http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=Leilei+Yang 2026-05-26T12:32:49Z User contributions MediaWiki 1.30.0 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183873 2014-06-11T04:48:56Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Os03g0742900'' which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. ''Osiaa13'' mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> Figure 1 (A, B) Two-week-old wild-type Taichung 65 (A) and mutant (B) seedlings. Scale bars = 5 cm. (C, D) Lateral roots in 2-week-old wild-type (C) and mutant (D). Scale bars = 1 mm. (E, F) Root hairs in 2-week-old wild-type (E) and mutant (F). Scale bars = 1 mm. (G) Root tip angles of wild-type and mutant. Seedlings were grown vertically and then rotated 90◦ for 24 h. (H, I) Root tip of ''ProDR5:GUS''-introduced wild-type (H) and mutant (I). Scale bars = 200 μm. (J, K) Lateral root initiation sites of ''ProDR5:GUS''-introduced wild-type (J) and mutant (K). Scale bars = 200 μm. (L, M) Cross sections through the nodes of ''ProDR5:GUS''-introduced wild-type (L) and mutant (M) at crown root initiation sites. Scale bars = 200 μm.<br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> Figure 2 Gene isolation and complementation test. (A) High-resolution linkage and physiological map of the ''OsIAA13'' locus. The vertical bars represent molecular markers, and the numbers of recombinant plants are indicated below the linkage map. (B) Structure of the ''OsIAA13'' gene. Black boxes and horizontal lines indicate exons and each domain of the IAA protein, respectively.wild-type containing the ''ProOsIAA13:Osiaa13'' construct (C), ''Osiaa13'' containing the empty vector (D), and wild-type containing the empty vector (E) are shown on the left. Magnifications of crown roots in each transgenic plant are shown in the right. Scale bars = 5 mm.<br /> ===Expression===<br /> Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in ''Osiaa13''.<br /> <br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> <br /> Figure 3 Gene expressions related to lateral root initiation. Changes in the expression levels of 21 genes in ''Osiaa13''. Vertical bars indicate the expression levels of ''Osiaa13'' relative to that of the wild-type, considering the expression level of the wild-type to be 100%. The genes that are downregulated (&lt;0.7-fold) and upregulated (&gt;1.4-fold) in ''Osiaa13'' are indicated by bars colored dark gray and light gray, respectively.<br /> <br /> ===Evolution===<br /> OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> <br /> ==Labs working on this gene==<br /> Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan<br /> <br /> ==References==<br /> 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> <br /> 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.<br /> <br /> 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.<br /> <br /> 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.<br /> <br /> 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130<br /> <br /> 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183871 2014-06-11T04:47:07Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Os03g0742900'' which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> Figure 1 (A, B) Two-week-old wild-type Taichung 65 (A) and mutant (B) seedlings. Scale bars = 5 cm. (C, D) Lateral roots in 2-week-old wild-type (C) and mutant (D). Scale bars = 1 mm. (E, F) Root hairs in 2-week-old wild-type (E) and mutant (F). Scale bars = 1 mm. (G) Root tip angles of wild-type and mutant. Seedlings were grown vertically and then rotated 90◦ for 24 h. (H, I) Root tip of ''ProDR5:GUS''-introduced wild-type (H) and mutant (I). Scale bars = 200 μm. (J, K) Lateral root initiation sites of ''ProDR5:GUS''-introduced wild-type (J) and mutant (K). Scale bars = 200 μm. (L, M) Cross sections through the nodes of ''ProDR5:GUS''-introduced wild-type (L) and mutant (M) at crown root initiation sites. Scale bars = 200 μm.<br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> Figure 2 Gene isolation and complementation test. (A) High-resolution linkage and physiological map of the ''OsIAA13'' locus. The vertical bars represent molecular markers, and the numbers of recombinant plants are indicated below the linkage map. (B) Structure of the ''OsIAA13'' gene. Black boxes and horizontal lines indicate exons and each domain of the IAA protein, respectively.wild-type containing the ''ProOsIAA13:Osiaa13'' construct (C), ''Osiaa13'' containing the empty vector (D), and wild-type containing the empty vector (E) are shown on the left. Magnifications of crown roots in each transgenic plant are shown in the right. Scale bars = 5 mm.<br /> ===Expression===<br /> Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in ''Osiaa13''.<br /> <br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> <br /> Figure 3 Gene expressions related to lateral root initiation. Changes in the expression levels of 21 genes in ''Osiaa13''. Vertical bars indicate the expression levels of ''Osiaa13'' relative to that of the wild-type, considering the expression level of the wild-type to be 100%. The genes that are downregulated (&lt;0.7-fold) and upregulated (&gt;1.4-fold) in ''Osiaa13'' are indicated by bars colored dark gray and light gray, respectively.<br /> <br /> ===Evolution===<br /> OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> <br /> ==Labs working on this gene==<br /> Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan<br /> <br /> ==References==<br /> 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> <br /> 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.