<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Haustltt</id>
		<title>RiceWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Haustltt"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php/Special:Contributions/Haustltt"/>
		<updated>2026-08-27T18:50:13Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183671</id>
		<title>Os09g0482600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183671"/>
				<updated>2014-06-10T13:59:49Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;I ==Annotated Information==&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
In recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproductive organ developing and flowering stage. (late July to early August), resulted in severe loss of production. We initiated rice panicle microarray analysis (Agilent 22K) for the gene expression pattern under heat stress at the beginning of heading stage. We found the annotated and putative rice heat shock proteins (HSPs) gene expression was generally responded to the stress and this brought our interests to further understand the expression and responses to stresses other than heat stress. &lt;br /&gt;
Heat shock protein was first discovered in Drosophilain 1962 and has been reported in a wide&lt;br /&gt;
range of organisms, including plants &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs,o40 kDa). Expression profiles of nine rice heat shock protein genes (OsHSPs) were analyzed by semi-quantitative reverse transcriptase polymerase chain reaction (RT-PCR). The nine genes exhibited distinctive expression in different organs. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
 1 gagcctacca ctacgagcag gttgcggcgg cggaggcgag cggagccgcg gtggtgcgga&lt;br /&gt;
       61 ttgagcggcg gagccggagc cggagccgcg gtggtgcgga tcgagcggcg gcggtggccg&lt;br /&gt;
      121 gcggggaggc gcaactggtc gccgagggga gcatggcgct tgacggtgga ggtgcggccg&lt;br /&gt;
      181 acggcagcgc ggccagcagc cgggccacca gcccaccagg ccacggccac ttttatccaa&lt;br /&gt;
      241 caatatggtt caatctttgg aggaaccata tcaatatttc aggcagcaat cccaataatt&lt;br /&gt;
      301 tacggtgcct tgaagggtag atacttgctg gcactagagc tttggaatgc tagcattacg&lt;br /&gt;
      361 atcattaact tggtgggaaa cacgacgtgg atgatctatt ctgccgtcaa taagggagtt&lt;br /&gt;
      421 gagctgtcaa tgttaatgac taattcagtc gcttgtggac tgaacatcta ccacttgctg&lt;br /&gt;
      481 tctatttata gacacaacaa ggaaaggaaa aaaacaattt gtcttgtaag ttttatatgc&lt;br /&gt;
      541 atcagttttc tggtaatcct ggttttgctg gaaacaaatg tgggagacga catattgaga&lt;br /&gt;
      601 ctgctggagc atttatttgg atcactggga aatgttatga ttgttttgtg ccatctagtt&lt;br /&gt;
      661 cagatcaata acttgtggta ctcaactctg tcactagaaa ttcacgtttt catactgttc&lt;br /&gt;
      721 tatgtaccaa atatactatt tgctgccagt gaattggttt tgattgtcta caagcagtac&lt;br /&gt;
      781 agcatgaaaa tttatgtcca gctctcatac attttgaaca caatcttcta tgtgattgag&lt;br /&gt;
      841 ctccctgtca tgattcgcgc aatgattaca aataatccag attctgacaa tgaagcaatc&lt;br /&gt;
      901 gatatcgaga atcaagcaat tgtaaagatt gatgggcaaa agaaacatca caatgagcgt&lt;br /&gt;
      961 caagaggaca gggcagagaa gaaaacgacc ttcacggaag tttatttgct tcctgcgccg&lt;br /&gt;
     1021 cctgggctct ttggccaagg aaaaagaaaa cacagcgaca acgatactgc ttcaaccaaa&lt;br /&gt;
     1081 agaagaagaa taacaatctt acaaagaaag cgacgatgga tagagctgag ggacaaggaa&lt;br /&gt;
     1141 attcattttt caaagaggat gagaagtcat atttattcaa gatctatcaa aagaggatct&lt;br /&gt;
     1201 ccccccacta ggaccttgca actccaaatg gattcactat ctgaagacag ttatgagcct&lt;br /&gt;
     1261 gaatatgttg aggagcatcg cctcaaggat ctggtgaaga actctgagtt catcagctac&lt;br /&gt;
     1321 cctatctccc tgaatgagaa aaagattgag aaggaaatct gtgatgatga ggaagtcgat&lt;br /&gt;
     1381 gctgaagagg gaaaggttga ggatgttgat gaggagaagg aaaagaaagg ggagaagatc&lt;br /&gt;
     1441 aatgaagtct ctcatgagtg gcattcctcg aacaagcaga aacctctctc agattcaaag&lt;br /&gt;
     1501 gagattacta gtgagaacga ggaagctaaa gagggaaagg ttgaggatgt tgatgaggag&lt;br /&gt;
     1561 aaggaagaga agaaaaaaca agggaagaag atcaaggaag tctgtcatga gtgcaacttg&lt;br /&gt;
