RiceWiki - User contributions [en]

Atp1

2014-06-06T02:43:38Z

Hailin Li:

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{Mitochondrion|
GeneName = atp1|
Annotated Information = protein coding; the gene of protein Atp1(ATP synthase F0 subunit 1).|
Function = Involved in the synthesis of ATP|This is one of the mitochondrial-encoded genes, which encodes one of the ATP sythases of the respiratory chain.Encode the αsubunit of F1.
Expression = With the in vitro capping method, ribonuclease protection experiments and from primer extension analysis, it has been prove that rice atp1 is transcribed from multiple initiation sites.Further experiments prove that there are at least eight transcription initiation sites of the rice mitochondrial atp1 gene. This only exist in rice atp1 gene, which are different from other plant species, such as wheat , maize and ''Oenothera''. Rice atp1 is present in a unique environment and is transcribed at a high level. The multiple initiation sites of the rice mitochondrial atp1 gene is also regulated in different ways.|
Evolution = R1c might have evolved from R1b through elimination of its partial segments at the end containing the atp1 gene, which was integrated in the soybean genome at another location.The mitochondrial DNA is more conservative and the evolution rate of chloroplast DNA is higher than mitochondrial DNA in rice.|During the evolution peocess, the majarity of the mitochondria genetics content were transferred into the nucleus of the cell.Mitochondrial biogenesis today relies on the coordinated regulation of both the nuclear genomes and the mitochondrial genomes. So the expression of rice atp1 now is influence by bothe the nuclear genomes and the mitochondrial genomes.
Labs wodking on this gene = Laboratory of Plant Molecular Genetics; Key Laboratory of Crop Heterosis and Utilization of Ministry of Education; Beijing Key Laboratory of Crop Genetic Improvement; Key Laboratory of MOE for Plant Developmental Biology; State Key Laboratory of Pharmaceutical Biotechnology; Key Laboratory of Tea Biochemistry and Biotechnology; MOE Key Laboratory of Bioinformatics and Bioinformatics Div. TNLIST.|Laboratory of Radiation Genetics, Faculty of Agriculture, The University
of Tokyo. Laboratory of Plant Breeding, Faculty of Agriculture, The University
of Tokyo.
References = Notsu Y, Masood S, Nishikawa T, et al. The complete sequence of the rice (Oryza sativa L.) mitochondrial genome: frequent DNA sequence acquisition and loss during the evolution of flowering plants[J]. Molecular Genetics and Genomics, 2002, 268(4): 434-445.
Wei X, Wang R, Cao L, et al. Origin of Oryza sativa in China inferred by nucleotide polymorphisms of organelle DNA[J]. PloS one, 2012, 7(11): e49546.
Li S, Yang D, Zhu Y. Characterization and use of male sterility in hybrid rice breeding[J]. Journal of Integrative Plant Biology, 2007, 49(6): 791-804.
Tan Y P, Li S Q, Xie H W, et al. Genetical and molecular analysis reveals a cooperating relationship between cytoplasmic male sterility-and fertility restoration-related genes in Oryza species[J]. Theoretical and Applied Genetics, 2011, 122(1): 9-19.
Wang B, Yuan J, Liu J, et al. Codon usage bias and determining forces in green plant mitochondrial genomes[J]. Journal of integrative plant biology, 2011, 53(4): 324-334.
Pasentsis K, Falara V, Pateraki I, et al. Identification and expression profiling of low oxygen regulated genes from Citrus flavedo tissues using RT-PCR differential display[J]. Journal of experimental botany, 2007, 58(8): 2203-2216.
Duroux L, Welinder K G. The peroxidase gene family in plants: a phylogenetic overview[J]. Journal of molecular evolution, 2003, 57(4): 397-407.
Zhu L, Deng W W, Ye A H, et al. Cloning of two cDNAs encoding a family of ATP sulfurylase from Camellia sinensis related to selenium or sulfur metabolism and functional expression in Escherichia coli[J]. Plant Physiology and Biochemistry, 2008, 46(8): 731-738.
Chen X, Wang Y, Li J, et al. Mitochondrial proteome during salt stress-induced programmed cell death in rice[J]. Plant Physiology and Biochemistry, 2009, 47(5): 407-415.
Lei B, Li S, Liu G, et al. Evolution of mitochondrial gene content: loss of genes, tRNAs and introns between Gossypium harknessii and other plants[J]. Plant Systematics and Evolution, 2013, 299(10): 1889-1897.|
Mikio Nakazono, Mayuko Ishikawa, et al. Multiple initiation sites for transcription of a gene
for subunit 1 of F1-ATPase (atp1 ) in rice mitochondria[J]. Curr Genet, 1996, 29: 417-422.
Catherine Colas des Francs-Small, Ian Small. Surrogate mutants for studying mitochondrially encoded functions[J]. Biochimie, 2014, 234-242.
Kamel Hammani, Philippe Giege. RNA metabolism in plant mitochondria[J]. Trends in plant sciences, 2014, 19: 380-389.

