RiceWiki - User contributions [en]

Os02g0830200

2014-06-04T13:34:38Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.

[[File:FIG2.png]]

==Labs working on this gene==
Please input related labs here.
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[3].

[[File:FIG3.png]]

Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin[3].

[[File:FIG4.png]]

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
Please input cited references here.
1. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0830200|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001055148.1 GI:115450023 GeneID:4331245|
Length = 794 bp|
Definition = Oryza sativa Japonica Group Os02g0830200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:36576414..36577207|
CDS = 36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207|
GCID = <gbrowseImage1>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq>|
AA = <aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq>|
DNA = <dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055148.1 RefSeq:Os02g0830200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

Os04g0524300

2014-06-04T13:33:21Z

Lianglei086: /* Evolution */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.

===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.

[[File:FIG2.png]]

==Labs working on this gene==
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]

Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin.

[[File:FIG4.png]]

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os02g0830200

2014-06-04T13:30:39Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.

[[File:FIG2.png]]

==Labs working on this gene==
Please input related labs here.
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[3].
[[File:FIG3.png]]

Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin[3].

[[File:FIG4.png]]

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
Please input cited references here.
1. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0830200|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001055148.1 GI:115450023 GeneID:4331245|
Length = 794 bp|
Definition = Oryza sativa Japonica Group Os02g0830200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:36576414..36577207|
CDS = 36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207|
GCID = <gbrowseImage1>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq>|
AA = <aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq>|
DNA = <dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055148.1 RefSeq:Os02g0830200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

Os02g0830200

2014-06-04T13:30:08Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.

[[File:FIG2.png]]

==Labs working on this gene==
Please input related labs here.
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]

Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin.

[[File:FIG4.png]]

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
Please input cited references here.
1. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0830200|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001055148.1 GI:115450023 GeneID:4331245|
Length = 794 bp|
Definition = Oryza sativa Japonica Group Os02g0830200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:36576414..36577207|
CDS = 36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207|
GCID = <gbrowseImage1>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq>|
AA = <aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq>|
DNA = <dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055148.1 RefSeq:Os02g0830200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

Os02g0830200

2014-06-04T13:29:20Z

Lianglei086: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR3 belongs to thirtten A-type response regulator (RR) genes in the rice genome[1]. The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes[2]. OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous cytokinins[3].
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower. The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.
===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.

[[File:FIG2.png]]

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.
1. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359

==Structured Information==
{{JaponicaGene|
GeneName = Os02g0830200|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001055148.1 GI:115450023 GeneID:4331245|
Length = 794 bp|
Definition = Oryza sativa Japonica Group Os02g0830200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
AP = Chromosome 2:36576414..36577207|
CDS = 36576414..36576575,36576665..36576742,36576834..36576880,36577099..36577207|
GCID = <gbrowseImage1>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008395:36576414..36577207
source=RiceChromosome02
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgagttacgacggtggatagtggcaagagagcactggaggttctcagcctggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</cdnaseq>|
AA = <aaseq>MSTKTVPEPEPHVLAVDDSIVDRTVISRLLRSSKYRVTTVDSGK RALEVLSLDRNVHMIITDYCMPEMTGFDLLKRVKESAELKEIPVVLMSSENSPTRIRR CLEEGAEDFLIKPVRPSDVSRLCNRVIMK</aaseq>|
DNA = <dnaseqindica>633..794#466..543#328..374#1..109#atgtcgacgaagacagtgccggagccggagccgcacgtcctcgccgtggacgacagcatcgtcgaccgtactgtcatctccagactcctgcgcagctccaaatatcgaggtacaattgcgcgcattttatttctattaactgatcgatatgactactagctagcaaatatatatgtgtcatctgtcatctgtgtagaattgagtttcatgtagaatgaagtcgttgattgctcatttggtctggttggttagtacaatcaagtacatatcaagaacaataagcagtcagtcacctttaattttgtttggttgttgttgtgcatgcagttacgacggtggatagtggcaagagagcactggaggttctcagcctggtatgttctttgatccctatgcctgtggatgtcagtcagttttgaagaattgctagaaatgaatgtaaaattagtttgtgttatgatgcaggatcggaatgtgcatatgatcatcacggattactgcatgccggagatgacagggttcgatctcctcaagagggtcaaggttagcatttcagacagtcactcagctcctctctctgtatctggatgttgtagtagcaactgaagattggattggattgtgcatggcaggagtcggcggagctgaaggagattccggtggtgctaatgtcgtcggagaattcgccgacgagaatccggcggtgcctggaggagggggctgaagactttttgatcaaaccggttcgcccgtctgatgtgtcgcgcctttgcaaccgcgtcatcatgaaatga</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055148.1 RefSeq:Os02g0830200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

Os02g0830200

2014-06-04T13:27:25Z

Lianglei086: /* Evolution */

Os02g0830200

2014-06-04T13:27:05Z

Lianglei086: /* Annotated Information */

Os04g0524300

2014-06-04T13:21:17Z

Lianglei086: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.