     1621 atcaacaagc aggaagccat ctggatgagg aaatcagagg tgatcaccaa ggaagcagcc&lt;br /&gt;
     1681 ttctaaaaga gcttgacaaa cgactgggag gaacatctgg ctgtcaagca cttctctgtg&lt;br /&gt;
     1741 gagggtcagc ttgagttcaa ggccatcctg tttgtaccca agggagcacc atttgacatc&lt;br /&gt;
     1801 tttgacacca gaaagaagct taacaacatc aggctgtacg tacgccgggt gtttatcatg&lt;br /&gt;
     1861 gacaactgtg aggagttgat ccctgagtgg ctcagctttg tcgagggcgt tgttgattat&lt;br /&gt;
     1921 gaagaccttc ccctaaatat ctcatttgag ctgctgcagc agaacaagat cctgaaggtg&lt;br /&gt;
     1981 atccgcaaga accttgtgaa gaaatgcgtc gagctgttct ttgagattgc tgagaacaag&lt;br /&gt;
     2041 gaagactaca acaaattcta caaggccttc tccaaaaatc tcaagcttgg catccatgag&lt;br /&gt;
     2101 gactctacca acaggacgaa gattgctgag ctcctgaggt accactccac caagagtggt&lt;br /&gt;
     2161 gatgagttga ccagcctcaa ggactatgta gcccggatga aagagggcca gcgtgatatc&lt;br /&gt;
     2221 tattaaatca ctggtgagag caagaaggct gttgagaact cccccttcct tgagaagctg&lt;br /&gt;
     2281 aaggactatg aggtcctgta catggttgat gccattgatg agtacgctgt cggtcagttc&lt;br /&gt;
     2341 atggagtttg agggcaagaa gctcatctct gccaccaaag gactgaagct tgatgagaag&lt;br /&gt;
     2401 tttgacaatt tgagcatagt gatgaaggag gtgctcgttg acacagtgga gagggatgtt&lt;br /&gt;
     2461 ttttctgacc gtgtggtgga ctcttcctgc tgtccagtca ctggcgagta cagctgggtt&lt;br /&gt;
     2521 gctaacatgg agaggatcat gaaggagaat gccatcatgg acgagctacc taacaaatcc&lt;br /&gt;
     2581 caagtgaaca aatgtgcccc aaagcaaaag gttgatatcc ttcctgtgaa ggagaatgct&lt;br /&gt;
     2641 atcaggctcc aaagcagtga agagagagaa gttaatacta aattttctgt taccggaatc&lt;br /&gt;
     2701 tgtggagatg gaagatgcct attccgatct atagtacatg gtgcttatat taaactaatg&lt;br /&gt;
     2761 atgattccac ctgatgataa tcttgagaaa gatatggctg atgacttaag aaaaaaggtt&lt;br /&gt;
     2821 tgtgatgcgt tggagaagga atgtgctgac aaaccctggc ttgttgaggt gactgccatt&lt;br /&gt;
     2881 cctatatcaa agagatgagg aaacctcatg tgtggggagg tgagatagaa atctctatgg&lt;br /&gt;
     2941 cgtcacatgt tttaaagatg cccatcaccg tgttcgtggt ggaaaaaact ggaggtttga&lt;br /&gt;
     3001 gggtattcac caaatacgga aaggagtatg gacggaatgc aatacaggtt ctttttgatg&lt;br /&gt;
     3061 gtaatggaca ttatgatgtt ctgagtttgc ggtagtccag gactgcagga cagacatttg&lt;br /&gt;
     3121 ttcccccttt tttttttctt ccccaaatac acttgctgta aaaatgtaac cggagtttac&lt;br /&gt;
     3181 caacaattaa aaatgttgtt ctttcct&lt;br /&gt;
//&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; &amp;gt; Jie Zhou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment. Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName =  ' Rice heat shock protein gene|&lt;br /&gt;
Description = rice blast resistance gene|&lt;br /&gt;
Version = AK065528.1  GI:32975546|&lt;br /&gt;
Length = 3207bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group cDNA clone:J013031D07, full insertsequence.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
 &lt;br /&gt;
  ORGANISM  Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; &amp;gt; Jie Zhou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment. Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Wang G L, Mackill D J, Bonman J M, et al. RFLP mapping of genes conferring complete and partial resistance to blast in a durably resistant rice cultivar[J]. Genetics, 1994, 136(4): 1421-1434.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183581</id>
		<title>Os09g0482600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183581"/>
				<updated>2014-06-10T12:35:16Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;I ==Annotated Information==&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
In recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproductive organ developing and flowering stage. (late July to early August), resulted in severe loss of production. We initiated rice panicle microarray analysis (Agilent 22K) for the gene expression pattern under heat stress at the beginning of heading stage. We found the annotated and putative rice heat shock proteins (HSPs) gene expression was generally responded to the stress and this brought our interests to further understand the expression and responses to stresses other than heat stress. &lt;br /&gt;