<br /> <br /> 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.<br /> <br /> 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.<br /> <br /> 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130<br /> <br /> 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183870 2014-06-11T04:46:15Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Os03g0742900'' which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> Figure 1 (A, B) Two-week-old wild-type Taichung 65 (A) and mutant (B) seedlings. Scale bars = 5 cm. (C, D) Lateral roots in 2-week-old wild-type (C) and mutant (D). Scale bars = 1 mm. (E, F) Root hairs in 2-week-old wild-type (E) and mutant (F). Scale bars = 1 mm. (G) Root tip angles of wild-type and mutant. Seedlings were grown vertically and then rotated 90◦ for 24 h. (H, I) Root tip of ''ProDR5:GUS''-introduced wild-type (H) and mutant (I). Scale bars = 200 μm. (J, K) Lateral root initiation sites of ''ProDR5:GUS''-introduced wild-type (J) and mutant (K). Scale bars = 200 μ���m. (L, M) Cross sections through the nodes of ''ProDR5:GUS''-introduced wild-type (L) and mutant (M) at crown root initiation sites. Scale bars = 200 μm.<br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> Figure 2 Gene isolation and complementation test. (A) High-resolution linkage and physiological map of the ''OsIAA13'' locus. The vertical bars represent molecular markers, and the numbers of recombinant plants are indicated below the linkage map. (B) Structure of the ''OsIAA13'' gene. Black boxes and horizontal lines indicate exons and each domain of the IAA protein, respectively.wild-type containing the ''ProOsIAA13:Osiaa13'' construct (C), ''Osiaa13'' containing the empty vector (D), and wild-type containing the empty vector (E) are shown on the left. Magnifications of crown roots in each transgenic plant are shown in the right. Scale bars = 5 mm.<br /> ===Expression===<br /> Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in ''Osiaa13''.<br /> <br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> <br /> Figure 3 Gene expressions related to lateral root initiation. Changes in the expression levels of 21 genes in ''Osiaa13''. Vertical bars indicate the expression levels of ''Osiaa13'' relative to that of the wild-type, considering the expression level of the wild-type to be 100%. The genes that are downregulated (&lt;0.7-fold) and upregulated (&gt;1.4-fold) in ''Osiaa13'' are indicated by bars colored dark gray and light gray, respectively.<br /> <br /> ===Evolution===<br /> OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> <br /> ==Labs working on this gene==<br /> Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan<br /> <br /> ==References==<br /> 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> <br /> 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.<br /> <br /> 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.<br /> <br /> 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.<br /> <br /> 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130<br /> <br /> 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183868 2014-06-11T04:41:37Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Os03g0742900'' which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> Figure 1 (A, B) Two-week-old wild-type Taichung 65 (A) and mutant (B) seedlings. Scale bars = 5 cm. (C, D) Lateral roots in 2-week-old wild-type (C) and mutant (D). Scale bars = 1 mm. (E, F) Root hairs in 2-week-old wild-type (E) and mutant (F). Scale bars = 1 mm. (G) Root tip angles of wild-type and mutant. Seedlings were grown vertically and then rotated 90◦ for 24 h. (H, I) Root tip of ProDR5:GUS-introduced wild-type (H) and mutant (I). Scale bars = 200 �m. (J, K) Lateral root initiation sites of ProDR5:GUS-introduced wild-type (J) and mutant (K). Scale bars = 200 �m. (L, M) Cross sections through the nodes of ProDR5:GUS-introduced wild-type (L) and mutant (M) at crown root initiation sites. Scale bars = 200 �m.<br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> Figure 2 Gene isolation and complementation test. (A) High-resolution linkage and physiological map of the ''OsIAA13'' locus. The vertical bars represent molecular markers, and the numbers of recombinant plants are indicated below the linkage map. (B) Structure of the ''OsIAA13'' gene. Black boxes and horizontal lines indicate exons and each domain of the IAA protein, respectively.wild-type containing the ''ProOsIAA13:Osiaa13'' construct (C), ''Osiaa13'' containing the empty vector (D), and wild-type containing the empty vector (E) are shown on the left. Magnifications of crown roots in each transgenic plant are shown in the right. Scale bars = 5 mm.<br /> ===Expression===<br /> Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in ''Osiaa13''.<br /> <br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> <br /> Figure 3 Gene expressions related to lateral root initiation. Changes in the expression levels of 21 genes in ''Osiaa13''. Vertical bars indicate the expression levels of ''Osiaa13'' relative to that of the wild-type, considering the expression level of the wild-type to be 100%. The genes that are downregulated (&lt;0.7-fold) and upregulated (&gt;1.4-fold) in ''Osiaa13'' are indicated by bars colored dark gray and light gray, respectively.<br /> <br /> ===Evolution===<br /> OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> <br /> ==Labs working on this gene==<br /> Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan<br /> <br /> ==References==<br /> 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> <br /> 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.