===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]

Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin.

[[File:FIG4.png]]

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T13:20:10Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]

Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin.

[[File:FIG4.png]]

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T13:19:38Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]

Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin.
[[File:FIG4.png]]
With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T13:18:41Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
1.Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]
Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

2.Callus formation of pACT1:OsRR3 and pACT1:OsRR5 is less sensitive to cytokinin.
[[File:FIG4.png]]
With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T13:16:14Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]Analysis of root elongation and lateral root formation during overexpression of OsRR3 and OsRR5 in transgenic rice and ZH11 (CK) in the presence of exogenous hormones. A., B., C.Seeds were grown on plates supplemented with the specified concentrations of BA, 2,4-D, ABA, or DMSO control, under a 16-h photoperiod
at 23°C. Error bars represent SE (N = 30). D. Seeds were grown on plates supplemented with the specified concentrations of BA control under a 16-h photoperiod at 23°C. The total number of lateral roots was determined at 15 days. Error bars represent SE (N= 30). E.Phenotypes of roots for 16-day-old seedlings of (from left to right) ZH11, pACT1:OsRR3, and pACT1:OsRR5 treated with 0.5 μM BA under a 16-h photoperiod.

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and
shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.
[[File:FIG4.png]]Callus formation of ZH11, pACT1:OsRR3, and pACT1:OsRR5. Rice seeds were grown on N6 media containing specified concentrations of 2,4-D and 6-BA. After 4 weeks in culture, the induced calli were arranged and photographed. A.ZH11. B.pACT1:OsRR3. C.pACT1:OsRR5.

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T13:13:40Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].
[[File:FIG3.png]]

With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and
shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.
[[File:FIG4.png]]

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

File:FIG4.png

2014-06-04T13:12:41Z

Lianglei086:

File:FIG3.png

2014-06-04T13:11:55Z

Lianglei086:

Os04g0524300

2014-06-04T13:11:31Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
Rice seedlings overexpressing OsRR3 and OsRR5 are less sensitive to cytokinin inhibition of root elongation and lateral root formation[1].[[File:FIG3.png]]
With increasing cytokinin:auxin ratios, larger calli were formed and green shoots were longer (Figure 4A). Both pACT1:OsRR3 and pACT1:OsRR5 formed smaller calli and
shorter shoots with concentrations of hormones that were able to induce ZH11 calli (Figure 4B and C). The decrease in sensitivity to hormones of pACT1:OsRR3 and pACT1:OsRR5 in callus and shoot formation showed that both OsRR3 and OsRR5 act as negative regulators of the cytokinin-signaling system.[[File:FIG4.png]]

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T13:05:54Z

Lianglei086: /* Evolution */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.
[[File:FIG2.png]]

==Labs working on this gene==
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.[[File:FIG2.png]]

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T13:03:42Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===

==Labs working on this gene==
Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.[[File:FIG2.png]]

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

File:FIG2.png

2014-06-04T13:02:04Z

Lianglei086: uploaded a new version of "File:FIG2.png": Reverted to version as of 12:56, 4 June 2014

Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.1 amino acid substitution per site.

File:FIG2.png

2014-06-04T13:01:17Z

Lianglei086: uploaded a new version of "File:FIG2.png": Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining m

File:FIG2.png

2014-06-04T12:56:43Z

Lianglei086: Phylogenetic relationship among type-A response regulator proteins from rice (OsRR), maize (ZmRR), and Arabidopsis (ARR). The unrooted tree was generated using ClustalX program by neighbor-joining method and visualized by Treeview. Scale bar represents 0.

Os04g0524300

2014-06-04T12:52:45Z

Lianglei086: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===

==Labs working on this gene==
[[File:FIG2.png]]

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T12:37:20Z

Lianglei086: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
OsRR5 belongs to thirtten A-type response regulator (RR) genes in the rice genome.
The induction of OsRR genes by cytokinin even in the absence of de novo protein synthesis qualifies them to be primary cytokinin response genes.
OsRR3 and OsRR5 mainly act as negative regulators of cytokinin signaling, as indicated by the reduced sensitivity of OsRR3 and OsRR5 overexpressors to exogenous ytokinins.
===Expression===
Three A-type RR genes(OsRR4, OsRR9and OsRR10 for O. sativa RR) showed cytokinin-induced expression, and three (OsRR8, OsRR12andOsRR13) showed expression in flower.
The transcripts of OsRR genes could be detected by real-time PCR in all organs of the light- and dark-grown rice seedlings/plants, although there were quantitative differences. The steady-state transcript levels of most of the OsRR genes increased rapidly (within 15 min) on exogenous cytokinin application even in the presence of cycloheximide. Moreover, the expression of the OsRR6 gene was enhanced in rice seedlings exposed to salinity, dehydration and low temperature stress.