Heat shock protein was first discovered in Drosophilain 1962 and has been reported in a wide&lt;br /&gt;
range of organisms, including plants &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs,o40 kDa). Expression profiles of nine rice heat shock protein genes (OsHSPs) were analyzed by semi-quantitative reverse transcriptase polymerase chain reaction (RT-PCR). The nine genes exhibited distinctive expression in different organs. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; &amp;gt; Jie Zhou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment. Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName =  ' Rice heat shock protein gene|&lt;br /&gt;
Description = rice blast resistance gene|&lt;br /&gt;
Version = AK065528.1  GI:32975546|&lt;br /&gt;
Length = 3207bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group cDNA clone:J013031D07, full insertsequence.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
 &lt;br /&gt;
  ORGANISM  Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; &amp;gt; Jie Zhou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment. Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Wang G L, Mackill D J, Bonman J M, et al. RFLP mapping of genes conferring complete and partial resistance to blast in a durably resistant rice cultivar[J]. Genetics, 1994, 136(4): 1421-1434.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183574</id>
		<title>Os09g0482600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183574"/>
				<updated>2014-06-10T12:22:59Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;I ==Annotated Information==&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
In recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproductive organ developing and flowering stage. (late July to early August), resulted in severe loss of production. We initiated rice panicle microarray analysis (Agilent 22K) for the gene expression pattern under heat stress at the beginning of heading stage. We found the annotated and putative rice heat shock proteins (HSPs) gene expression was generally responded to the stress and this brought our interests to further understand the expression and responses to stresses other than heat stress. &lt;br /&gt;
Heat shock protein was first discovered in Drosophilain 1962 and has been reported in a wide&lt;br /&gt;
range of organisms, including plants &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs,o40 kDa). Expression profiles of nine rice heat shock protein genes (OsHSPs) were analyzed by semi-quantitative reverse transcriptase polymerase chain reaction (RT-PCR). The nine genes exhibited distinctive expression in different organs. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; &amp;gt; Jie Zhou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment. Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Wang G L, Mackill D J, Bonman J M, et al. RFLP mapping of genes conferring complete and partial resistance to blast in a durably resistant rice cultivar[J]. Genetics, 1994, 136(4): 1421-1434.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183561</id>
		<title>Os09g0482600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0482600&amp;diff=183561"/>
				<updated>2014-06-10T11:59:16Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: Created page with &amp;quot;I ==Annotated Information== ===Function=== n recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproduct...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;I ==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
n recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproductive organ developing and flowering stage. (late July to early August), resulted in severe loss of production. We initiated rice panicle microarray analysis (Agilent 22K) for the gene expression pattern under heat stress at the beginning of heading stage. We found the annotated and putative rice heat shock proteins (HSPs) gene expression was generally responded to the stress and this brought our interests to further understand the expression and responses to stresses other than heat stress. &lt;br /&gt;