<br /> <br /> 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.<br /> <br /> 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.<br /> <br /> 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130<br /> <br /> 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183867 2014-06-11T04:40:57Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Os03g0742900'' which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].<br /> <br /> [[File:Figure 1.JPG]]<br /> Figure 1 (A, B) Two-week-old wild-type Taichung 65 (A) and mutant (B) seedlings. Scale bars = 5 cm. (C, D) Lateral roots in 2-week-old wild-type (C) and mutant (D). Scale bars = 1 mm. (E, F) Root hairs in 2-week-old wild-type (E) and mutant (F). Scale bars = 1 mm. (G) Root tip angles of wild-type and mutant. Seedlings were grown vertically and then rotated 90◦ for 24 h. (H, I) Root tip of ProDR5:GUS-introduced wild-type (H) and mutant (I). Scale bars = 200 �m. (J, K) Lateral root initiation sites of ProDR5:GUS-introduced wild-type (J) and mutant (K). Scale bars = 200 �m. (L, M) Cross sections through the nodes of ProDR5:GUS-introduced wild-type (L) and mutant (M) at crown root initiation sites. Scale bars = 200 �m.<br /> <br /> [[File:Figure 2.JPG]]<br /> Figure 2 Gene isolation and complementation test. (A) High-resolution linkage and physiological map of the ''OsIAA13'' locus. The vertical bars represent molecular markers, and the numbers of recombinant plants are indicated below the linkage map. (B) Structure of the ''OsIAA13'' gene. Black boxes and horizontal lines indicate exons and each domain of the IAA protein, respectively.wild-type containing the ''ProOsIAA13:Osiaa13'' construct (C), ''Osiaa13'' containing the empty vector (D), and wild-type containing the empty vector (E) are shown on the left. Magnifications of crown roots in each transgenic plant are shown in the right. Scale bars = 5 mm.<br /> ===Expression===<br /> Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in ''Osiaa13''.<br /> <br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> Figure 3 Gene expressions related to lateral root initiation. Changes in the expression levels of 21 genes in ''Osiaa13''. Vertical bars indicate the expression levels of ''Osiaa13'' relative to that of the wild-type, considering the expression level of the wild-type to be 100%. The genes that are downregulated (&lt;0.7-fold) and upregulated (&gt;1.4-fold) in ''Osiaa13'' are indicated by bars colored dark gray and light gray, respectively.<br /> <br /> ===Evolution===<br /> OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> <br /> ==Labs working on this gene==<br /> Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan<br /> <br /> ==References==<br /> 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> <br /> 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.<br /> <br /> 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.<br /> <br /> 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.<br /> <br /> 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130<br /> <br /> 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183817 2014-06-11T02:05:01Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Os03g0742900'' which encodes Oryza sativa indoleacetic acid 13(OsIAA13) is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> ===Expression===<br /> Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in ''Osiaa13''.<br /> <br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> <br /> ===Evolution===<br /> OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> <br /> ==Labs working on this gene==<br /> Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan<br /> <br /> ==References==<br /> 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> <br /> 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.<br /> <br /> 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.<br /> <br /> 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.<br /> <br /> 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130<br /> <br /> 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183813 2014-06-11T01:56:27Z

<p>Leilei Yang: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> The gene ''Os03g0742900'' (''Oryza sativa indoleacetic acid 13(OsIAA13)'') is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> <br /> A rice gain-of-function mutant, ''Osiaa13'', contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13 required for the degradation of the OsIAA13 protein). The ''Osiaa13'' mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in ''Osiaa13''[1].<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> ===Expression===<br /> Comparison of the expression levels of candidate genes between wild-type and ''Osiaa13'' plants revealed that 7 genes are downregulated and 2 genes are upregulated in ''Osiaa13''. The expression levels of 7 genes (Os03g0659700, Os07g0669500,Os09g0531600, Os06g0697000, Os07g0539400, Os12g0577700,and Os03g0399800) were downregulated, and those of 2 genes (Os04g0445100 and Os08g0280200) were upregulated in Osiaa13.<br /> <br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> <br /> ===Evolution===<br /> OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. It has been reported that lateral root initiation is inhibited in a ''SLR/IAA14'' gain-of-function mutant, and in ''ARF7'' and ''ARF19'' loss-of-function mutants; the latter proteins interact with IAA14/SLR[3,4,5]. The gain-of-function mutant ''Osiaa11'' showed a similar phenotype to ''Osiaa13'': the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced [6]. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. Taken together, ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> <br /> ==Labs working on this gene==<br /> Yoshiaki Inukaia, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Aichi 464-8601, Japan<br /> <br /> ==References==<br /> 1. Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> 2. M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.<br /> 3. H. Fukaki, S. Tameda, H. Masuda, M. Tasaka, Lateral root formation is blocked by a gain-of-function mutation in the ''SOLITARY-ROOT/IAA14'' gene of ''Arabidopsis'', Plant Journal 29 (2002) 153–168.<br /> 4. B. Hughes, A. Lui, D. Nguyen, C. Onodera, H. Quach, A. Smith, G. Yu, A. Theologis, Functional genomic analysis of the ''AUXIN RESPONSE FACTOR'' gene family members in ''Arabidopsis'' thaliana: Unique and overlapping functions of ''ARF7'' and ''ARF19'', Plant Cell 17 (2005) 444–463.<br /> 5. J.C. Wilmoth, S. Wang, S.B. Tiwari, A.D. Joshi, G. Hagen, T.J. Guilfoyle, J.M. Alonso, J.R. Ecker, J.W. Reed, NPH4/ARF7 and ARF19 promote leaf expansion and auxininduced lateral root formation, Plant Journal 43 (2005) 118–130<br /> 6. Z.X. Zhu, Y. Liu, S.J. Liu, C.Z. Mao, Y.R. Wu, P. Wu, A gain-of-function mutation in ''OsIAA11'' affects lateral root development in rice, Molecular Plant 5 (2012) 154–161.<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183798 2014-06-11T01:00:10Z

<p>Leilei Yang: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> <br /> [[File:Figure 3.JPG]]<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183797 2014-06-11T00:59:23Z

<p>Leilei Yang: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> <br /> [[File:Figure 2.JPG]]<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0742900&diff=183796 2014-06-11T00:58:39Z

<p>Leilei Yang: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> [[File:Figure 1.JPG]]<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os03g0742900|<br /> Description = Aux /IAA protein|<br /> Version = NM_001057765.1 GI:115455258 GeneID:4334069|<br /> Length = 2585 bp|<br /> Definition = Oryza sativa Japonica Group Os03g0742900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br /> AP = Chromosome 3:31243860..31246444|<br /> CDS = 31244172..31244209,31244294..31244355,31244480..31244573,31244687..31244952,31246037..31246287&lt;br&gt;|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008396:31243860..31246444<br /> source=RiceChromosome03<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaaggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactgggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttgcaccaagagcaaaggacaagtacaagaacaagagctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MAGADVDVGTELRLGLPGGGGGAAEAAAKAAKRGFEETIDLKLK LPTAGMEEAAAGKAEAPAAEKAKRPAEAAAADAEKPPAPKAQAVGWPPVRSFRRNIMT VQSVKSKKEEEADKQQQQPAANASGSNSSAFVKVSMDGAPYLRKVDLKMYNSYKDLSL ALQKMFGTFTATGNNMNEVNGSDAVTTYEDKDGDWMLVGDVPWQMFVESCKRLRIMKG SEAIGLAPRAKDKYKNKS&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;2236..2273#2090..2151#1872..1965#1493..1758#158..408#tcctctctcttcttccaacacctcctaatcaccacaaaggcttaaaaatctccagtctccatagagagaaagagagagaagagaaggcagcttgatttggggcgaggagacgcgatagccgcgataggctaagcagctggcagcggcggctgctgcgatggccggcgccgacgtggacgtcgggacggagctccggctggggctgcccggaggtggcggcggcgccgccgaggcggcggccaaggccgcgaagaggggcttcgaggagaccattgacctgaagctgaagctgcccaccgccggcatggaggaggccgccgccggcaaggcggaggcgccggccgccgagaaggccaagaggccggcggaggccgccgccgccgacgccgagaagccacctgctcccaagtatgtactggacctagcatgattttattattttttcatatataaatctggcattaatatgttacagtagttccaatttgatccttcgtatatatagttgcatcgtctaattactagtttacttaataattagtgagaatttagtgggattagtattgttaatttttgctaaagggataaaagatgaattatttggtgtgctgtttggaggaactttatgcatgtttagttttgatttatggaaaaagatccacatatagtagcagcataatggcatttggtgaaaaggtgtatgcatgtttaggttattagttagttctccccccccccccccccccctcttctcttcctttcttttgtttggatttatatatttgggagcttgctgcataaacttgagatgcccatgaagcaacacctttaaaagaagcacaaattatccatataaaagagatcctctggcagaaagtgcatatggcgacaccatcgtgtatgttctttgtcgcttgcaaagtgctgagcagataattatcaccatttttaatcaccattggctcatctgatgcctgctttgtgcagcaggtgtcagaaattgctggcgatgtagtggtactactattgtttttggtttattttttccttcatctcctggcagattccatctgaaaaaggagttgttttcgtattgttttgatttattttttttcctgaaaagaagataggatcacaacaaaatatttagaacgatcagaaaaggagtacatctgtatacaattaattcctgaaataatcatggtggccatgattcatgtggcaataactaaagttgatggcattttcattatacacacagtactaccataaagttgctgcaggcatacacacataatacattagttaacacagagttggtcgccagcaagaatattgtaacatgcatgatctagctggatggaacttccagtcacgaaagtaaatcatctcagttttttcacagcgccaataagttagaacaagatgtgaaaaaactgagcaaaagaaaaaaaaatcgatgtagtagctaatttccaatgttacacatcagggcgcaggcagtgggttggccaccagttcggtcgttccgcaggaacatcatgaccgtccagtcagtgaagagcaagaaggaagaggaagctgacaagcagcagcagcagcccgctgccaatgccagcggcagcaacagctctgccttcgtgaaggtcagcatggacggggcaccctacctgcgcaaggtggacctgaagatgtacaacagctacaaggacctctcccttgctctgcagaagatgttcggcaccttcaccgcaactggtaaatcgctggccacgggaacctgcagaaacagattatcaactagtaattaatttgaatgcaaagtttgatccggaattgatgaaaacactgtgcatgaacctctctgtcagggaacaatatgaatgaggtgaatggctctgatgctgttacaacttatgaagacaaggatggtgactggatgcttgttggagatgtcccgtggcagtatgttactacttcattcttgtgcccccttaactgttttccttattttccacctcatgattagaatgcggtttagcgataccacgttcaagtttctcgcattagctgattggttactctgcaggatgtttgtcgagtcatgcaaacgcttgaggatcatgaagggttccgaagccattggtcttggtcagtatcttcagctaaaatttgctttcgtgtcaagatttatatcttaattcacaccccttgtgtgtgtggtttttcttccagcaccaagagcaaaggacaagtacaagaacaagagctgaaaatgttgcagtattaagatgctgagcatggtgccataagaatggtgttcttgcagtgtgttatggtttccttagaaatataaggttttacttgtttagctggattaaaagaaggaagagttgtcatgtttaatttgtttatggaccagaagcaataatctatttgtgtgtagctggattggtgttatgtgatgtcccctaccgtgtgtcccaagatctacttgatgattttattccaatgttgttaatttaagtttgtgtgattgtgaagtaaagggtatcaatgagactattattattatggtatctggt&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057765.1 RefSeq:Os03g0742900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 3]]<br /> [[Category:Chromosome 3]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure_3.JPG&diff=183795 2014-06-11T00:54:59Z