Structured information = The product of the gene is the subunit of the ATP synthase F0(ATP synthase F0 subunit 1)
Description = ATP synthase F0 subunit 1|
Version = GeneID:6450183|
Length = 1530 bp|
Definition = Oryza sativa Japonica Group ''atp1'', Mitochondrion gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
AP = Mitochondrion:352379..353908|
CDS = 352379..353908|
GCID = <gbrowseImage1>
name=NC_011033:352379..353908
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_011033:352379..353908
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage2>|
AA = <aaseq>MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGKGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRGTNESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVSKQPQYEPLPIEKQIVVIYAAVNGFCDRMPLDRISQYEKAILSTINPELLKSFNEKGGLTNERKIELDAFLKQTAKEIN</aaseq>|
DNA = <dnaseqindica>1..1530#atggaattctcacccagagctgcggaactcacgactctattagaaagtagaatgaccaacttttacacgaattttcaagtggatgagatcggtcgagtggtctcagttggagatgggattgcacgtgtttatggattgaacgagattcaagctggagaaatggtggaatttgccagcggtgtgaaaggaatagccttgaatcttgagaatgagaatgtaggtattgttgtctttggtagtgataccgctattaaagaaggagatcttgtcaagcgcactggatctattgtggatgttcctgcgggaaaggccatgttaggccgtgtggtcgacgccttgggagtacctattgatggaaaaggggctctaagcgatcacgaacgaagacgtgtcgaagtgaaagccccagggattattgaacgtaaatctgtgcacgaacccatgcaaacaggcttaaaagcagtggatagcctggttcctataggccgtggtcaacgagaacttataatcggggacagacaaactggaaaaacagcaatagctatcgatactatattaaaccaaaagcaaatgaactcaaggggcacaaatgagagtgagacattgtattgtgtctatgttgcgattggacaaaaacgctcgactgtggcacaattagttcaaattctttcagaagcgaatgctttggaatattccattcttgtagcagccaccgcttcggatcctgctcctctgcaatttctggccccatattcagggtgtgccatgggggaatatttccgcgataatggaatgcacgcattaattatatatgatgatctaagtaaacaggcggtggcatatcgacaaatgtcattattgttacgccgaccaccaggccgtgaggctttcccaggggatgttttctatttacattcccgtctcttagaaagagccgctaaacgatcggaccagacaggtgcaggtagcttgactgcgttacccgtgattgaaacacaagctggagacgtatcggcctatatccccaccaatgtgatctccattacagatggacaaatctgtttggaaacagagctcttttatcgcggaattagacctgctattaacgttggcttatccgtcagtcgcgtcgggtctgccgctcagttgaaagctatgaaacaagtctgcggtagttcaaaactggaattggcacaatatcgcgaagtggccgccttcgctcaatttgggtcagaccttgatgctgcgactcaggcattactcaatagaggtgcaaggcttacagaagtgcccaaacaaccacaatatgaaccacttccaattgaaaaacaaattgttgtgatttatgctgctgtcaacggcttctgtgatcgaatgccactagacagaatttctcaatatgaaaaagccattctaagtactattaatccagaattactaaaatccttcaacgaaaaagggggattaactaacgaaagaaagattgaacctgatgcttctttaaaacaaactgcgaaggagattaattag</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450183 NCBI Gene:atp1]
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Mitochondrion]]
[[Category:Mitochondrion]]

