http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=Lifengjiao13RiceWiki - User contributions [en]2026-08-27T16:12:15ZUser contributionsMediaWiki 1.30.0https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178374Os11g01849002014-06-05T12:33:24Z<p>Lifengjiao13: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|left|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. [[File:Fig 4.OsNAC5.png|center|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
[[File:Fig 7.OsNAC5.png|center|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
</references><br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178362Os11g01849002014-06-05T12:19:47Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|left|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. [[File:Fig 4.OsNAC5.png|center|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
[[File:Fig 7.OsNAC5.png|center|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178360Os11g01849002014-06-05T12:19:17Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|left|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. [[File:Fig 4.OsNAC5.png|center|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
[[File:Fig 7.OsNAC5.png|right|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178357Os11g01849002014-06-05T12:18:42Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|left|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. [[File:Fig 4.OsNAC5.png|center|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
[[File:Fig 7.OsNAC5.png|left|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178353Os11g01849002014-06-05T12:17:04Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|left|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. [[File:Fig 4.OsNAC5.png|center|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. <br />
[[File:Fig 7.OsNAC5.png|center|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178351Os11g01849002014-06-05T12:16:11Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|left|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. <br />
[[File:Fig 7.OsNAC5.png|center|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178345Os11g01849002014-06-05T12:13:40Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|left|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|right|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. <br />
[[File:Fig 7.OsNAC5.png|right|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178338Os11g01849002014-06-05T12:11:13Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|right|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. <br />
[[File:Fig 7.OsNAC5.png|right|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig_7.OsNAC5.png&diff=178335File:Fig 7.OsNAC5.png2014-06-05T12:10:34Z<p>Lifengjiao13: Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.</p>
<hr />
<div>Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178332Os11g01849002014-06-05T12:10:02Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|200px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. <br />
[[File:Fig 7.OsNAC5.png|right|thumb|200px|Fig.7 Relative expression levels (qRT-PCR, relative to Ubiquitin expression) of OsNAC5 in different rice organs collected during the grain filling stage.(From reference <ref name="ref3" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles(Fig.7). A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178322Os11g01849002014-06-05T12:05:10Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178321Os11g01849002014-06-05T12:03:52Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.6 OsNAC5.png|center|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.3 OsNAC5.png|left|thum|200px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178317Os11g01849002014-06-05T12:00:48Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.3)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.6) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|left|thumb|250px|Fig.3 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']][[File:Fig.6 OsNAC5.png|thum|100px|Fig.6 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178312Os11g01849002014-06-05T11:59:26Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
[[File:Fig.6 OsNAC5.png|left|thumb|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178301Os11g01849002014-06-05T11:56:13Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']][[File:Fig.6 OsNAC5.png|left|thum|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178298Os11g01849002014-06-05T11:55:27Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']][[File:Fig.6 OsNAC5.png|center|thum|250px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178296Os11g01849002014-06-05T11:54:04Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']][[File:Fig.6 OsNAC5.png|thum|50px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.6_OsNAC5.png&diff=178294File:Fig.6 OsNAC5.png2014-06-05T11:53:02Z<p>Lifengjiao13: </p>