<p>Leilei Yang: Gene expressions related to lateral root initiation. Changes in the expression levels of 21 genes in Osiaa13. Vertical bars indicate the expression levels of Osiaa13 relative to that of the wild-type, considering the expression level of the wild-type to b</p> <hr /> <div>Gene expressions related to lateral root initiation. Changes in the expression<br /> levels of 21 genes in Osiaa13. Vertical bars indicate the expression levels of Osiaa13<br /> relative to that of the wild-type, considering the expression level of the wild-type to<br /> be 100%. The genes that are downregulated (&lt;0.7-fold) and upregulated (&gt;1.4-fold)<br /> in Osiaa13 are indicated by bars colored dark gray and light gray, respectively.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure_2.JPG&diff=183793 2014-06-11T00:53:43Z

<p>Leilei Yang: uploaded a new version of &amp;quot;File:Figure 2.JPG&amp;quot;: Gene isolation and complementation test. (A) High-resolution linkage and physiological map of the OsIAA13 locus. The vertical bars represent molecular markers, and the numbers of recombinant pla</p> <hr /> <div>Map-based cloning of d50 gene. (a) Fine mapping of d50 locus. The d50 was located in the 43-kb region between CD5 and<br /> RB2. The number indicates recombinants identified from F2 mapping plants. Predicted gene-coding regions are indicated by gray arrows,<br /> and the D50 gene is indicated by a black arrow. (b) Schema of D50 gene. The D50 gene contains 11 exons (boxes) separated by 10 introns<br /> (lines). Predicted protein-coding regions are indicated by black boxes, the 5-phosphatase domain by blue boxes, and the WD repeats by<br /> red boxes. Mutation points of each F71 mutant allele are shown. (c) Complementation of F71 phenotypes by D50 gene. F71 plants<br /> introduced D50 cDNA under the 2-kbp promoter region exhibit normal plant height (left), whereas F71 plants introduced the empty<br /> vector maintain a dwarf phenotype (right). (d) Cross-sections of transgenic F71 internodes stained by the Mäule reaction. Transgenic F71<br /> plants containing the D50 gene (left) have normal parenchyma cells, whereas plants containing the empty vector (right) exhibit strong<br /> staining of the Mäule reaction. (e) DNA gel blot analysis of d12 mutant (m) and its parent cultivar,Yukara (W), using two probes within<br /> D50-coding region. The d12 exhibits no signal, indicating the D50-coding region is completely lost from the d12 genome. Bars: 10 cm (c)and 100 mm (d).</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure_1.JPG&diff=183792 2014-06-11T00:52:55Z

<p>Leilei Yang: Phenotype of the T1-34-6 mutant. (A, B) Two-week-old wild-type Taichung 65 (A) and mutant (B) seedlings. Scale bars = 5 cm. (C, D) Lateral roots in 2-week-old wild-type (C) and mutant (D). Scale bars = 1 mm. (E, F) Root hairs in 2-week-old wild-type (E) a</p> <hr /> <div>Phenotype of the T1-34-6 mutant. (A, B) Two-week-old wild-type Taichung 65 (A) and mutant (B) seedlings. Scale bars = 5 cm. (C, D) Lateral roots in 2-week-old<br /> wild-type (C) and mutant (D). Scale bars = 1 mm. (E, F) Root hairs in 2-week-old wild-type (E) and mutant (F). Scale bars = 1 mm. (G) Root tip angles of wild-type and mutant.<br /> Seedlings were grown vertically and then rotated 90◦ for 24 h. (H, I) Root tip of ProDR5:GUS-introduced wild-type (H) and mutant (I). Scale bars = 200 �m. (J, K) Lateral root<br /> initiation sites of ProDR5:GUS-introduced wild-type (J) and mutant (K). Scale bars = 200 �m. (L, M) Cross sections through the nodes of ProDR5:GUS-introduced wild-type (L)<br /> and mutant (M) at crown root initiation sites. Scale bars = 200 �m.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183785 2014-06-10T17:05:13Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13[1].<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.<br /> The gain-of-function mutant OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA1''1, and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> '''''OsIAA13 (Os03g0742900)'' sequence'''<br /> <br /> Position: chr03:31291676..31294263 (- strand)<br /> <br /> Length: 2588 bp<br /> <br /> GGCTCCTCTC TCTTCTTCCA ACACCTCCTA ATCACCACAA AGGCTTAAAA ATCTCCAGTC TCCATAGAGA GAAAGAGAGA<br /> GAAGAGAAGG CAGCTTGATT TGGGGCGAGG AGACGCGATA GCCGCGATAG GCTAAGCAGC TGGCAGCGGC GGCTGCTGCG<br /> ATGGCCGGCG CCGACGTGGA CGTCGGGACG GAGCTCCGGC TGGGGCTGCC CGGAGGTGGC GGCGGCGCCG CCGAGGCGGC<br /> GGCCAAGGCC GCGAAGAGGG GCTTCGAGGA GACCATTGAC CTGAAGCTGA AGCTGCCCAC CGCCGGCATG GAGGAGGCCG<br /> CCGCCGGCAA GGCGGAGGCG CCGGCCGCCG AGAAGGCCAA GAGGCCGGCG GAGGCCGCCG CCGCCGACGC CGAGAAGCCA<br /> CCTGCTCCCA AGTATGTACT GGACCTAGCA TGATTTTATT ATTTTTTCAT ATATAAATCT GGCATTAATA TGTTACAGTA<br /> GTTCCAATTT GATCCTTCGT ATATATAGTT GCATCGTCTA ATTACTAGTT TACTTAATAA TTAGTGAGAA TTTAGTGGGA<br /> TTAGTATTGT TAATTTTTGC TAAAGGGATA AAAGATGAAT TATTTGGTGT GCTGTTTGGA GGAACTTTAT GCATGTTTAG<br /> TTTTGATTTA TGGAAAAAGA TCCACATATA GTAGCAGCAT AATGGCATTT GGTGAAAAGG TGTATGCATG TTTAGGTTAT<br /> TAGTTAGTTC TCCCCCCCCC CCCCCCCCCC TCTTCTCTTC CTTTCTTTTG TTTGGATTTA TATATTTGGG AGCTTGCTGC<br /> ATAAACTTGA GATGCCCATG AAGCAACACC