Heat shock protein was first discovered in Drosophilain 1962 and has been reported in a wide&lt;br /&gt;
range of organisms, including plants &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs,o40 kDa). Expression profiles of nine rice heat shock protein genes (OsHSPs) were analyzed by semi-quantitative reverse transcriptase polymerase chain reaction (RT-PCR). The nine genes exhibited distinctive expression in different organs. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses. &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Wang G L, Mackill D J, Bonman J M, et al. RFLP mapping of genes conferring complete and partial resistance to blast in a durably resistant rice cultivar[J]. Genetics, 1994, 136(4): 1421-1434.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os09g0482600&amp;diff=183560</id>
		<title>Talk:Os09g0482600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os09g0482600&amp;diff=183560"/>
				<updated>2014-06-10T11:58:37Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==Annotated Information==&lt;br /&gt;
I ==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
n recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproductive organ developing and flowering stage. (late July to early August), resulted in severe loss of production. We initiated rice panicle microarray analysis (Agilent 22K) for the gene expression pattern under heat stress at the beginning of heading stage. We found the annotated and putative rice heat shock proteins (HSPs) gene expression was generally responded to the stress and this brought our interests to further understand the expression and responses to stresses other than heat stress. &lt;br /&gt;
Heat shock protein was first discovered in Drosophilain 1962 and has been reported in a wide&lt;br /&gt;
range of organisms, including plants &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs,o40 kDa). Expression profiles of nine rice heat shock protein genes (OsHSPs) were analyzed by semi-quantitative reverse transcriptase polymerase chain reaction (RT-PCR). The nine genes exhibited distinctive expression in different organs. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Wang G L, Mackill D J, Bonman J M, et al. RFLP mapping of genes conferring complete and partial resistance to blast in a durably resistant rice cultivar[J]. Genetics, 1994, 136(4): 1421-1434.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os09g0482600&amp;diff=183559</id>
		<title>Talk:Os09g0482600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os09g0482600&amp;diff=183559"/>
				<updated>2014-06-10T11:57:59Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==Annotated Information==&lt;br /&gt;
I ==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
n recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproductive organ developing and flowering stage. (late July to early August), resulted in severe loss of production. We initiated rice panicle microarray analysis (Agilent 22K) for the gene expression pattern under heat stress at the beginning of heading stage. We found the annotated and putative rice heat shock proteins (HSPs) gene expression was generally responded to the stress and this brought our interests to further understand the expression and responses to stresses other than heat stress. &lt;br /&gt;
Heat shock protein was first discovered in Drosophilain 1962 and has been reported in a wide&lt;br /&gt;
