http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=Jxjjeremy123 2026-08-29T15:48:01Z User contributions MediaWiki 1.30.0 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=182381 2014-06-09T12:10:41Z

<p>Jxjjeremy123: /* Evolution */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> [[File:OsRAF is an ERF-like gene.png]]<br /> OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale<br /> bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g&lt;ref name=&quot;ref2&quot; /&gt;<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).&lt;ref name=&quot;ref3&quot; /&gt;<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.&lt;ref name=&quot;ref4&quot; /&gt;<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> == References ==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Banno H, Ikeda Y, Niu QW et al (2001) Overexpression of Arabidopsis ESR1 induces initiation of shoot regeneration.Plant Cell 13:2609–2618&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392&lt;/ref&gt;<br /> &lt;/references&gt;</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=182380 2014-06-09T12:10:27Z

<p>Jxjjeremy123: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> [[File:OsRAF is an ERF-like gene.png]]<br /> OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale<br /> bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g&lt;ref name=&quot;ref2&quot; /&gt;<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).&lt;ref name=&quot;ref3&quot; /&gt;<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> == References ==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Banno H, Ikeda Y, Niu QW et al (2001) Overexpression of Arabidopsis ESR1 induces initiation of shoot regeneration.Plant Cell 13:2609–2618&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392&lt;/ref&gt;<br /> &lt;/references&gt;</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=182379 2014-06-09T12:10:12Z

<p>Jxjjeremy123: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> [[File:OsRAF is an ERF-like gene.png]]<br /> OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale<br /> bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g&lt;ref name=&quot;ref2&quot; /&gt;<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> == References ==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Banno H, Ikeda Y, Niu QW et al (2001) Overexpression of Arabidopsis ESR1 induces initiation of shoot regeneration.Plant Cell 13:2609–2618&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392&lt;/ref&gt;<br /> &lt;/references&gt;</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=182375 2014-06-09T12:06:38Z

<p>Jxjjeremy123: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> [[File:OsRAF is an ERF-like gene.png]]<br /> OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale<br /> bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g<br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> == References ==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Banno H, Ikeda Y, Niu QW et al (2001) Overexpression of Arabidopsis ESR1 induces initiation of shoot regeneration.Plant Cell 13:2609–2618&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392&lt;/ref&gt;<br /> &lt;/references&gt;</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=182361 2014-06-09T12:00:50Z

<p>Jxjjeremy123: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> [[File:OsRAF is an ERF-like gene.png]]<br /> OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale<br /> bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g<br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> == References ==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Banno H, Ikeda Y, Niu QW et al (2001) Overexpression of Arabidopsis ESR1 induces initiation of shoot regeneration.Plant Cell 13:2609–2618&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Chuck G, Muszynski M, Kellogg E et al (2002) The control of spikelet meristem identity by the branched silkless1 gene in maize. Science 298:1238–1241&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Decker CJ, Parker R (1995) Diversity of cytoplasmic functions for the 30 untranslated region of eukaryotic transcripts.Curr Opin Cell Biol 7:386–392&lt;/ref&gt;</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=182343 2014-06-09T11:53:14Z

<p>Jxjjeremy123: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> [[File:OsRAF is an ERF-like gene.png]]<br /> OsRAF is a nucleuslocalized protein. (a–d) Onion epidermis transformed with 35S::OsRAF::GFP construct (a, b) or pCAMBIA1302 (control) (c, d) observed under microscopy with an FITC filter (Zeiss) (a, c) or under bright field (b, d). (e–g) OsRAF::GFP signals in root tip cells from transgenic Arabidopsis plants observed under microscopy (e) or stained with propidium iodide (f) with an FITC filter, g is a bright-field graph. Arrowhead indicates endopleural cell. Scale<br /> bar = 50 lm in a for a to b, in c for c to d and in e for e, f, g<br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> ==References==<br /> Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:OsRAF_is_an_ERF-like_gene.png&diff=181952 2014-06-09T07:12:14Z

<p>Jxjjeremy123: </p> <hr /> <div></div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181944 2014-06-09T07:05:54Z

<p>Jxjjeremy123: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> ==References==<br /> Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181941 2014-06-09T07:04:27Z