TTTAAAAGAA GCACAAATTA TCCATATAAA AGAGATCCTC TGGCAGAAAG<br /> TGCATATGGC GACACCATCG TGTATGTTCT TTGTCGCTTG CAAAGTGCTG AGCAGATAAT TATCACCATT TTTAATCACC<br /> ATTGGCTCAT CTGATGCCTG CTTTGTGCAG CAGGTGTCAG AAATTGCTGG CGATGTAGTG GTACTACTAT TGTTTTTGGT<br /> TTATTTTTTC CTTCATCTCC TGGCAGATTC CATCTGAAAA AGGAGTTGTT TTCGTATTGT TTTGATTTAT TTTTTTTCCT<br /> GAAAAGAAGA TAGGATCACA ACAAAATATT TAGAACGATC AGAAAAGGAG TACATCTGTA TACAATTAAT TCCTGAAATA<br /> ATCATGGTGG CCATGATTCA TGTGGCAATA ACTAAAGTTG ATGGCATTTT CATTATACAC ACAGTACTAC CATAAAGTTG<br /> CTGCAGGCAT ACACACATAA TACATTAGTT AACACAGAGT TGGTCGCCAG CAAGAATATT GTAACATGCA TGATCTAGCT<br /> GGATGGAACT TCCAGTCACG AAAGTAAATC ATCTCAGTTT TTTCACAGCG CCAATAAGTT AGAACAAGAT GTGAAAAAAC<br /> TGAGCAAAAG AAAAAAAAAT CGATGTAGTA GCTAATTTCC AATGTTACAC ATCAGGGCGC AGGCAGTGGG TTGGCCACCA<br /> GTTCGGTCGT TCCGCAGGAA CATCATGACC GTCCAGTCAG TGAAGAGCAA GAAGGAAGAG GAAGCTGACA AGCAGCAGCA<br /> GCAGCCCGCT GCCAATGCCA GCGGCAGCAA CAGCTCTGCC TTCGTGAAGG TCAGCATGGA CGGGGCACCC TACCTGCGCA<br /> AGGTGGACCT GAAGATGTAC AACAGCTACA AGGACCTCTC CCTTGCTCTG CAGAAGATGT TCGGCACCTT CACCGCAACT<br /> GGTAAATCGC TGGCCACGGG AACCTGCAGA AACAGATTAT CAACTAGTAA TTAATTTGAA TGCAAAGTTT GATCCGGAAT<br /> TGATGAAAAC ACTGTGCATG AACCTCTCTG TCAGGGAACA ATATGAATGA GGTGAATGGC TCTGATGCTG TTACAACTTA<br /> TGAAGACAAG GATGGTGACT GGATGCTTGT TGGAGATGTC CCGTGGCAGT ATGTTACTAC TTCATTCTTG TGCCCCCTTA<br /> ACTGTTTTCC TTATTTTCCA CCTCATGATT AGAATGCGGT TTAGCGATAC CACGTTCAAG TTTCTCGCAT TAGCTGATTG<br /> GTTACTCTGC AGGATGTTTG TCGAGTCATG CAAACGCTTG AGGATCATGA AGGGTTCCGA AGCCATTGGT CTTGGTCAGT<br /> ATCTTCAGCT AAAATTTGCT TTCGTGTCAA GATTTATATC TTAATTCACA CCCCTTGTGT GTGTGGTTTT TCTTCCAGCA<br /> CCAAGAGCAA AGGACAAGTA CAAGAACAAG AGCTGAAAAT GTTGCAGTAT TAAGATGCTG AGCATGGTGC CATAAGAATG<br /> GTGTTCTTGC AGTGTGTTAT GGTTTCCTTA GAAATATAAG GTTTTACTTG TTTAGCTGGA TTAAAAGAAG GAAGAGTTGT<br /> CATGTTTAAT TTGTTTATGG ACCAGAAGCA ATAATCTATT TGTGTGTAGC TGGATTGGTG TTATGTGATG TCCCCTACCG<br /> TGTGTCCCAA GATCTACTTG ATGATTTTAT TCCAATGTTG TTAATTTAAG TTTGTGTGAT TGTGAAGTAA AGGGTATCAA<br /> TGAGACTATT ATTATTATGG TATCTGGT<br /> <br /> [1]Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> <br /> [2]M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183784 2014-06-10T17:04:56Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13[1].<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.<br /> The gain-of-function mutant OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA1''1, and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> '''''OsIAA13 (Os03g0742900)'' sequence'''<br /> <br /> Position: chr03:31291676..31294263 (- strand)<br /> <br /> Length: 2588 bp<br /> <br /> GGCTCCTCTC TCTTCTTCCA ACACCTCCTA ATCACCACAA AGGCTTAAAA ATCTCCAGTC TCCATAGAGA GAAAGAGAGA<br /> GAAGAGAAGG CAGCTTGATT TGGGGCGAGG AGACGCGATA GCCGCGATAG GCTAAGCAGC TGGCAGCGGC GGCTGCTGCG<br /> ATGGCCGGCG CCGACGTGGA CGTCGGGACG GAGCTCCGGC TGGGGCTGCC CGGAGGTGGC GGCGGCGCCG CCGAGGCGGC<br /> GGCCAAGGCC GCGAAGAGGG GCTTCGAGGA GACCATTGAC CTGAAGCTGA AGCTGCCCAC CGCCGGCATG GAGGAGGCCG<br /> CCGCCGGCAA GGCGGAGGCG CCGGCCGCCG AGAAGGCCAA GAGGCCGGCG GAGGCCGCCG CCGCCGACGC CGAGAAGCCA<br /> CCTGCTCCCA AGTATGTACT GGACCTAGCA TGATTTTATT ATTTTTTCAT ATATAAATCT GGCATTAATA TGTTACAGTA<br /> GTTCCAATTT GATCCTTCGT ATATATAGTT GCATCGTCTA ATTACTAGTT TACTTAATAA TTAGTGAGAA TTTAGTGGGA<br /> TTAGTATTGT TAATTTTTGC TAAAGGGATA AAAGATGAAT TATTTGGTGT GCTGTTTGGA GGAACTTTAT GCATGTTTAG<br /> TTTTGATTTA TGGAAAAAGA TCCACATATA GTAGCAGCAT AATGGCATTT GGTGAAAAGG TGTATGCATG TTTAGGTTAT<br /> TAGTTAGTTC TCCCCCCCCC CCCCCCCCCC TCTTCTCTTC CTTTCTTTTG TTTGGATTTA TATATTTGGG AGCTTGCTGC<br /> ATAAACTTGA GATGCCCATG AAGCAACACC TTTAAAAGAA GCACAAATTA TCCATATAAA AGAGATCCTC TGGCAGAAAG<br /> TGCATATGGC GACACCATCG TGTATGTTCT TTGTCGCTTG CAAAGTGCTG AGCAGATAAT TATCACCATT TTTAATCACC<br /> ATTGGCTCAT CTGATGCCTG CTTTGTGCAG CAGGTGTCAG AAATTGCTGG CGATGTAGTG GTACTACTAT TGTTTTTGGT<br /> TTATTTTTTC CTTCATCTCC TGGCAGATTC CATCTGAAAA AGGAGTTGTT TTCGTATTGT TTTGATTTAT TTTTTTTCCT<br /> GAAAAGAAGA TAGGATCACA ACAAAATATT TAGAACGATC AGAAAAGGAG TACATCTGTA TACAATTAAT TCCTGAAATA<br /> ATCATGGTGG CCATGATTCA TGTGGCAATA ACTAAAGTTG ATGGCATTTT CATTATACAC ACAGTACTAC CATAAAGTTG<br /> CTGCAGGCAT ACACACATAA TACATTAGTT AACACAGAGT TGGTCGCCAG CAAGAATATT GTAACATGCA TGATCTAGCT<br /> GGATGGAACT TCCAGTCACG AAAGTAAATC ATCTCAGTTT TTTCACAGCG CCAATAAGTT AGAACAAGAT GTGAAAAAAC<br /> TGAGCAAAAG AAAAAAAAAT CGATGTAGTA GCTAATTTCC AATGTTACAC ATCAGGGCGC AGGCAGTGGG TTGGCCACCA<br /> GTTCGGTCGT TCCGCAGGAA CATCATGACC GTCCAGTCAG TGAAGAGCAA GAAGGAAGAG GAAGCTGACA AGCAGCAGCA<br /> GCAGCCCGCT GCCAATGCCA GCGGCAGCAA CAGCTCTGCC TTCGTGAAGG TCAGCATGGA CGGGGCACCC TACCTGCGCA<br /> AGGTGGACCT GAAGATGTAC AACAGCTACA AGGACCTCTC CCTTGCTCTG CAGAAGATGT TCGGCACCTT CACCGCAACT<br /> GGTAAATCGC TGGCCACGGG AACCTGCAGA AACAGATTAT CAACTAGTAA TTAATTTGAA TGCAAAGTTT GATCCGGAAT<br /> TGATGAAAAC ACTGTGCATG AACCTCTCTG TCAGGGAACA ATATGAATGA GGTGAATGGC TCTGATGCTG TTACAACTTA<br /> TGAAGACAAG GATGGTGACT GGATGCTTGT TGGAGATGTC CCGTGGCAGT ATGTTACTAC TTCATTCTTG TGCCCCCTTA<br /> ACTGTTTTCC TTATTTTCCA CCTCATGATT AGAATGCGGT TTAGCGATAC CACGTTCAAG TTTCTCGCAT TAGCTGATTG<br /> GTTACTCTGC AGGATGTTTG TCGAGTCATG CAAACGCTTG AGGATCATGA AGGGTTCCGA AGCCATTGGT CTTGGTCAGT<br /> ATCTTCAGCT AAAATTTGCT TTCGTGTCAA GATTTATATC TTAATTCACA CCCCTTGTGT GTGTGGTTTT TCTTCCAGCA<br /> CCAAGAGCAA AGGACAAGTA CAAGAACAAG AGCTGAAAAT GTTGCAGTAT TAAGATGCTG AGCATGGTGC CATAAGAATG<br /> GTGTTCTTGC AGTGTGTTAT GGTTTCCTTA GAAATATAAG GTTTTACTTG TTTAGCTGGA TTAAAAGAAG GAAGAGTTGT<br /> CATGTTTAAT TTGTTTATGG ACCAGAAGCA ATAATCTATT TGTGTGTAGC TGGATTGGTG TTATGTGATG TCCCCTACCG<br /> TGTGTCCCAA GATCTACTTG ATGATTTTAT TCCAATGTTG TTAATTTAAG TTTGTGTGAT TGTGAAGTAA AGGGTATCAA<br /> TGAGACTATT ATTATTATGG TATCTGGT<br /> <br /> [1]Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> [2]M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183783 2014-06-10T17:03:28Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13[1].