range of organisms, including plants &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs,o40 kDa). Expression profiles of nine rice heat shock protein genes (OsHSPs) were analyzed by semi-quantitative reverse transcriptase polymerase chain reaction (RT-PCR). The nine genes exhibited distinctive expression in different organs. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses. &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Wang G L, Mackill D J, Bonman J M, et al. RFLP mapping of genes conferring complete and partial resistance to blast in a durably resistant rice cultivar[J]. Genetics, 1994, 136(4): 1421-1434.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os09g0482600&amp;diff=183554</id>
		<title>Talk:Os09g0482600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os09g0482600&amp;diff=183554"/>
				<updated>2014-06-10T11:50:47Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: Created page with &amp;quot;==Annotated Information== ===Function=== In recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproducti...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
In recent years, heat stresses occurred more frequently in South China (the largest rice planting area in China) during the reproductive organ developing and flowering stage. (late July to early August), resulted in severe loss of production. We initiated rice panicle microarray analysis (Agilent 22K) for the gene expression pattern under heat stress at the beginning of heading stage. We found the annotated and putative rice heat shock proteins (HSPs) gene expression was generally responded to the stress and this brought our interests to further understand the expression and responses to stresses other than heat stress. &lt;br /&gt;
Heat shock protein was first discovered in Drosophilain 1962 and has been reported in a wide&lt;br /&gt;
range of organisms, including plants &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. According to their approximate molecular weights, HSPs are grouped into five families: HSP100s, HSP90s, HSP70s, HSP60s and sHSPs (small HSPs,o40 kDa). Expression profiles of nine rice heat shock protein genes (OsHSPs) were analyzed by semi-quantitative reverse transcriptase polymerase chain reaction (RT-PCR). The nine genes exhibited distinctive expression in different organs. Expression of nine OsHSP genes was affected differentially by abiotic stresses and abscisic acid (ABA). All nine OsHSP genes were induced strongly by heat shock treatment, whereas none of them were induced by cold. The transcripts of OsHSP80.2, OsHSP71.1 and OsHSP23.7 were increased during salt tress treatment. Expression of OsHSP80.2 and OsHSP24.1 genes were enhanced while treated with 10% PEG. Only OsHSP71.1 was induced by ABA while OsHSP24.1 was suppressed by ABA. These observations imply that the nine OsHSP genes may play different roles in plant development and abiotic stress responses. &amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
===Evolution===&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt; Vierling E. The roles of heat shock proteins in plants. Annu&lt;br /&gt;
Rev Plant Physiol Plant Mol Biol 1991;42:579–620.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Wang G L, Mackill D J, Bonman J M, et al. RFLP mapping of genes conferring complete and partial resistance to blast in a durably resistant rice cultivar[J]. Genetics, 1994, 136(4): 1421-1434.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt; Jie Zou.&lt;br /&gt;
  Expression analysis of nine rice heat shock protein genes under abiotic stresses and ABA treatment&lt;br /&gt;
  Journal of Plant Physiology, 2009, 166(8): 851-861.&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os03g0245800&amp;diff=183538</id>
		<title>Talk:Os03g0245800</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os03g0245800&amp;diff=183538"/>
				<updated>2014-06-10T11:06:36Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: Created page with &amp;quot; When plants suffer from cold or drought stress, the ABA signal transduction pathway is activated and ZFP245 accumulates quickly. ZFP245 promotes the accumulation of free prol...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt; When plants suffer from cold or drought stress, the ABA signal transduction pathway is activated and ZFP245 accumulates&lt;br /&gt;