Atp1

2014-06-06T02:42:23Z

Hailin Li:

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.
{{Mitochondrion|
GeneName = atp1|
Annotated Information = protein coding; the gene of protein Atp1(ATP synthase F0 subunit 1).|
Function = Involved in the synthesis of ATP|This is one of the mitochondrial-encoded genes, which encodes one of the ATP sythases of the respiratory chain.Encode the αsubunit of F1.
Expression = With the in vitro capping method, ribonuclease protection experiments and from primer extension analysis, it has been prove that rice atp1 is transcribed from multiple initiation sites.Further experiments prove that there are at least eight transcription initiation sites of the rice mitochondrial atp1 gene. This only exist in rice atp1 gene, which are different from other plant species, such as wheat , maize and ''Oenothera''. Rice atp1 is present in a unique environment and is transcribed at a high level. The multiple initiation sites of the rice mitochondrial atp1 gene is also regulated in different ways.|
Evolution = R1c might have evolved from R1b through elimination of its partial segments at the end containing the atp1 gene, which was integrated in the soybean genome at another location.The mitochondrial DNA is more conservative and the evolution rate of chloroplast DNA is higher than mitochondrial DNA in rice.|During the evolution peocess, the majarity of the mitochondria genetics content were transferred into the nucleus of the cell.Mitochondrial biogenesis today relies on the coordinated regulation of both the nuclear genomes and the mitochondrial genomes. So the expression of rice atp1 now is influence by bothe the nuclear genomes and the mitochondrial genomes.
Labs wodking on this gene = Laboratory of Plant Molecular Genetics; Key Laboratory of Crop Heterosis and Utilization of Ministry of Education; Beijing Key Laboratory of Crop Genetic Improvement; Key Laboratory of MOE for Plant Developmental Biology; State Key Laboratory of Pharmaceutical Biotechnology; Key Laboratory of Tea Biochemistry and Biotechnology; MOE Key Laboratory of Bioinformatics and Bioinformatics Div. TNLIST.|Laboratory of Radiation Genetics, Faculty of Agriculture, The University
of Tokyo. Laboratory of Plant Breeding, Faculty of Agriculture, The University
of Tokyo.
References = Notsu Y, Masood S, Nishikawa T, et al. The complete sequence of the rice (Oryza sativa L.) mitochondrial genome: frequent DNA sequence acquisition and loss during the evolution of flowering plants[J]. Molecular Genetics and Genomics, 2002, 268(4): 434-445.
Wei X, Wang R, Cao L, et al. Origin of Oryza sativa in China inferred by nucleotide polymorphisms of organelle DNA[J]. PloS one, 2012, 7(11): e49546.
Li S, Yang D, Zhu Y. Characterization and use of male sterility in hybrid rice breeding[J]. Journal of Integrative Plant Biology, 2007, 49(6): 791-804.
Tan Y P, Li S Q, Xie H W, et al. Genetical and molecular analysis reveals a cooperating relationship between cytoplasmic male sterility-and fertility restoration-related genes in Oryza species[J]. Theoretical and Applied Genetics, 2011, 122(1): 9-19.
Wang B, Yuan J, Liu J, et al. Codon usage bias and determining forces in green plant mitochondrial genomes[J]. Journal of integrative plant biology, 2011, 53(4): 324-334.
Pasentsis K, Falara V, Pateraki I, et al. Identification and expression profiling of low oxygen regulated genes from Citrus flavedo tissues using RT-PCR differential display[J]. Journal of experimental botany, 2007, 58(8): 2203-2216.
Duroux L, Welinder K G. The peroxidase gene family in plants: a phylogenetic overview[J]. Journal of molecular evolution, 2003, 57(4): 397-407.
Zhu L, Deng W W, Ye A H, et al. Cloning of two cDNAs encoding a family of ATP sulfurylase from Camellia sinensis related to selenium or sulfur metabolism and functional expression in Escherichia coli[J]. Plant Physiology and Biochemistry, 2008, 46(8): 731-738.
Chen X, Wang Y, Li J, et al. Mitochondrial proteome during salt stress-induced programmed cell death in rice[J]. Plant Physiology and Biochemistry, 2009, 47(5): 407-415.
Lei B, Li S, Liu G, et al. Evolution of mitochondrial gene content: loss of genes, tRNAs and introns between Gossypium harknessii and other plants[J]. Plant Systematics and Evolution, 2013, 299(10): 1889-1897.|
Mikio Nakazono, Mayuko Ishikawa, et al. Multiple initiation sites for transcription of a gene
for subunit 1 of F1-ATPase (atp1 ) in rice mitochondria[J]. Curr Genet, 1996, 29: 417-422.
Catherine Colas des Francs-Small, Ian Small. Surrogate mutants for studying mitochondrially encoded functions[J]. Biochimie, 2014, 234-242.
Kamel Hammani, Philippe Giege. RNA metabolism in plant mitochondria[J]. Trends in plant sciences, 2014, 19: 380-389.