<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.<br /> The gain-of-function mutant OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA1''1, and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> '''''OsIAA13 (Os03g0742900)'' sequence'''<br /> Position: chr03:31291676..31294263 (- strand)<br /> Length: 2588 bp<br /> <br /> GGCTCCTCTC TCTTCTTCCA ACACCTCCTA ATCACCACAA AGGCTTAAAA ATCTCCAGTC TCCATAGAGA GAAAGAGAGA<br /> GAAGAGAAGG CAGCTTGATT TGGGGCGAGG AGACGCGATA GCCGCGATAG GCTAAGCAGC TGGCAGCGGC GGCTGCTGCG<br /> ATGGCCGGCG CCGACGTGGA CGTCGGGACG GAGCTCCGGC TGGGGCTGCC CGGAGGTGGC GGCGGCGCCG CCGAGGCGGC<br /> GGCCAAGGCC GCGAAGAGGG GCTTCGAGGA GACCATTGAC CTGAAGCTGA AGCTGCCCAC CGCCGGCATG GAGGAGGCCG<br /> CCGCCGGCAA GGCGGAGGCG CCGGCCGCCG AGAAGGCCAA GAGGCCGGCG GAGGCCGCCG CCGCCGACGC CGAGAAGCCA<br /> CCTGCTCCCA AGTATGTACT GGACCTAGCA TGATTTTATT ATTTTTTCAT ATATAAATCT GGCATTAATA TGTTACAGTA<br /> GTTCCAATTT GATCCTTCGT ATATATAGTT GCATCGTCTA ATTACTAGTT TACTTAATAA TTAGTGAGAA TTTAGTGGGA<br /> TTAGTATTGT TAATTTTTGC TAAAGGGATA AAAGATGAAT TATTTGGTGT GCTGTTTGGA GGAACTTTAT GCATGTTTAG<br /> TTTTGATTTA TGGAAAAAGA TCCACATATA GTAGCAGCAT AATGGCATTT GGTGAAAAGG TGTATGCATG TTTAGGTTAT<br /> TAGTTAGTTC TCCCCCCCCC CCCCCCCCCC TCTTCTCTTC CTTTCTTTTG TTTGGATTTA TATATTTGGG AGCTTGCTGC<br /> ATAAACTTGA GATGCCCATG AAGCAACACC TTTAAAAGAA GCACAAATTA TCCATATAAA AGAGATCCTC TGGCAGAAAG<br /> TGCATATGGC GACACCATCG TGTATGTTCT TTGTCGCTTG CAAAGTGCTG AGCAGATAAT TATCACCATT TTTAATCACC<br /> ATTGGCTCAT CTGATGCCTG CTTTGTGCAG CAGGTGTCAG AAATTGCTGG CGATGTAGTG GTACTACTAT TGTTTTTGGT<br /> TTATTTTTTC CTTCATCTCC TGGCAGATTC CATCTGAAAA AGGAGTTGTT TTCGTATTGT TTTGATTTAT TTTTTTTCCT<br /> GAAAAGAAGA TAGGATCACA ACAAAATATT TAGAACGATC AGAAAAGGAG TACATCTGTA TACAATTAAT TCCTGAAATA<br /> ATCATGGTGG CCATGATTCA TGTGGCAATA ACTAAAGTTG ATGGCATTTT CATTATACAC ACAGTACTAC CATAAAGTTG<br /> CTGCAGGCAT ACACACATAA TACATTAGTT AACACAGAGT TGGTCGCCAG CAAGAATATT GTAACATGCA TGATCTAGCT<br /> GGATGGAACT TCCAGTCACG AAAGTAAATC ATCTCAGTTT TTTCACAGCG CCAATAAGTT AGAACAAGAT GTGAAAAAAC<br /> TGAGCAAAAG AAAAAAAAAT CGATGTAGTA GCTAATTTCC AATGTTACAC ATCAGGGCGC AGGCAGTGGG TTGGCCACCA<br /> GTTCGGTCGT TCCGCAGGAA CATCATGACC GTCCAGTCAG TGAAGAGCAA GAAGGAAGAG GAAGCTGACA AGCAGCAGCA<br /> GCAGCCCGCT GCCAATGCCA GCGGCAGCAA CAGCTCTGCC TTCGTGAAGG TCAGCATGGA CGGGGCACCC TACCTGCGCA<br /> AGGTGGACCT GAAGATGTAC AACAGCTACA AGGACCTCTC CCTTGCTCTG CAGAAGATGT TCGGCACCTT CACCGCAACT<br /> GGTAAATCGC TGGCCACGGG AACCTGCAGA AACAGATTAT CAACTAGTAA TTAATTTGAA TGCAAAGTTT GATCCGGAAT<br /> TGATGAAAAC ACTGTGCATG AACCTCTCTG TCAGGGAACA ATATGAATGA GGTGAATGGC TCTGATGCTG TTACAACTTA<br /> TGAAGACAAG GATGGTGACT GGATGCTTGT TGGAGATGTC CCGTGGCAGT ATGTTACTAC TTCATTCTTG TGCCCCCTTA<br /> ACTGTTTTCC TTATTTTCCA CCTCATGATT AGAATGCGGT TTAGCGATAC CACGTTCAAG TTTCTCGCAT TAGCTGATTG<br /> GTTACTCTGC AGGATGTTTG TCGAGTCATG CAAACGCTTG AGGATCATGA AGGGTTCCGA AGCCATTGGT CTTGGTCAGT<br /> ATCTTCAGCT AAAATTTGCT TTCGTGTCAA GATTTATATC TTAATTCACA CCCCTTGTGT GTGTGGTTTT TCTTCCAGCA<br /> CCAAGAGCAA AGGACAAGTA CAAGAACAAG AGCTGAAAAT GTTGCAGTAT TAAGATGCTG AGCATGGTGC CATAAGAATG<br /> GTGTTCTTGC AGTGTGTTAT GGTTTCCTTA GAAATATAAG GTTTTACTTG TTTAGCTGGA TTAAAAGAAG GAAGAGTTGT<br /> CATGTTTAAT TTGTTTATGG ACCAGAAGCA ATAATCTATT TGTGTGTAGC TGGATTGGTG TTATGTGATG TCCCCTACCG<br /> TGTGTCCCAA GATCTACTTG ATGATTTTAT TCCAATGTTG TTAATTTAAG TTTGTGTGAT TGTGAAGTAA AGGGTATCAA<br /> TGAGACTATT ATTATTATGG TATCTGGT<br /> <br /> [[1]]Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> [[2]]M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183782 2014-06-10T17:03:09Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[1].<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13[1].<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.<br /> The gain-of-function mutant OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[2]. Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA1''1, and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> '''''OsIAA13 (Os03g0742900)'' sequence'''<br /> Position: chr03:31291676..31294263 (- strand)<br /> Length: 2588 bp<br /> GGCTCCTCTC TCTTCTTCCA ACACCTCCTA ATCACCACAA AGGCTTAAAA ATCTCCAGTC TCCATAGAGA GAAAGAGAGA<br /> GAAGAGAAGG CAGCTTGATT TGGGGCGAGG AGACGCGATA GCCGCGATAG GCTAAGCAGC TGGCAGCGGC GGCTGCTGCG<br /> ATGGCCGGCG CCGACGTGGA CGTCGGGACG GAGCTCCGGC TGGGGCTGCC CGGAGGTGGC GGCGGCGCCG CCGAGGCGGC<br /> GGCCAAGGCC GCGAAGAGGG GCTTCGAGGA GACCATTGAC CTGAAGCTGA AGCTGCCCAC CGCCGGCATG GAGGAGGCCG<br /> CCGCCGGCAA GGCGGAGGCG CCGGCCGCCG AGAAGGCCAA GAGGCCGGCG GAGGCCGCCG CCGCCGACGC CGAGAAGCCA<br /> CCTGCTCCCA AGTATGTACT GGACCTAGCA TGATTTTATT ATTTTTTCAT ATATAAATCT GGCATTAATA TGTTACAGTA<br /> GTTCCAATTT GATCCTTCGT ATATATAGTT GCATCGTCTA ATTACTAGTT TACTTAATAA TTAGTGAGAA TTTAGTGGGA<br /> TTAGTATTGT TAATTTTTGC TAAAGGGATA AAAGATGAAT TATTTGGTGT GCTGTTTGGA GGAACTTTAT GCATGTTTAG<br /> TTTTGATTTA TGGAAAAAGA TCCACATATA GTAGCAGCAT AATGGCATTT GGTGAAAAGG TGTATGCATG TTTAGGTTAT<br /> TAGTTAGTTC TCCCCCCCCC CCCCCCCCCC TCTTCTCTTC CTTTCTTTTG TTTGGATTTA TATATTTGGG AGCTTGCTGC<br /> ATAAACTTGA GATGCCCATG AAGCAACACC TTTAAAAGAA GCACAAATTA TCCATATAAA AGAGATCCTC TGGCAGAAAG<br /> TGCATATGGC GACACCATCG TGTATGTTCT TTGTCGCTTG CAAAGTGCTG AGCAGATAAT TATCACCATT TTTAATCACC<br /> ATTGGCTCAT CTGATGCCTG CTTTGTGCAG CAGGTGTCAG AAATTGCTGG CGATGTAGTG GTACTACTAT TGTTTTTGGT<br /> TTATTTTTTC