quickly. ZFP245 promotes the accumulation of free proline by activating the expression levels of pyrroline-5-carboxylatesynthetase&lt;br /&gt;
and proline transporter genes, and enhances the ROS-scavenging&lt;br /&gt;
ability in plant cells by activating the ROS-scavenging enzymes.&lt;br /&gt;
Our data suggest that ZFP245 may contribute to the cold and&lt;br /&gt;
drought tolerance of rice plants by regulating their proline levels&lt;br /&gt;
and ROS-scavenging abilities and therefore may be useful in the&lt;br /&gt;
development of transgenic crops with enhanced tolerance to abiotic stress.&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os07g0587400&amp;diff=183530</id>
		<title>Talk:Os07g0587400</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Talk:Os07g0587400&amp;diff=183530"/>
				<updated>2014-06-10T10:35:38Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: Created page with &amp;quot;ZFP245is a cold- and drought-responsive gene that encodes a zinc finger protein in rice. The ZFP245 protein localizes in the nucleus and exhibits trans-activation activity. Tr...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;ZFP245is a cold- and drought-responsive gene that encodes a zinc finger protein in rice. The ZFP245 protein localizes in the nucleus and exhibits trans-activation activity. Transgenic rice plants overexpressing ZFP245were generated and found to display high tolerance to cold and drought stresses. The transgenic plants did not exhibit growth retardation, but showed growth sensitivity against exogenous abscisic acid, increased free proline levels and elevated expression of rice pyrroline-5-carboxylatesynthetase and proline transporter genes under stress conditions. Overproduction of ZFP245 enhanced the activities of reactive oxygen species-scavenging enzymes under stress conditions and increased the tolerance of rice seedlings to oxidative stress. Our data suggest that ZFP245 may contribute to the tolerance of rice plants to cold and drought stresses by regulating proline levels and reactive oxygen species-scavenging activities, and therefore may be useful for developing transgenic crops with enhanced tolerance to abiotic&lt;br /&gt;
stress. When plants suffer from cold or drought stress, the ABA signal transduction pathway is activated and ZFP245 accumulates quickly. ZFP245 promotes the accumulation of free proline by activating the expression levels of pyrroline-5-carboxylatesynthetase and proline transporter genes, and enhances the ROS-scavenging ability in plant cells by activating the ROS-scavenging enzymes.Our data suggest that ZFP245 may contribute to the cold and drought tolerance of rice plants by regulating their proline levels and ROS-scavenging abilities and therefore may be useful in the development of transgenic crops with enhanced tolerance to abiotic stress.&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0587400&amp;diff=183527</id>
		<title>Os07g0587400</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0587400&amp;diff=183527"/>
				<updated>2014-06-10T10:29:10Z</updated>
		
		<summary type="html">&lt;p&gt;Haustltt: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
ZFP245is a cold- and drought-responsive gene that encodes a zinc finger protein in rice. The ZFP245 protein localizes in the nucleus and exhibits trans-activation activity. Transgenic rice plants overexpressing ZFP245were generated and found to display high tolerance to cold and drought stresses. The transgenic plants did not exhibit growth retardation, but showed growth sensitivity against exogenous abscisic acid, increased free proline levels and elevated expression of rice pyrroline-5-carboxylatesynthetase and proline transporter genes under stress conditions. Overproduction of ZFP245 enhanced the activities of reactive oxygen species-scavenging enzymes under stress conditions and increased the tolerance of rice seedlings to oxidative stress. Our data suggest that ZFP245 may contribute to the tolerance of rice plants to cold and drought stresses by regulating proline levels and reactive oxygen species-scavenging activities, and therefore may be useful for developing transgenic crops with enhanced tolerance to abiotic&lt;br /&gt;