<hr />
<div></div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178290Os11g01849002014-06-05T11:52:00Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Under the control of the root-specific (RCc3) and constitutive (GOS2) promoters,the overexpressed OsNAC5 could improve rice plant tolerance to drought and high salinity during the vegetative stage of growth.<br />
Moreover,Root-specific overexpression of OsNAC5 can significantly enlarge the root diameter in transgenic rice plants via enlarging steles and aerenchymas at the reproductive stage of growth(Fig.6)<ref name="ref4" />. It suggests the importance of this phenotype to improve grain yield.(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants.(From reference <ref name="ref4" />).'']]<br />
<br />
[[File:Fig.6 OsNAC5.png|thum|500px|Fig.6 Light microscopic images of cross-sectioned RCc3:OsNAC5, GOS2:OsNAC5 and NT roots (10 cm down from the ground surface level)during the panicle heading stage. The position of the metaxylem vessel (Me) and aerenchyma (Ae) are indicated. Scale bars, 500 lm in the upper panels and 100 lm in the lower panels.(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178255Os11g01849002014-06-05T11:18:33Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots, with no detectable expression in leaf blades of mature plants and young panicles. A possible explanation for such differences in organ specificity could be the use of a different cultivar and of a completely different experiment strategy for transcript detection <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178247Os11g01849002014-06-05T11:11:42Z<p>Lifengjiao13: /* Knowledge Extension */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178245Os11g01849002014-06-05T11:11:00Z<p>Lifengjiao13: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others Members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178242Os11g01849002014-06-05T11:08:35Z<p>Lifengjiao13: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref8" /> <ref name="ref9" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others Members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178240Os11g01849002014-06-05T11:07:53Z<p>Lifengjiao13: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others Members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150.</ref><br />
<ref name="ref9">Fang YJ, You J, Xie KB, Xie WB, Xiong LZ (2008) Systematic sequence analysis and identification of tissue-specific or stressresponsive genes of NAC transcription factor family in rice. MolGenet Genomics 280: 547–563.</ref><br />
<ref name="ref10">Nuruzzaman M, Manimekalai R, Sharoni AM, Satoh K, Kondoh H,et al. (2010) Genome-wide analysis of NAC transcription factor family in rice. Gene 465: 30–44.</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178236Os11g01849002014-06-05T11:04:32Z<p>Lifengjiao13: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
According to phylogenetic relationship, NAC family with 151 members in rice is divided into five groups. OsNAC5 belongs to the third subgroup with SNAC1 and OsNAC6/SNAC2 <ref name="ref9" /> <ref name="ref10" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others Members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=178231Os11g01849002014-06-05T11:02:06Z<p>Lifengjiao13: /* Knowledge Extension */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins showed that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
By yeast two-hybrid screening and pull-down assays in vitro demonstrated that OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggested that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
Like others Members of the NAM-ATAF-CUC (NAC) protein family，OsNAC5 contains a highly conserved N-terminal NAC-domain and a variable C-terminal domain.C-terminal region comprising the acidic, proline-, and serine-rich elements are responsible for transcriptional activation <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169311Os11g01849002014-05-17T10:05:47Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169310Os11g01849002014-05-17T09:58:21Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
[[File:Fig.3 OsNAC5.png|thum|100px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169309Os11g01849002014-05-17T09:51:30Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
<br />
[[File:Fig.3 OsNAC5.png|right|thumb|250px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169308Os11g01849002014-05-17T09:50:47Z<p>Lifengjiao13: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
<br />
[[File:Fig.3 OsNAC5.png|right|thumb|250px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|right|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169307Os11g01849002014-05-17T09:49:53Z<p>Lifengjiao13: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