Structured information = The product of the gene is the subunit of the ATP synthase F0(ATP synthase F0 subunit 1)
Description = ATP synthase F0 subunit 1|
Version = GeneID:6450183|
Length = 1530 bp|
Definition = Oryza sativa Japonica Group ''atp1'', Mitochondrion gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
AP = Mitochondrion:352379..353908|
CDS = 352379..353908|
GCID = <gbrowseImage1>
name=NC_011033:352379..353908
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_011033:352379..353908
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage2>|
AA = <aaseq>MEFSPRAAELTTLLESRMTNFYTNFQVDEIGRVVSVGDGIARVYGLNEIQAGEMVEFASGVKGIALNLENENVGIVVFGSDTAIKEGDLVKRTGSIVDVPAGKAMLGRVVDALGVPIDGKGALSDHERRRVEVKAPGIIERKSVHEPMQTGLKAVDSLVPIGRGQRELIIGDRQTGKTAIAIDTILNQKQMNSRGTNESETLYCVYVAIGQKRSTVAQLVQILSEANALEYSILVAATASDPAPLQFLAPYSGCAMGEYFRDNGMHALIIYDDLSKQAVAYRQMSLLLRRPPGREAFPGDVFYLHSRLLERAAKRSDQTGAGSLTALPVIETQAGDVSAYIPTNVISITDGQICLETELFYRGIRPAINVGLSVSRVGSAAQLKAMKQVCGSLKLELAQYREVAAFAQFGSDLDAATQALLNRGARLTEVSKQPQYEPLPIEKQIVVIYAAVNGFCDRMPLDRISQYEKAILSTINPELLKSFNEKGGLTNERKIELDAFLKQTAKEIN</aaseq>|
DNA = <dnaseqindica>1..1530#atggaattctcacccagagctgcggaactcacgactctattagaaagtagaatgaccaacttttacacgaattttcaagtggatgagatcggtcgagtggtctcagttggagatgggattgcacgtgtttatggattgaacgagattcaagctggagaaatggtggaatttgccagcggtgtgaaaggaatagccttgaatcttgagaatgagaatgtaggtattgttgtctttggtagtgataccgctattaaagaaggagatcttgtcaagcgcactggatctattgtggatgttcctgcgggaaaggccatgttaggccgtgtggtcgacgccttgggagtacctattgatggaaaaggggctctaagcgatcacgaacgaagacgtgtcgaagtgaaagccccagggattattgaacgtaaatctgtgcacgaacccatgcaaacaggcttaaaagcagtggatagcctggttcctataggccgtggtcaacgagaacttataatcggggacagacaaactggaaaaacagcaatagctatcgatactatattaaaccaaaagcaaatgaactcaaggggcacaaatgagagtgagacattgtattgtgtctatgttgcgattggacaaaaacgctcgactgtggcacaattagttcaaattctttcagaagcgaatgctttggaatattccattcttgtagcagccaccgcttcggatcctgctcctctgcaatttctggccccatattcagggtgtgccatgggggaatatttccgcgataatggaatgcacgcattaattatatatgatgatctaagtaaacaggcggtggcatatcgacaaatgtcattattgttacgccgaccaccaggccgtgaggctttcccaggggatgttttctatttacattcccgtctcttagaaagagccgctaaacgatcggaccagacaggtgcaggtagcttgactgcgttacccgtgattgaaacacaagctggagacgtatcggcctatatccccaccaatgtgatctccattacagatggacaaatctgtttggaaacagagctcttttatcgcggaattagacctgctattaacgttggcttatccgtcagtcgcgtcgggtctgccgctcagttgaaagctatgaaacaagtctgcggtagttcaaaactggaattggcacaatatcgcgaagtggccgccttcgctcaatttgggtcagaccttgatgctgcgactcaggcattactcaatagaggtgcaaggcttacagaagtgcccaaacaaccacaatatgaaccacttccaattgaaaaacaaattgttgtgatttatgctgctgtcaacggcttctgtgatcgaatgccactagacagaatttctcaatatgaaaaagccattctaagtactattaatccagaattactaaaatccttcaacgaaaaagggggattaactaacgaaagaaagattgaacctgatgcttctttaaaacaaactgcgaaggagattaattag</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450183 NCBI Gene:atp1]
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Mitochondrion]]
[[Category:Mitochondrion]]