stress. When plants suffer from cold or drought stress, the ABA signal transduction pathway is activated and ZFP245 accumulates quickly. ZFP245 promotes the accumulation of free proline by activating the expression levels of pyrroline-5-carboxylatesynthetase and proline transporter genes, and enhances the ROS-scavenging ability in plant cells by activating the ROS-scavenging enzymes.Our data suggest that ZFP245 may contribute to the cold and drought tolerance of rice plants by regulating their proline levels and ROS-scavenging abilities and therefore may be useful in the development of transgenic crops with enhanced tolerance to abiotic stress.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os07g0587400|&lt;br /&gt;
Description = Similar to Eukaryotic peptide chain release factor subunit 1-3 (eRF1-3) (Eukaryotic release factor 1-3) (Omnipotent suppressor protein 1 homolog 3) (SUP1 homolog 3)|&lt;br /&gt;
Version = NM_001066672.1 GI:115473076 GeneID:4343757|&lt;br /&gt;
Length = 4045 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os07g0587400, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|&lt;br /&gt;
AP = Chromosome 7:24565107..24569151|&lt;br /&gt;
CDS = 24565589..24566902|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008400:24565107..24569151&lt;br /&gt;
source=RiceChromosome07&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008400:24565107..24569151&lt;br /&gt;
source=RiceChromosome07&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgtctgacagccatgaaactgataggaacattgagatctggaagattaagaagctaatcaaggctctggagtcagctagaggaaatggcacaagcatgatctctcttattatgcctccacgtgaccagattgcgcgagtggctaagatgttgggtgatgaatatggtaccgcctcaaacatcaagagtagagtcaatcgtcagtctgttttggctgccattacctcagctcagcagaggctgaagctctataacaaagttcctccaaatggattggttctctacactggaaccattgttactgaagatgggaaggaaaagaaggttaccattgattttgaacccttcaagcctatcaatgtatcactgtatctttgtgataacaagttccacactgaagctttgaatgagctcttggaatctgatgacaagtttgggttcattgttatggatggtaatggtactctttttggcacactaagtggcaacacacgtgaggtgcttcacaaattcactgttgatctcccaaagaagcatggtagaggaggacaatctgctttgcgttttgctcgtcttcggatggagaaacgccataattatgtccggaaaacagctgagcttgctactcagttcttcattaatcctgctacaagtcagcctaatgtttcaggcctaatcctcgctggttctgctgattttaagacagaattgagtcagtctgacatgtttgatcaacgacttcaagccaagatacttaatgtggttgatgtttcttatggtggcgagaatggtttcaaccaagctattgaattgtcagctgagattctagcaaatgtcaagttcatacaggagaagaagctaattggcaagtattttgaagagatcagtcaagatactgggaaatatgtctttggggttgatgacactcttaaagctcttgagatgggtgctgttgagactctaatagtgtgggagaaccttgaaaccaacagatatgtgcttaagaacagtgcatctggtgaaactgtgatcaaacattttaacaaagagcaggaagctgaccagagtaatttccgtgatccggctagtaatgctgagttggaagttcaggaaaaaatgtctcttctggaatggtttgctaatgaatacaagaagtttggttgctcgcttgagtttgtcactaataaatctcaagagggatctcagttttgtagaggattcggtggcattggtggtatcttgcgttaccagctagatatccggtcatttgatgagctttctgacgatgagggattgtatgaagactctgattag&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MSDSHETDRNIEIWKIKKLIKALESARGNGTSMISLIMPPRDQI                     ARVAKMLGDEYGTASNIKSRVNRQSVLAAITSAQQRLKLYNKVPPNGLVLYTGTIVTE                     DGKEKKVTIDFEPFKPINVSLYLCDNKFHTEALNELLESDDKFGFIVMDGNGTLFGTL                     SGNTREVLHKFTVDLPKKHGRGGQSALRFARLRMEKRHNYVRKTAELATQFFINPATS                     QPNVSGLILAGSADFKTELSQSDMFDQRLQAKILNVVDVSYGGENGFNQAIELSAEIL                     ANVKFIQEKKLIGKYFEEISQDTGKYVFGVDDTLKALEMGAVETLIVWENLETNRYVL                     KNSASGETVIKHFNKEQEADQSNFRDPASNAELEVQEKMSLLEWFANEYKKFGCSLEF                     