<br />
[[File:Fig.3 OsNAC5.png|right|thumb|250px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|left|thumb|250px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169306Os11g01849002014-05-17T09:45:34Z<p>Lifengjiao13: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
<br />
[[File:Fig.3 OsNAC5.png|right|thumb|250px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />.<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="1"|Gene amplication<br />
| | 5′-CGCGGATCCATGGAGTGCGGTGGTGCGCTG-3′;<br />
| | 5′-CGGGGTACCTTAGAACGGCTTCTGCAGGTAC-3′;(<ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5′-ATGGAGTGCGGTGGTGCGCT-3′<br />
| | 5′-TTAGAACGGCTTCTGCAGGT-3′ <ref name="ref4" /><br />
|-<br />
| | 5′-TTCAAGAACA-CATCCCTG-3′<br />
| | 5′-GAAGTGAACTGAAGTACC-3′ <ref name="ref5" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|center|frame|50px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169305Os11g01849002014-05-17T09:33:59Z<p>Lifengjiao13: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|250px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2 OsNAC5.png|right|thumb|250px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
<br />
[[File:Fig.3 OsNAC5.png|right|thumb|250px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
[[File:Fig 4.OsNAC5.png|center|thumb|350px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
[[File:Fig.5 OsNAC5.png|center|frame|50px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169304Os11g01849002014-05-17T09:25:55Z<p>Lifengjiao13: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1 OsNAC5.png|right|thumb|50px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2.jpg|right|thumb|50px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
<br />
[[File:Fig.3.jpg|right|thumb|50px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
[[File:Fig.4.jpg|center|thumb|150px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
[[File:Fig.5.jpg|center|frame|150px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.1.OsNAC5.png&diff=169303File:Fig.1.OsNAC5.png2014-05-17T09:09:04Z<p>Lifengjiao13: </p>
<hr />
<div></div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169302Os11g01849002014-05-17T09:02:51Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1.jpg|right|thumb|50px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2.jpg|right|thumb|50px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref2" />).'']]<br />
<br />
[[File:Fig.3.jpg|right|thumb|50px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref4" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
[[File:Fig.4.jpg|center|thumb|150px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
[[File:Fig.5.jpg|center|frame|150px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169298Os11g01849002014-05-17T08:58:28Z<p>Lifengjiao13: </p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
[[File:Fig.1.jpg|right|thumb|50px|Fig.1 Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants(From reference <ref name="ref1" />).'']]<br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress (Fig.2)<ref name="ref2" />.<br />
[[File:Fig.2.jpg|right|thumb|50px|Fig.2 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress(200 mM NaCl for 14 days),drought(withholding of water for 15 days).(From reference <ref name="ref4" />).'']]<br />
<br />
[[File:Fig.3.jpg|right|thumb|50px|Fig.3 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).(From reference <ref name="ref2" />).'']]<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field(Fig.3) <ref name="ref4" />.<br />
<br />
===Expression===<br />
[[File:Fig.4.jpg|center|thumb|150px|Fig.4 Expression patterns of OsNAC5 in different.(From reference <ref name="ref2" />).'']]<br />
<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers(Fig.2) and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
[[File:Fig.5.jpg|center|frame|150px|Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).(From reference <ref name="ref5" />).'']]<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.5_OsNAC5.png&diff=169290File:Fig.5 OsNAC5.png2014-05-17T07:53:53Z<p>Lifengjiao13: Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).</p>
<hr />
<div>Fig.5 A dendrogram of NAC genes based on the amino-acid sequences of their NAC domains(The tree was made by the neighbor-joining method).</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig_4.OsNAC5.png&diff=169289File:Fig 4.OsNAC5.png2014-05-17T07:52:07Z<p>Lifengjiao13: Fig.4 Expression patterns of OsNAC5 in different organs</p>
<hr />
<div>Fig.4 Expression patterns of OsNAC5 in different organs</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.3_OsNAC5.png&diff=169288File:Fig.3 OsNAC5.png2014-05-17T07:49:39Z<p>Lifengjiao13: Fig.3 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress (200 mM NaCl for 14 days),drought stress(withholding of water for 15 days)</p>