===Evolution===

==Labs working on this gene==
Please input related labs here.

==References==
1. X. Cheng;H. Jiang;J. Zhang;Y. Qian;S. Zhu;B. Cheng
Overexpression of type-A rice response regulators, OsRR3 and OsRR5, results in lower sensitivity to cytokinins
Genetics and Molecular Research, 2010, 9(1): 348-359
2. Mukesh Jain;Akhilesh K Tyagi;Jitendra P Khurana
Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)
BMC Plant Biology, 2006, 6: 1
3. Yukihiro Ito;Nori Kurata
Identification and characterization of cytokinin-signalling gene families in rice
Gene, 2006, 382(1): 57-65

==Structured Information==
{{JaponicaGene|
GeneName = Os04g0524300|
Description = Similar to ZmRR2 protein (Response regulator 2)|
Version = NM_001059883.1 GI:115459495 GeneID:4336439|
Length = 1220 bp|
Definition = Oryza sativa Japonica Group Os04g0524300, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|
AP = Chromosome 4:26625768..26626987|
CDS = 26625843..26625963,26626041..26626087,26626190..26626267,26626379..26626449,26626539..26626626 |
GCID = <gbrowseImage1>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008397:26625768..26626987
source=RiceChromosome04
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcgtgacggctgtggacagcgggaagagggcattggagctgctaggctcggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtga</cdnaseq>|
AA = <aaseq>MATCRSRGVERGGAPHVLAVDDSSVDRAVISGILRSSQFRVTAV DSGKRALELLGSEPNVSMIITDYWMPEMTGYELLKKVKESSRLKEIPVVIMSSENVST RINRCLEEGAEDFLLKPVQPSDVSRLCSRVLR</aaseq>|
DNA = <dnaseqindica>76..196#274..320#423..500#612..682#772..859#acggtcacacacagaattcctaaagccgacttggcttttgctcgcgagtaggactgtaggagagatatcgatctgatggccacctgcaggagccgtggcgtcgagaggggcggcgcgccgcacgtcctcgcggtggacgacagctccgtggaccgcgccgtcatctccggcatcctccggagctctcagttccgcggtgagctgctggctctcttgctcctgtaccacatattgtccatcctcgttcttcttcttacgtgtgcatgtgtgtagtgacggctgtggacagcgggaagagggcattggagctgctaggctcggtgagtctccggcatcctctgcctttttgctgttggttacgcaaatgtggaggtgtgttttgcctgcgaggccgtaaacgtttttttttctttggctcgcaggaaccgaatgtgagcatgattatcactgactactggatgccggagatgaccgggtatgaactcctgaagaaggtcaaggtaatccggtgatatcaccaccgttatttgggccaacttccatagtactcctcgtgcatattactactcaccttttctgatttgacaatagaaaatggcatatctttgcaggagtcgtccaggctgaaggagatccctgtggtgatcatgtcctcggagaacgtctctacaaggatcaacaggtttgtgtgcacagtatcggtgcccatatctgcccaaatactatcaagatatactcatcttcttgacacgtttttggttaatttgccaggtgcttggaggaaggagcggaggatttcttgctgaagcccgtgcagccgtcggacgtgtcgcggctgtgcagccgcgtcctccggtgagccgtgcaggcggcggccggtcgggtgggcgtcgtgggcgactgaagcgtccctgcatgcatatgcggcttcagtgttttgggggttggaattaatagcagcagaagcagaagcagtagtagtagtgattagtggtagccaaacgcactgtgcgcttgcagatgttgtggttaatgggctgaatttgcctctccctttctctatttttctcattccgaatgtcatgttctagctgttccctgtgtcgatctagaatgcagtttgtcccatcggtttgtccatcccagttgaaaaacctgttgcaacaaatgtctcaattttatgttcttaacagttcatccgttttactagttatattcat</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059883.1 RefSeq:Os04g0524300]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 4]]
[[Category:Chromosome 4]]

Os04g0524300

2014-06-04T12:35:50Z

Lianglei086: /* Evolution */

Os04g0524300

2014-06-04T12:35:21Z

Lianglei086: /* Evolution */

Os04g0524300

2014-06-04T12:28:43Z

Lianglei086: /* Evolution */

Os04g0524300

2014-06-04T12:25:22Z

Lianglei086: /* Evolution */

Os04g0524300

2014-06-04T12:19:04Z

Lianglei086: /* Evolution */

Os04g0524300

2014-06-04T12:01:00Z

Lianglei086: OsRR3 and OsRR5 are primary cytokinin response genes, functioning as negative regulators of cytokinin signaling.