VTNKSQEGSQFCRGFGGIGGILRYQLDIRSFDELSDDEGLYEDSD&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;2250..3563#atctctctctctctccgaaacagccgaccacaccagaagttcagaggcgagggtttcccacccgcgagaagtcggcgctcccctcttcctcctcctccctcctcctcggtaaggaaaccctagcccctcctcctcttcctccctcctgcgccccctcgatccgatcccgtctcgtgcttcttctcccccgatcgttcggagctgcgtgggtgcggcggatcgggagcaggttggatctgttgaatcgtcgcgggttgtgttgttttcatggttcgtgtggtcgtcagatttggtcgagattagagtctggatccggtgtactggtagcgcgaggtggatcgggagtgattgggacctagttctgtggcgaaatttctagggcgtgtagtgatccttcgcctcccggtctcgggatctgtgcgggaagtactctagatggctgttccgcgcgattttcctgatttaggccactaatttaggtggatgtatttggatccatgctgtgtttgtaagttgtaattgcctgccaggagatggctttgtttgttggctatttgaagtagcgtactgggatgtgtattaacataggaatacatgctattttccatcgtggatattaatcgggttattttgattccttaatgcttggagttattgtcatattagacgagccttcctgctatggtgccatgcggacatgcggttactcaagttcacggcgctctttttagcgttgttggtttgaaaattacatgttatatgtcttcttcatggttgcattctgctcttgtatgttttgttgcgctaatagtttccttttcattggtgatgtatcatttaggttaacttgaagtagtagtgagcattgagcaaactatgtgttttttttctgaatttacatgattttaaagattcaaacattctgaaatctgtagattgctgcacgtttgccttattgattttggaagtaactggtaactgaaaatgtatgtgctggactgctagtagaacatgaactagaaggaataccccttgatgaacatggcaatcaagaagttaagaaggtttcttgatcttctatgactctggtagcttgtaaagacaaaacactgaccatgtcaatgtcaatgcaacttctataaatttatgccattcgatcttaaaatgttagcctgaggtttagttcttatcttctatcttagtcttggtgacagatgcatgtttggtcttacaatgatttactttaattatattgattgcctatagttaattttttattacattgttggcagaagataaatacatctaagatgtgctgttttaactttattgactgattatattccatatttcattgttttgtgattttccaagttgatatctagttgactagtactaattgtactttccgtttgtttcatgagtgtactctctatttcggttttgtgattattgaaactaaattctgtttcttggatataatttagattttatgttggttttattattttatctgggtgacattccgattctgaaaattttacatggctatgcaggtccttcatttgtcttgggggttaactccatgctttattttatttcagtatgtttgtcccacataaaaaatgttaccaagtacctgtaacctagtgataacatcgtatgtgttcatgattgtttcatgttagctgcaaaaatcatttgagtatatgcaaatgaaaacctttttcacatttcgtaacctaccttttcctaaaccaaaccaaaatttgccacccattgggcaatattaaccttgtctgctgagtgttgtggtttaattttaaccttgtctgctgagtgttgtggttatttgatagtacctttgctgccgaaattttgttgtgagatatttagtaagataaacggtggttgtttttcttgttctttcactgtgttacgtataaagtaatagagcatgctgctttgaagaaatcagtctcattattgattaatttgtacaggagacaggtatcatttcttatttagcatgtccatgtccaatttggtatcatgaacagagcttgtgtcaacaagaaagttgaatgtactatataacaataatatgacttgtctttgttctgtgtttttttttaatctgtttgcaagtttttcttgagtgaactgtctggttaatgttcccttcaaatcccttatatccctgtgttttggcattgtacaggtgagccagtcatccaagctctgtcaagatgtctgacagccatgaaactgataggaacattgagatctggaagattaagaagctaatcaaggctctggagtcagctagaggaaatggcacaagcatgatctctcttattatgcctccacgtgaccagattgcgcgagtggctaagatgttgggtgatgaatatggtaccgcctcaaacatcaagagtagagtcaatcgtcagtctgttttggctgccattacctcagctcagcagaggctgaagctctataacaaagttcctccaaatggattggttctctacactggaaccattgttactgaagatgggaaggaaaagaaggttaccattgattttgaacccttcaagcctatcaatgtatcactgtatctttgtgataacaagttccacactgaagctttgaatgagctcttggaatctgatgacaagtttgggttcattgttatggatggtaatggtactctttttggcacactaagtggcaacacacgtgaggtgcttcacaaattcactgttgatctcccaaagaagcatggtagaggaggacaatctgctttgcgttttgctcgtcttcggatggagaaacgccataattatgtccggaaaacagctgagcttgctactcagttcttcattaatcctgctacaagtcagcctaatgtttcaggcctaatcctcgctggttctgctgattttaagacagaattgagtcagtctgacatgtttgatcaacgacttcaagccaagatacttaatgtggttgatgtttcttatggtggcgagaatggtttcaaccaagctattgaattgtcagctgagattctagcaaatgtcaagttcatacaggagaagaagctaattggcaagtattttgaagagatcagtcaagatactgggaaatatgtctttggggttgatgacactcttaaagctcttgagatgggtgctgttgagactctaatagtgtgggagaaccttgaaaccaacagatatgtgcttaagaacagtgcatctggtgaaactgtgatcaaacattttaacaaagagcaggaagctgaccagagtaatttccgtgatccggctagtaatgctgagttggaagttcaggaaaaaatgtctcttctggaatggtttgctaatgaatacaagaagtttggttgctcgcttgagtttgtcactaataaatctcaagagggatctcagttttgtagaggattcggtggcattggtggtatcttgcgttaccagctagatatccggtcatttgatgagctttctgacgatgagggattgtatgaagactctgattagcaatcagccaatcacatgactgtgctggcccagggaaggacgccgcagctgcaacgagtctgattcgctctacttacgcaggaacacttcgaaagcagctgtatgcatattaattctttggtcttgctcaaattattttggttactttctcatgctataatgtaaacttgactattcctctcctctgtttcagatccagaaattgatgggcgtgggccagcctcatcctatgctggaagggattaaggcgaaaggattactgagtcacatcatcatgatagtaatgtgtcaagaagttatcgaacttaaaaggcatgctgttgccaaggtcgtactggttgtctattgtctgctttttgcaactatattcgcaagttctgaattctagtgtctgcttgaaattgagcacgctggacgcgctcgtgactatatggtgtaatctgctacttttgcagtttttgcaatgaagttactgttatgct&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066672.1 RefSeq:Os07g0587400]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 7]]&lt;br /&gt;
[[Category:Chromosome 7]]&lt;/div&gt;</summary>
		<author><name>Haustltt</name></author>	</entry>

	</feed>