<p>Jxjjeremy123: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> ==References==<br /> &lt;references&gt; <br /> &lt;ref name=&quot;ref1&quot;&gt; <br /> Yibing Hu Æ Kang Chong Æ Tai Wang(2007) OsRAF is an ethylene responsive and root abundant factor gene of rice.Plant Growth Regul (2008) 54:55–61<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0183000|<br /> Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|<br /> Version = NM_001055712.1 GI:115451152 GeneID:4331845|<br /> Length = 1794 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:4327072..4328865|<br /> CDS = 4327660..4328399,4328509..4328773|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF &lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181936 2014-06-09T06:59:54Z

<p>Jxjjeremy123: /* Labs working on this gene */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Research Center for Molecular &amp; Developmental Biology, Key Laboratory of Photosynthesis &amp; Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, 20 Nanxincun, Xiangshan, Haidianqu, Beijing 100093, China<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0183000|<br /> Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|<br /> Version = NM_001055712.1 GI:115451152 GeneID:4331845|<br /> Length = 1794 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:4327072..4328865|<br /> CDS = 4327660..4328399,4328509..4328773|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF &lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181934 2014-06-09T06:57:58Z

<p>Jxjjeremy123: /* Evolution */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> In summary, our experiment identified that OsRAF was an ethylene responsive gene. As mentioned in the introduction, no such genes in rice had been reported previously although ethylene responsive genes were extensively investigated in Arabidopsis and in tobacco. Moreover, our data from rice together with research from other species showed that these ERF genes were similar in function.In contrast, functions of AP2 subfamily members varied obviously. For example, APETALA2 and its homologues in maize and in petunia play different roles in plant development.An intriguing question is why stress responsive ERF members are more conserved in function, whereas development related AP2 members are more versatile? Further investigation will help us gain new insight into the function concerning this superfamily.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0183000|<br /> Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|<br /> Version = NM_001055712.1 GI:115451152 GeneID:4331845|<br /> Length = 1794 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:4327072..4328865|<br /> CDS = 4327660..4328399,4328509..4328773|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF &lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181927 2014-06-09T06:46:21Z

<p>Jxjjeremy123: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> The expression could be up-regulated by ethylene or low temperature. Transient expression of OsRAF::GFP fusion in onion epidermis cells and its overexpression in Arabidopsis revealed that OsRAF was a nucleus localized protein. Down-regulation of OsRAF’s expression by RNAi method failed to produce aberrance in ransgenic rice, which suggests existence of functionally redundant gene(s).<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0183000|<br /> Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|<br /> Version = NM_001055712.1 GI:115451152 GeneID:4331845|<br /> Length = 1794 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:4327072..4328865|<br /> CDS = 4327660..4328399,4328509..4328773|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF &lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181915 2014-06-09T06:39:26Z

<p>Jxjjeremy123: /* Function */ OsRAF is an ethylene responsive and root abundant factor gene of rice</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others. In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0183000|<br /> Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|<br /> Version = NM_001055712.1 GI:115451152 GeneID:4331845|<br /> Length = 1794 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:4327072..4328865|<br /> CDS = 4327660..4328399,4328509..4328773|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF &lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181910 2014-06-09T06:38:49Z

<p>Jxjjeremy123: /* Expression */ OsRAF is an ethylene responsive and root abundant factor gene of rice</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others. In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0183000|<br /> Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|<br /> Version = NM_001055712.1 GI:115451152 GeneID:4331845|<br /> Length = 1794 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:4327072..4328865|<br /> CDS = 4327660..4328399,4328509..4328773|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF &lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Jxjjeremy123 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0183000&diff=181908 2014-06-09T06:37:58Z

