binding domain (DBD), an adjacent bipartite oligomerization domain composed of heptads repeat of hydrophobic amino acid residues (HR-A/B), a nuclear localization signal (NLS) essential for nuclear uptake of the protein, a nuclear export signal (NES),and in many cases a less conserved C-terminal activation domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids (AHA) that have been reported
to be crucial for activation function<ref name="ref4" />.Based on the conservative DBD and the HR-A/B regions, 21 putative Hsfs from the Arabidopsis,23 from rice, and 18 from tomato have been identified through the genome-wide analysis. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
their protein structures<ref name="ref4" />.HsfA and HsfC have insertions of 21 and 7 amino acids, between the hydrophobic regions HR-A and HR-B,respectively. HsfB and HsfC are also characterized bylack of AHA motifs in their C-terminal regions(CTRs).

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany

Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany

CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France

State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China

National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China

State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China

Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

Biocenter of the Goethe University, Frankfurt/Main, Germany
==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
<ref name="ref4">Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A.,Scharf, K.D. et al.(2001)Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?Cell Stress Chaperones 6:177-89.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-29T08:48:45Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]
=== Knowledge Extension ===
A typical Hsf protein contains a modular structure with an N-terminal DNA-binding domain (DBD), an adjacent bipartite oligomerization domain composed of heptads repeat of hydrophobic amino acid residues (HR-A/B), a nuclear localization signal (NLS) essential for nuclear uptake of the protein, a nuclear export signal (NES),and in many cases a less conserved C-terminal activation domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids (AHA) that have been reported
to be crucial for activation function<ref name="ref4" />.Based on the conservative DBD and the HR-A/B regions, 21 putative Hsfs from the Arabidopsis,23 from rice, and 18 from tomato have been identified through the genome-wide analysis. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
their protein structures<ref name="ref4" />.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany

Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany

CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France

State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China

National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China

State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China

Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

Biocenter of the Goethe University, Frankfurt/Main, Germany
==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
<ref name="ref4">Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A.,Scharf, K.D. et al.(2001)Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?Cell Stress Chaperones 6:177-89.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-29T08:46:47Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]
=== Knowledge Extension ===
A typical Hsf protein contains a modular structure with an N-terminal DNA-binding domain (DBD), an adjacent bipartite oligomerization domain composed of heptads repeat of hydrophobic amino acid residues (HR-A/B), a nuclear localization signal (NLS) essential for nuclear uptake of the protein, a nuclear export signal (NES),and in many cases a less conserved C-terminal activation domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids (AHA) that have been reported
to be crucial for activation function<ref name="ref4" />.Based on the conservative DBD and the HR-A/B regions, 21 putative Hsfs from the Arabidopsis,23 from rice, and 18 from tomato have been identified through the genome-wide analysis. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
their protein structures<ref name="ref4" />.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China
Biocenter of the Goethe University, Frankfurt/Main, Germany
==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
<ref name="ref4">Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A.,Scharf, K.D. et al.(2001)Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?Cell Stress Chaperones 6:177-89.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-29T08:02:43Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-29T08:02:01Z

FuhinWong: Blanked the page

Os01g0733200

2014-05-29T07:54:40Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#
1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
1201 tattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T14:27:52Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

==References==
<references>
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T14:20:40Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
[[File:tileshop.jpg]]

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

==References==
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T14:13:13Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.

OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them (Fig.1). As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs
were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B (Fig.1)<ref name="ref3" />.
[[File:tileshop.jpg]]

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

==References==
<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T13:25:40Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.
OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated
in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.
OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them (Fig.1). As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs
were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B (Fig.1)<ref name="ref3" />.[[File:tileshop.jpg]]

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

==References==
1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.
2.Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.
3.Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:Tileshop.jpg

2014-05-28T13:15:44Z

FuhinWong:

Os01g0733200

2014-05-28T13:12:44Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.
Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.
OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated
in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.
OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.

===Evolution===
To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them (Fig.1). As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs
were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B (Fig.1)<ref name="ref3" />.[[File:tileshop.jpg]]

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
Graduate School of the Chinese Academy of Sciences, Beijing 100039, China

==References==
1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.
2.Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.
3.Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T10:26:16Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and
development in Oryza sativa ssp. japonica.——FuhinWong（2014）
==Annotated Information==
===Function===
OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice. Furthermore, OsHsfC1b is
involved in the response to osmotic stress and is required for plant growth under non-stress
conditions.