<hr />
<div>Fig.3 WT, OE1, Ri5 and Ri6 rice seedlings treated with cold (4°C for 6 days),salt stress (200 mM NaCl for 14 days),drought stress(withholding of water for 15 days)</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.2_OsNAC5.png&diff=169287File:Fig.2 OsNAC5.png2014-05-17T07:46:28Z<p>Lifengjiao13: Fig.2 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).</p>
<hr />
<div>Fig.2 Drought stress tolerance of RCc3:OsNAC5 and GOS2:OsNAC5 plants(GOS2 promoter for constitutive expression and the RCc3 promoter for root-specific expression).</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.1_OsNAC5.png&diff=169286File:Fig.1 OsNAC5.png2014-05-17T07:43:32Z<p>Lifengjiao13: Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants.</p>
<hr />
<div>Expression of OsNAC3, OsNAC4,OsNAC5, OsNAC6 and SNAC1 in response to dehydration, cold temperature(4°C), high salinity, and ABA or MeJA in rice plants.</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169285Os11g01849002014-05-17T07:18:21Z<p>Lifengjiao13: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />.<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
*School of Biotechnology and Environmental Engineering, Myongji University, Yongin, 449-728, South Korea<br />
*Laboratory of Plant Molecular Physiology, Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo, 1138657, Japan<br />
*Centro de Biotecnologia, Universidade Federal do Rio Grande do Sul, P.O. Box 15005, 91501-970, Porto Alegre, RS, Brazil<br />
*State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, The Chinese Academy of Sciences, Beijing, 100093, People’s Republic of China<br />
*Laboratory of Plant Breeding and Genetics, Graduate School of Agricultural and Life Sciences, University of Tokyo, Yayoi 1-1-1, Bunkyo-ku, Tokyo 113-8657, Japan<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169284Os11g01849002014-05-17T07:13:30Z<p>Lifengjiao13: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />.<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169283Os11g01849002014-05-17T07:12:25Z<p>Lifengjiao13: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref5" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />.<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref8">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169282Os11g01849002014-05-17T07:11:10Z<p>Lifengjiao13: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref5" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />.<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref7">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169281Os11g01849002014-05-17T07:10:22Z<p>Lifengjiao13: /* Knowledge Extension */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />.<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins<ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref7">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169280Os11g01849002014-05-17T07:09:18Z<p>Lifengjiao13: /* Mutation */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />.<br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref7">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169279Os11g01849002014-05-17T07:07:49Z<p>Lifengjiao13: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />. <br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
<ref name="ref1">Takasaki H., Maruyama K., Kidokoro S., Ito Y., Fujita Y., et al. (2010) The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol Genet Genomics 284: 173–183.</ref><br />
<ref name="ref2">Song, S.Y., Chen, Y., Chen, J., Dai, X.Y. and Zhang, W.H. (2011) Physiological mechanisms underlying OsNAC5-dependent tolerance of rice plants to abiotic stress. Planta 234: 331–345.</ref><br />
<ref name="ref3">Sperotto RA, Ricachenevsky FK, Duarte GL, BoV T, Lopes KL, et al. (2009) Identification of up-regulated genes in flag leaves during rice grain filling and characterization of OsNAC5, a new ABA-dependent transcription factor. Planta 230: 985–1002.</ref><br />
<ref name="ref4">Jeong, J. S., Kim,Y. S., Redillas, M. C. F. R., Jang, G., Jung, H., Bang, S. W.,et al. (2013) OsNAC5 overexpression enlarges root diameter in rice plants leading to enhanced drought tolerance and increased grain yield in the field. Plant Biotechnology Journal, 11: 101–114.</ref><br />
<ref name="ref5">Kikuchi K, Ueguchi-Tanaka M, Yoshida KT, Nagato Y, Matsusoka M, et al. (2000) Molecular analysis of the NAC gene family in rice. Mol Gen Genet 262: 1047–1051.</ref><br />
<ref name="ref6">Jeong, J.S., Park, Y.T., Jung, H., Park, S.H. and Kim, J.-K. (2009) Rice NAC proteins act as homodimers and heterodimers. Plant Biotechnol. Rep 3: 127–134.</ref><br />