<p>Jxjjeremy123: /* Function */ OsRAF is an ethylene responsive and root abundant factor gene of rice</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> AP2/ethylene responsive-element binding proteins (EREBPs) compose of a superfamily of transcription factors that exist extensively in plants and microorganisms.The superfamily is divided on the basis of number of domains and function into five subfamilies namely AP2, ERF, DREB, RAV and others.<br /> In Arabidopsis and tomato, expression of many characterized ERFs can be induced by ethylene, but a corresponding ERF member has not been identified in rice.Here, we report OsRAF, a functionally unidentified rice ERF gene with known full length cDNA sequence (AK101949) capable of encoding an AP2/EREBP<br /> domain contained protein, could be up-regulated by ethylene or coldness and expressed abundantly in roots of rice at the transcriptional level. Moreover, OsRAF<br /> accumulated predominantly in the nucleus, which suggests that it might act as a transcription factor.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0183000|<br /> Description = Similar to AP2 domain containing protein RAP2.6 (Fragment)|<br /> Version = NM_001055712.1 GI:115451152 GeneID:4331845|<br /> Length = 1794 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0183000, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:4327072..4328865|<br /> CDS = 4327660..4328399,4328509..4328773|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:4327072..4328865<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtgtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MCGGAILAEFIPAPSRAAAATKRVTASHLWPAGSKNAARGKSKS KRQQRSFADVDDFEAAFEQFDDDSDFDDAEEEDEGHFVFASKSRVVAGHDGRAAARAA SKKKRGRHFRGIRQRPWGKWAAEIRDPHKGTRVWLGTFNTPEEAARAYDVEARRLRGS KAKVNFPATPAAARPRRGNTRATAVPPPATAPAAAPPRGLKREFSPPAETALPFFTNG FVDLTTAAAPPPAMMMTSSFTDSVATSESGGSPAKKARSDDVDSSEGSVGGGSDTLGF TDELEFDPFMLFQLPYSDGYESIDSLFAAGDANSANTDMNAGVNLWSFDDFPIDGALF &lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;467..1206#93..357#aaaggcattcgcaacacacacttgaagaaaaaaaacacgacgaacacgttaaaaaaaggtcgaagagaagtgggagacccaaaccgcgaacaatgtgtggaggcgccatcctcgccgagttcatcccggcgccgtcgcgcgccgcggcggcgaccaagcgggtgaccgccagccacctgtggccggccggctccaagaacgccgcccgcggcaagagcaagagcaagaggcagcagaggagcttcgccgacgtcgacgacttcgaggccgccttcgagcagttcgacgatgactccgacttcgacgacgcggaggaagaagacgaaggacacttcgtgttcgcgtccaaatctcgtggtaatgttcgtcgcgtgcgatctcgtctaggtgttcgatcgtgatggcgatgagttcttggcttgatctcaccgaggaagattggtttggtttggttttgttcgtgcagtcgtcgccgggcacgacgggcgcgcggcggcgagggcggcgagcaagaagaagcgggggcggcacttccgaggcatccggcagcggccatgggggaagtgggcggcggagatccgcgacccgcacaagggcacgcgcgtctggctcggcacgttcaacaccccggaggaggccgcacgcgcctacgacgtcgaggcgcgccgcctccgcggcagcaaggccaaggtcaacttccccgccacgcccgccgccgcgcgcccacgccgcggcaacacgagagccaccgccgtgccaccgccggcgacagcacccgccgccgccccgccgcgcggactgaagcgagaattctcgccgcctgctgagaccgcgctacctttcttcaccaacggcttcgtcgacctgacgaccgccgcggcgccgccaccggccatgatgatgacgagctccttcaccgacagcgtcgccacgtcggagtccggcgggagccccgccaagaaggcgaggtccgacgacgtcgactcgtccgagggcagcgtcggcggcggcagcgacacgctgggtttcaccgacgagctggagttcgacccgttcatgctgttccagctcccctactccgacggctacgagtccatcgacagcctcttcgccgccggcgacgccaacagcgcgaacaccgacatgaacgccggcgtcaacctgtggagcttcgacgacttcccaatcgacggcgcccttttctgatgtactcctccattgatgcagtttgtgcactcaattgtaagcatctgaattcacttccattttaatggattcagttaaaaacttaaaatccatctgttcatcaggattatatatcttgatcagataccatgccatttcttggttcaggttaatcacgtcgtcgttgatgaatgtttaaccggaggatgatggggtgcagctgatatcatggcttgcttgattaccgaattatattgcggtgtttgtgtttgtcaattagattctgaatctgtactactgccgatcttatgatcaaaactatatattaagtttatgtactcttaatttgtgggctacttttacggggtcttcgtactgctggtcaaatagtcctatgaaatcgatcatgtcggcaatatcgtcgtcaattatcgtggtcgtggttgttaatgatgtcaaataagtctatgaaaacctggtcctcttggtgtttatgtaccactgatcgatccatcatttgatctctgtcatgttgagatggatcgtgtaagaatatcataatttgctggattcagtccagtcgtaatgtattttggtttgtacaactgc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055712.1 RefSeq:Os03g0183000]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Jxjjeremy123