===Expression===
Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2.

===Evolution===
Impaired
function of OsHsfC1b in the hsfc1b mutant and the amiRNA lines led to decreased salt and
osmotic stress tolerance, increased sensitivity to ABA, and temporal misregulation of saltresponsive
genes involved in signalling and ion homeostasis.

You can also add sub-section(s) at will.

==Labs working on this gene==
Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China

==References==
1.Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T08:02:20Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and
development in Oryza sativa ssp. japonica.——FuhinWong（2014）
==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T08:01:20Z

FuhinWong:

The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and
development in Oryza sativa ssp. japonica.——FuhinWong
==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0733200

2014-05-28T07:52:32Z

FuhinWong:

Please input one-sentence summary here.
The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and
development in Oryza sativa ssp. japonica.
==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0733200|
Description = Similar to Heat shock transcription factor 29 (Fragment)|
Version = NM_001050695.1 GI:115439760 GeneID:4324158|
Length = 1210 bp|
Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:32338331..32339540|
CDS = 32338482..32338730,32338840..32339343|
GCID = <gbrowseImage1>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:32338331..32339540
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
DNA = <dnaseqindica>152..400#510..1013#gcgcgctcactccctcccttgcccccaccgacgaacggaacaaatcttagcgaggaaaaagcgagcgcttttttcttatcctgttccgcgggcgcgctgccacgaccgaaccgggaggatacttgcgaattacacgatcggttgtggcactatgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacgtatgtatatgcgcctcctctgcttctgccatctgtgcatagctctgtgtgtggcttcgtgtgtcgtcatggttgtaactctttccgttgctgctgtcttctctctcagggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactagccgcaacagggccagataggtgtacacgtacgcagtcccccgttgtatatataacaacagtgtaacttcgcctcggtttagttgcctactgttaagttagtgtacttaagcataataggagagtttggctaagtagctatcgttggatttgtgtgtatatatcgactatcgaggggctaataacgcctattttgttc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os04g0568700

2014-05-28T07:22:29Z

FuhinWong:

==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0568700|
Description = Similar to Heat stress transcription factor Spl7 (Heat shock transcription factor) (Heat shock factor RHSF10)|
Version = NM_001060126.1 GI:115459981 GeneID:4336701|
Length = 1274 bp|
Definition = Oryza sativa Japonica Group Os04g0568700, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:28972921..28974194|
CDS = 28972991..28973197,28973300..28974010|
GCID = <gbrowseImage1>
name=NC_008397:28972921..28974194
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:28972921..28974194
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgtcgccggcggcggggacgccgccgttcttgacgaagacgtacgcgatggtggaggacccgagcaccgatgagaccatctcgtggaacgactccggcacggccttcgtggtgtggcgccccgccgagttcgcccgcgacctcctccccaagcacttcaagcacagcaacttctcctccttcgtgcgccagctcaacacctacggattcaagaaggtggtggcggataggtgggagttcgccaacgactgcttcaggagaggggagaagcacctgctcggtgggatacagaggcggaaggggtctgggaccggaggcgcgggggcggcgccggcggggggcataccgacggcgataccgatctcgtccccgccgacgagctccggcggggagcccgcggtgtcgtcgtcgccgccgcgcggggcggcggggatcgcggcgggggtgagcggcgcggtggccgagctggaggaggagaacgcccggctgcggcgagagaacgcgaggctggcgcgggagctggcacgcgcgcggcgggtctgcgacggcgtgcggcgcctcgtgtcgcggtacgaccacgaccacggcggcggggaggaggaagcgggggagggcgacgtgaagccgatgctgttcggcgtggcgatcggcggcaaaagatcgcgcgaggagaacggggaagacgaggaggaggaggaggaggaaggggctgacgaggacggcgaagacgatgaggtggaggaagacgacgaggagagagagaggcacgcggcgcggcgggtccccgtgagggaggggaaggtcaggaggacgacggagctgtcggatctggacgtgctcgcgctgtccgtgcgggcggcggccgcggcgaggccgggcggggcctcccgtgaccgcaagagctcggtctcgtaa</cdnaseq>|
AA = <aaseq>MASPAAGTPPFLTKTYAMVEDPSTDETISWNDSGTAFVVWRPAE FARDLLPKHFKHSNFSSFVRQLNTYGFKKVVADRWEFANDCFRRGEKHLLGGIQRRKG SGTGGAGAAPAGGIPTAIPISSPPTSSGGEPAVSSSPPRGAAGIAAGVSGAVAELEEE NARLRRENARLARELARARRVCDGVRRLVSRYDHDHGGGEEEAGEGDVKPMLFGVAIG GKRSREENGEDEEEEEEEGADEDGEDDEVEEDDEERERHAARRVPVREGKVRRTTELS DLDVLALSVRAAAAARPGGASRDRKSSVS</aaseq>|
DNA = <dnaseqindica>71..277#380..1090#ctctctggatcttcttctccgtctcctccccggtctcgtgtgagcgctactcccggcccacaggttcttcatggcgtcgccggcggcggggacgccgccgttcttgacgaagacgtacgcgatggtggaggacccgagcaccgatgagaccatctcgtggaacgactccggcacggccttcgtggtgtggcgccccgccgagttcgcccgcgacctcctccccaagcacttcaagcacagcaacttctcctccttcgtgcgccagctcaacacctacgtgcgtctccctccgctgaacactctctctccccctctctaatctcagtttggtttcggtagatcgacgagttttccgacagatttgcgtgtgttggtgcagggattcaagaaggtggtggcggataggtgggagttcgccaacgactgcttcaggagaggggagaagcacctgctcggtgggatacagaggcggaaggggtctgggaccggaggcgcgggggcggcgccggcggggggcataccgacggcgataccgatctcgtccccgccgacgagctccggcggggagcccgcggtgtcgtcgtcgccgccgcgcggggcggcggggatcgcggcgggggtgagcggcgcggtggccgagctggaggaggagaacgcccggctgcggcgagagaacgcgaggctggcgcgggagctggcacgcgcgcggcgggtctgcgacggcgtgcggcgcctcgtgtcgcggtacgaccacgaccacggcggcggggaggaggaagcgggggagggcgacgtgaagccgatgctgttcggcgtggcgatcggcggcaaaagatcgcgcgaggagaacggggaagacgaggaggaggaggaggaggaaggggctgacgaggacggcgaagacgatgaggtggaggaagacgacgaggagagagagaggcacgcggcgcggcgggtccccgtgagggaggggaaggtcaggaggacgacggagctgtcggatctggacgtgctcgcgctgtccgtgcgggcggcggccgcggcgaggccgggcggggcctcccgtgaccgcaagagctcggtctcgtaacggttgttgacttgctgttgattttatatgcggcgtaaaactgagaaaattggatggcacatgagccaaattgaattgtagttcgtaccagtaccaagcaaactgcagccactttacagggtactaaactatactttcgggagtagtaggaacattgtagccttggttgtcatgatgatgtaaa</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060126.1 RefSeq:Os04g0568700]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0568700

2014-05-28T02:03:11Z

FuhinWong:

'''Please cite:''' Fuhin Wong(2014)
==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0568700|
Description = Similar to Heat stress transcription factor Spl7 (Heat shock transcription factor) (Heat shock factor RHSF10)|
Version = NM_001060126.1 GI:115459981 GeneID:4336701|
Length = 1274 bp|
Definition = Oryza sativa Japonica Group Os04g0568700, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:28972921..28974194|
CDS = 28972991..28973197,28973300..28974010|
GCID = <gbrowseImage1>
name=NC_008397:28972921..28974194
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:28972921..28974194
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgtcgccggcggcggggacgccgccgttcttgacgaagacgtacgcgatggtggaggacccgagcaccgatgagaccatctcgtggaacgactccggcacggccttcgtggtgtggcgccccgccgagttcgcccgcgacctcctccccaagcacttcaagcacagcaacttctcctccttcgtgcgccagctcaacacctacggattcaagaaggtggtggcggataggtgggagttcgccaacgactgcttcaggagaggggagaagcacctgctcggtgggatacagaggcggaaggggtctgggaccggaggcgcgggggcggcgccggcggggggcataccgacggcgataccgatctcgtccccgccgacgagctccggcggggagcccgcggtgtcgtcgtcgccgccgcgcggggcggcggggatcgcggcgggggtgagcggcgcggtggccgagctggaggaggagaacgcccggctgcggcgagagaacgcgaggctggcgcgggagctggcacgcgcgcggcgggtctgcgacggcgtgcggcgcctcgtgtcgcggtacgaccacgaccacggcggcggggaggaggaagcgggggagggcgacgtgaagccgatgctgttcggcgtggcgatcggcggcaaaagatcgcgcgaggagaacggggaagacgaggaggaggaggaggaggaaggggctgacgaggacggcgaagacgatgaggtggaggaagacgacgaggagagagagaggcacgcggcgcggcgggtccccgtgagggaggggaaggtcaggaggacgacggagctgtcggatctggacgtgctcgcgctgtccgtgcgggcggcggccgcggcgaggccgggcggggcctcccgtgaccgcaagagctcggtctcgtaa</cdnaseq>|
AA = <aaseq>MASPAAGTPPFLTKTYAMVEDPSTDETISWNDSGTAFVVWRPAE FARDLLPKHFKHSNFSSFVRQLNTYGFKKVVADRWEFANDCFRRGEKHLLGGIQRRKG SGTGGAGAAPAGGIPTAIPISSPPTSSGGEPAVSSSPPRGAAGIAAGVSGAVAELEEE NARLRRENARLARELARARRVCDGVRRLVSRYDHDHGGGEEEAGEGDVKPMLFGVAIG GKRSREENGEDEEEEEEEGADEDGEDDEVEEDDEERERHAARRVPVREGKVRRTTELS DLDVLALSVRAAAAARPGGASRDRKSSVS</aaseq>|
DNA = <dnaseqindica>71..277#380..1090#ctctctggatcttcttctccgtctcctccccggtctcgtgtgagcgctactcccggcccacaggttcttcatggcgtcgccggcggcggggacgccgccgttcttgacgaagacgtacgcgatggtggaggacccgagcaccgatgagaccatctcgtggaacgactccggcacggccttcgtggtgtggcgccccgccgagttcgcccgcgacctcctccccaagcacttcaagcacagcaacttctcctccttcgtgcgccagctcaacacctacgtgcgtctccctccgctgaacactctctctccccctctctaatctcagtttggtttcggtagatcgacgagttttccgacagatttgcgtgtgttggtgcagggattcaagaaggtggtggcggataggtgggagttcgccaacgactgcttcaggagaggggagaagcacctgctcggtgggatacagaggcggaaggggtctgggaccggaggcgcgggggcggcgccggcggggggcataccgacggcgataccgatctcgtccccgccgacgagctccggcggggagcccgcggtgtcgtcgtcgccgccgcgcggggcggcggggatcgcggcgggggtgagcggcgcggtggccgagctggaggaggagaacgcccggctgcggcgagagaacgcgaggctggcgcgggagctggcacgcgcgcggcgggtctgcgacggcgtgcggcgcctcgtgtcgcggtacgaccacgaccacggcggcggggaggaggaagcgggggagggcgacgtgaagccgatgctgttcggcgtggcgatcggcggcaaaagatcgcgcgaggagaacggggaagacgaggaggaggaggaggaggaaggggctgacgaggacggcgaagacgatgaggtggaggaagacgacgaggagagagagaggcacgcggcgcggcgggtccccgtgagggaggggaaggtcaggaggacgacggagctgtcggatctggacgtgctcgcgctgtccgtgcgggcggcggccgcggcgaggccgggcggggcctcccgtgaccgcaagagctcggtctcgtaacggttgttgacttgctgttgattttatatgcggcgtaaaactgagaaaattggatggcacatgagccaaattgaattgtagttcgtaccagtaccaagcaaactgcagccactttacagggtactaaactatactttcgggagtagtaggaacattgtagccttggttgtcatgatgatgtaaa</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060126.1 RefSeq:Os04g0568700]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0568700

2014-05-18T06:56:39Z

FuhinWong:

Please cite: Fuhin Wong(2014)
==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0568700|
Description = Similar to Heat stress transcription factor Spl7 (Heat shock transcription factor) (Heat shock factor RHSF10)|
Version = NM_001060126.1 GI:115459981 GeneID:4336701|
Length = 1274 bp|
Definition = Oryza sativa Japonica Group Os04g0568700, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:28972921..28974194|
CDS = 28972991..28973197,28973300..28974010|
GCID = <gbrowseImage1>
name=NC_008397:28972921..28974194
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:28972921..28974194
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgtcgccggcggcggggacgccgccgttcttgacgaagacgtacgcgatggtggaggacccgagcaccgatgagaccatctcgtggaacgactccggcacggccttcgtggtgtggcgccccgccgagttcgcccgcgacctcctccccaagcacttcaagcacagcaacttctcctccttcgtgcgccagctcaacacctacggattcaagaaggtggtggcggataggtgggagttcgccaacgactgcttcaggagaggggagaagcacctgctcggtgggatacagaggcggaaggggtctgggaccggaggcgcgggggcggcgccggcggggggcataccgacggcgataccgatctcgtccccgccgacgagctccggcggggagcccgcggtgtcgtcgtcgccgccgcgcggggcggcggggatcgcggcgggggtgagcggcgcggtggccgagctggaggaggagaacgcccggctgcggcgagagaacgcgaggctggcgcgggagctggcacgcgcgcggcgggtctgcgacggcgtgcggcgcctcgtgtcgcggtacgaccacgaccacggcggcggggaggaggaagcgggggagggcgacgtgaagccgatgctgttcggcgtggcgatcggcggcaaaagatcgcgcgaggagaacggggaagacgaggaggaggaggaggaggaaggggctgacgaggacggcgaagacgatgaggtggaggaagacgacgaggagagagagaggcacgcggcgcggcgggtccccgtgagggaggggaaggtcaggaggacgacggagctgtcggatctggacgtgctcgcgctgtccgtgcgggcggcggccgcggcgaggccgggcggggcctcccgtgaccgcaagagctcggtctcgtaa</cdnaseq>|
AA = <aaseq>MASPAAGTPPFLTKTYAMVEDPSTDETISWNDSGTAFVVWRPAE FARDLLPKHFKHSNFSSFVRQLNTYGFKKVVADRWEFANDCFRRGEKHLLGGIQRRKG SGTGGAGAAPAGGIPTAIPISSPPTSSGGEPAVSSSPPRGAAGIAAGVSGAVAELEEE NARLRRENARLARELARARRVCDGVRRLVSRYDHDHGGGEEEAGEGDVKPMLFGVAIG GKRSREENGEDEEEEEEEGADEDGEDDEVEEDDEERERHAARRVPVREGKVRRTTELS DLDVLALSVRAAAAARPGGASRDRKSSVS</aaseq>|
DNA = <dnaseqindica>71..277#380..1090#ctctctggatcttcttctccgtctcctccccggtctcgtgtgagcgctactcccggcccacaggttcttcatggcgtcgccggcggcggggacgccgccgttcttgacgaagacgtacgcgatggtggaggacccgagcaccgatgagaccatctcgtggaacgactccggcacggccttcgtggtgtggcgccccgccgagttcgcccgcgacctcctccccaagcacttcaagcacagcaacttctcctccttcgtgcgccagctcaacacctacgtgcgtctccctccgctgaacactctctctccccctctctaatctcagtttggtttcggtagatcgacgagttttccgacagatttgcgtgtgttggtgcagggattcaagaaggtggtggcggataggtgggagttcgccaacgactgcttcaggagaggggagaagcacctgctcggtgggatacagaggcggaaggggtctgggaccggaggcgcgggggcggcgccggcggggggcataccgacggcgataccgatctcgtccccgccgacgagctccggcggggagcccgcggtgtcgtcgtcgccgccgcgcggggcggcggggatcgcggcgggggtgagcggcgcggtggccgagctggaggaggagaacgcccggctgcggcgagagaacgcgaggctggcgcgggagctggcacgcgcgcggcgggtctgcgacggcgtgcggcgcctcgtgtcgcggtacgaccacgaccacggcggcggggaggaggaagcgggggagggcgacgtgaagccgatgctgttcggcgtggcgatcggcggcaaaagatcgcgcgaggagaacggggaagacgaggaggaggaggaggaggaaggggctgacgaggacggcgaagacgatgaggtggaggaagacgacgaggagagagagaggcacgcggcgcggcgggtccccgtgagggaggggaaggtcaggaggacgacggagctgtcggatctggacgtgctcgcgctgtccgtgcgggcggcggccgcggcgaggccgggcggggcctcccgtgaccgcaagagctcggtctcgtaacggttgttgacttgctgttgattttatatgcggcgtaaaactgagaaaattggatggcacatgagccaaattgaattgtagttcgtaccagtaccaagcaaactgcagccactttacagggtactaaactatactttcgggagtagtaggaacattgtagccttggttgtcatgatgatgtaaa</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060126.1 RefSeq:Os04g0568700]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]