Atp9

2014-06-05T13:41:57Z

Hailin Li: moved Atp9a to Atp9 over redirect

The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.

==Annotated Information==
===Function===
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />.
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" />
=== Mutation ===
Please Mutation information here

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011</ref>
<ref name="ref2">Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from other plants .Plant Molecular Biology 13: 395-397, 1989.</ref>
<ref name="ref3">
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
Genome Evolution PLOS Genetics August 2012</ref>
== Structured Information ==
{{Mitochondrion|
GeneName = atp9|
Description = ATP synthase F0 subunit 9|
Version = GeneID:6450130|
Length = 225 bp|
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
AP = Mitochondrion:263141..263365|
CDS = 263141..263365|
GCID = <gbrowseImage1>
name=NC_011033:263141..263365
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_011033:263141..263365
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage2>|
AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
DNA <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Mitochondrion]]
[[Category:Mitochondrion]

Atp9a

2014-06-05T13:41:57Z

2014-06-05T12:58:05Z

Hailin Li:

Atp9

2014-06-05T12:57:02Z

Hailin Li:

{{Mitochondrion|
GeneName = atp9|
Description = ATP synthase F0 subunit 9|
Version = GeneID:6450130|
Length = 225 bp|
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
AP = Mitochondrion:263141..263365|
CDS = 263141..263365|
GCID = <gbrowseImage1>
name=NC_011033:263141..263365
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_011033:263141..263365
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage2>|
AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
DNA = <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Mitochondrion]]
[[Category:Mitochondrion]]

Atp9

2014-06-05T12:54:55Z

Hailin Li: Undo revision 178405 by Hailin Li (talk)

Atp9

2014-06-05T12:53:57Z

Hailin Li:

The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.

==Annotated Information==
===Function===
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />.
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.<ref name="ref3" />

===Mutation===

===Expression===
===Evolution===
==Labs working on this gene==

==References==
<references>
<ref name="ref1">
Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011</ref>
<ref name="ref2">
Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from other plants .Plant Molecular Biology 13: 395-397, 1989.</ref>
<ref name="ref3">
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
Genome Evolution PLOS Genetics August 2012</ref>
==Structured Information==
{{Mitochondrion|
GeneName = atp9|
Description = ATP synthase F0 subunit 9|
Version = GeneID:6450130|
Length = 225 bp|
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
AP = Mitochondrion:263141..263365|
CDS = 263141..263365|
GCID = <gbrowseImage1>
name=NC_011033:263141..263365
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_011033:263141..263365
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage2>|
AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>|
DNA = <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450130 NCBI Gene:atp9]
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Mitochondrion]]
[[Category:Mitochondrion]]

Hailin Li: Created page with "{{Mitochondrion| GeneName = atp4| Description = ATPase subunit 4| Version = GeneID:11272280| Length = 579 bp| Definition = Oryza sativa Japonica Group ''atp4'', Mitochondrion ..."