CTTCATCTCC TGGCAGATTC CATCTGAAAA AGGAGTTGTT TTCGTATTGT TTTGATTTAT TTTTTTTCCT<br /> GAAAAGAAGA TAGGATCACA ACAAAATATT TAGAACGATC AGAAAAGGAG TACATCTGTA TACAATTAAT TCCTGAAATA<br /> ATCATGGTGG CCATGATTCA TGTGGCAATA ACTAAAGTTG ATGGCATTTT CATTATACAC ACAGTACTAC CATAAAGTTG<br /> CTGCAGGCAT ACACACATAA TACATTAGTT AACACAGAGT TGGTCGCCAG CAAGAATATT GTAACATGCA TGATCTAGCT<br /> GGATGGAACT TCCAGTCACG AAAGTAAATC ATCTCAGTTT TTTCACAGCG CCAATAAGTT AGAACAAGAT GTGAAAAAAC<br /> TGAGCAAAAG AAAAAAAAAT CGATGTAGTA GCTAATTTCC AATGTTACAC ATCAGGGCGC AGGCAGTGGG TTGGCCACCA<br /> GTTCGGTCGT TCCGCAGGAA CATCATGACC GTCCAGTCAG TGAAGAGCAA GAAGGAAGAG GAAGCTGACA AGCAGCAGCA<br /> GCAGCCCGCT GCCAATGCCA GCGGCAGCAA CAGCTCTGCC TTCGTGAAGG TCAGCATGGA CGGGGCACCC TACCTGCGCA<br /> AGGTGGACCT GAAGATGTAC AACAGCTACA AGGACCTCTC CCTTGCTCTG CAGAAGATGT TCGGCACCTT CACCGCAACT<br /> GGTAAATCGC TGGCCACGGG AACCTGCAGA AACAGATTAT CAACTAGTAA TTAATTTGAA TGCAAAGTTT GATCCGGAAT<br /> TGATGAAAAC ACTGTGCATG AACCTCTCTG TCAGGGAACA ATATGAATGA GGTGAATGGC TCTGATGCTG TTACAACTTA<br /> TGAAGACAAG GATGGTGACT GGATGCTTGT TGGAGATGTC CCGTGGCAGT ATGTTACTAC TTCATTCTTG TGCCCCCTTA<br /> ACTGTTTTCC TTATTTTCCA CCTCATGATT AGAATGCGGT TTAGCGATAC CACGTTCAAG TTTCTCGCAT TAGCTGATTG<br /> GTTACTCTGC AGGATGTTTG TCGAGTCATG CAAACGCTTG AGGATCATGA AGGGTTCCGA AGCCATTGGT CTTGGTCAGT<br /> ATCTTCAGCT AAAATTTGCT TTCGTGTCAA GATTTATATC TTAATTCACA CCCCTTGTGT GTGTGGTTTT TCTTCCAGCA<br /> CCAAGAGCAA AGGACAAGTA CAAGAACAAG AGCTGAAAAT GTTGCAGTAT TAAGATGCTG AGCATGGTGC CATAAGAATG<br /> GTGTTCTTGC AGTGTGTTAT GGTTTCCTTA GAAATATAAG GTTTTACTTG TTTAGCTGGA TTAAAAGAAG GAAGAGTTGT<br /> CATGTTTAAT TTGTTTATGG ACCAGAAGCA ATAATCTATT TGTGTGTAGC TGGATTGGTG TTATGTGATG TCCCCTACCG<br /> TGTGTCCCAA GATCTACTTG ATGATTTTAT TCCAATGTTG TTAATTTAAG TTTGTGTGAT TGTGAAGTAA AGGGTATCAA<br /> TGAGACTATT ATTATTATGG TATCTGGT<br /> <br /> [[1]]Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> [[2]]M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183767 2014-06-10T16:34:38Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[[1]].<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13.<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.<br /> The gain-of-function mutant OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[[2]]. Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA1''1, and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> [[1]].Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> [[2]].M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183763 2014-06-10T16:29:04Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice[[1]].<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13.<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.<br /> The gain-of-function mutant OsIAA13 shares high sequence similarity with OsIAA11 and OsIAA30 in rice, and with AXR2/IAA7, SLR/IAA14, IAA16, and AXR3/IAA17 in ''Arabidopsis''[[2]]. Osiaa11 showed a similar phenotype to Osiaa13: the lateral root number of Osiaa11 was reduced because of a defect in LRP initiation but the crown root number was not reduced. Examination of the RiceXPro database revealed that ''OsIAA13'', ''OsIAA1''1, and ''OsIAA30'' show similar gene expression patterns indicating that the function of OsIAA30 might be redundant with OsIAA13 and OsIAA11 in lateral root initiation. ''OsIAA13'', ''OsIAA11'', and ''OsIAA30'' may play an important role in lateral root formation but not in crown root formation.<br /> <br /> 1.Yuka Kitomi;Hiroki Inahashi;Hinako Takehisa;Yutaka Sato;Yoshiaki Inukai, OsIAA13-mediated auxin signaling is involved in lateral root initiation in rice, Plant Science, 2012, 190: 116-122<br /> 2.M. Jain, N. Kaur, R. Garg, J.K. Thakur, A.K. Tyagi, J.P. Khurana, Structure expression analysis of early auxin-responsive Aux/IAA gene family in rice (''Oryza sativa''), Functional and Integrative Genomics 6 (2006) 47–59.</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183750 2014-06-10T16:19:33Z

<p>Leilei Yang: </p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice.<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13.<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.<br /> [[File:]]</div>

Leilei Yang https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Users&diff=183735 2014-06-10T16:12:51Z

<p>Leilei Yang: Created page with &quot;The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in ri...&quot;</p> <hr /> <div>The gene ''Oryza sativa indoleacetic acid 13(OsIAA13)'' is involved in auxin signaling and controls the expression of genes that are required for lateral root initiation in rice.<br /> The open reading frame (ORF) length of OsIAA13 was 2116 bp. It's located on the long arm of chromosome 3.<br /> <br /> A rice gain-of-function mutant, Osiaa13, contains a single amino acid substitution (G to A, which resulted in a single amino acid substitution, glycine (G) to serine (S), in the core sequence in domain II of OsIAA13) in the core sequence required for the degradation of the OsIAA13 protein. The Osiaa13 mutant displayed typical auxin-related phenotypes: the number of lateral roots was significantly reduced and the root gravitropic response was defective. Osiaa13 mutants also exhibited altered GUS staining controlled by the DR5 promoter in lateral root initiation sites. Furthermore, expression levels of several genes that might be associated with lateral root initiation were altered in Osiaa13.<br /> OsIAA13 encodes a member of the rice Aux/IAA protein family and is believed to play an essential part in blocking auxin signaling by repressing ARF function as a transcriptional regulator.</div>

Leilei Yang