{{Mitochondrion|
GeneName = atp4|
Description = ATPase subunit 4|
Version = GeneID:11272280|
Length = 579 bp|
Definition = Oryza sativa Japonica Group ''atp4'', Mitochondrion gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
AP = Mitochondrion:55400..55978|
CDS = 55400..55978|
GCID = <gbrowseImage1>
name=NC_011033:55400..55978
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_011033:55400..55978
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage2>|
AA = <aaseq>MRFLSTDMKDRNMLFAAIPSICASSPKKISIYNEEMIVARCFIGFLIFSRKSLGKTFKETLDGRIESIQE
ELLQFFNPNEVIPEESNEQQRLLRISLRICSTVVESLPTARCAPKCEKTVQALLCRNLNVKSATLLNATS
SRRIRLQDDIVTGFHFSVSERFVSGSTFKASTIDLIREGLIVLRKVRVGGS</aaseq>|
DNA = <dnaseqindica>1..225#ATGAGATTGAGTTCGACGAATATGGATGCTAGAAAGATGTTATTTGCTGCTATTCTATCTATTTGTGCAT
TAAGTTCGAAGAAGATCTCAATCTATAATGAAGAAATGATAGTAGCTCTTTGTTTTATAGGCTTTATCAT
ATTCAGTCGTAAGAGTTTAGGTACGACTTTCAAAGCGACTCTCGACGGGAGAATCCAGGCTATTCAGGAA
GAATCGCAGCAATTCCCCAATCCTAACGAAGTAGTTCCTCCGGAATCCAATGAACAACAACGATTACTTA
GGATCAGCTTGCGAATTTGTGGCACCGTAGTAGAATCATTACCAATGGCACGCTGTGCGCCTAAGTGCGA
AAAGACAGTGCAAGCTTTGTTATGCCGAAACCTAAATGTTAAGTCAGCAACACTTACAAATGCCACTTCT
TCCCGTCGCATCCGTTTTCAGGACGATCTAGTCACAAAGTTTTACACCTTAGTGGGTAATCAATTTGCCT
ACTCTTCTATCTCGAAAGCAGAAAGAGTAGAATTCATTCGAGAGAGCTTGGTGGTCTTAAGAATGGTTCG
GGGGGGGGGTTTCTCTTAA</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/gene/11272280 NCBI Gene:atp4]
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Mitochondrion]]
[[Category:Mitochondrion]]

Atp8

2014-06-05T10:37:23Z

Hailin Li: Created page with "{{Mitochondrion| GeneName = atp8| Description = Subunit 8 of the F0 sector of mitochondrial inner membrane F1-F0 ATP synthase, encoded on the mitochondrial genome| Version = G..."

{{Mitochondrion|
GeneName = atp8|
Description = Subunit 8 of the F0 sector of mitochondrial inner membrane F1-F0 ATP synthase, encoded on the mitochondrial genome|
Version = GeneID:807862|
Length = 207 bp|
Definition = Oryza sativa Japonica Group ''atp8'', Mitochondrion gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|
AP = Mitochondrion:7784..7990|
CDS = 7784..7990|
GCID = <gbrowseImage1>
name=NC_011033:7784..7990
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_011033:263141..263365
source=Rice_Japonica_Mitochondrion
preset=GeneLocation
</gbrowseImage2>|
AA = <aaseq>MPQLDTSKWFITILSVMFTLFVLFQVKLSNYNFPLDLSSKSEDLKKNKTPWELKWTKIYLPHLLPLQ</aaseq>|
DNA = <dnaseqindica>1..225#ATGCCCCAACTAAATACCGCCGTATGACCCACCATAATTACCCCCATACTCCTGACACTATTTCTCGTCA
CCCAACTAAAAATATTAAATTCAAATTACCATCTACCCCCCTCACCAAAACCCATAAAAATAAAAAACTA
CAATAAACCCTGAGAACCAAAATGAACGAAAATCTATTCGCTTCATTCGCTGCCCCCACAATCCTAG</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/gene/807862 NCBI Gene:atp8]
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Mitochondrion]]
[[Category:Mitochondrion]]