<ref name="ref7">Raul A. Sperotto, Tatiana Boff, Guilherme L. Duarte, Lívia S. Santos,Michael A. Grusakc, et al. (2010) Identification of putative target genes to manipulate Fe and Zn concentrations in rice grains. Journal of Plant Physiology 167: 1500–1506.</ref><br />
<ref name="ref7">Marta S. Lopes and Jose L. Araus (2008) Comparative genomic and physiological analysis of nutrient response to NH4+, NH4+: NO3- and NO3- in barley seedlings. Physiologia Plantarum 134: 134–150..</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0184900&diff=169272Os11g01849002014-05-17T07:00:29Z<p>Lifengjiao13: /* Knowledge Extension */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
The ''OsNAC5'' gene is a member of plant specific NAC family in rice that encodes a transcript factor to regulate stress responses.<br />
==Annotated Information==<br />
===Function===<br />
Stress-responsive proteins OsNAC5 is a transcriptional activator induced by abiotic stress,including drought,cold and high salinity.By microarray analysis,OsNAC5 upregulates many stress-inducible genes,including ''OsLEA3''( the late embryogenesis abundant gene) and ''Os06g0681200'' in rice plant that overexpressed ''OsNAC5''.By gel mobility shift assay demonstrated that this protein bind specifically to the NAC recognition sequence of the ''OsLEA3'' promoter (-56 to -85) and enhance the expression of this stress-related gene. Moreover,''OsNAC5''-overexpressing plants did not retard growth under non-stressed conditions. Hence, ''OsNAC5'' may be an effective gene to enhance the stress tolerance of rice without inviting growth defects <ref name="ref1" />. In addition to abiotic stress, expression of ''OsNAC5'' was also responsive to ABA,MeJA and other plant hormones such as ethylene,IAA,SA and BR could also induce rapid upregulation of ''OsNAC5'' <ref name="ref2" /><ref name="ref3" />. <br />
<br />
OsNAC5 has been characterized as a novel senescence associated ABA-dependent NAC transcription factor <ref name="ref3" />. The promoter regions of OsNAC5 which contain a conserved ABRE sequences (ACGTG G/TC) are activated in response to ABA <ref name="ref1" />. It is possible that OsNAC5 protein regulates similar transporter genes in rice and that these genes are needed for effective Fe and Zn remobilization <ref name="ref7" />.<br />
<br />
''OsNAC5'' involves in modulating several downstream functional genes (associated with accumulation of compatible solutes,Na+,H2O2 and malondialdehyde. By detecting some metabolic changes,such as greater amounts of Pro and soluble sugars, and less amounts of MDA and H2O2 accumulated in ''OsNAC5''-overexpressing rice plants suggests that it can protect plants from dehydration and oxidative damage in response to abiotic stresses <ref name="ref2" />.<br />
<br />
''OsNAC5'' is a metal homeostasis related gene. Final seed Fe, Zn and protein concentrations were positively correlated with high and early ''OsNAC5'' expression level in flag leaves (the major source of remobilized metals for developing seeds)during panicle emergence stage.(Sperotto et al., 2009)[3].The increase expression of ''OsNAC5'' in NH+4 (compared with NH4+:NO3-) demonstrates that the NAC domain is crucial to plant development <ref name="ref8" />.<br />
<br />
===Mutation===<br />
The knockdown lines (Ri5, Ri6) less tolerant to cold,drought and salt stress, while overexpression of ''OsNAC5'' (OE1) rice seedings conferred greater tolerance to these abiotic stress <ref name="ref2" />.<br />
<br />
Root-specific overexpression of ''OsNAC5'' can significantly enlarge the root diameter in transgenic rice plants due to enlarged steles and aerenchymas at flowering stage,suggesting the importance of this phenotype for improving the drought tolerance and grain yield in the field <ref name="ref4" />. <br />
<br />
===Expression===<br />
Each ''OsNAC'' gene has a unique expression pattern. ''OsNAC5'' is predominantly expressed in root and embryo <ref name="ref5" />. Surprisingly,later studies found that it expresses in leaves, roots, stems and flowers and higher expression in flag leaves, non-flag leaves panicles and Lower expression in stems and roots <ref name="ref2" /><ref name="ref3" />. <br />
<br />
===Evolution===<br />
Amino acid sequence analysis revealed that the NAC genes in plants can fall into several subfamilies, such as the NAM, ATAF, and OsNAC3 subfamilies.OsNAC5 and OsNAC6 represent ATAF subfamily in rice <ref name="ref5" />.<br />
<br />
===Knowledge Extension===<br />
Subcellular localization studies using ''OsNAC5''-GFP fusion proteins shows that OsNAC5 is localized to the nucleus.Transactivation assays demonstrated that OsNAC5 is a transcriptional activator that its activation domain lies C-terminal region between aa 273 and 328 <ref name="ref1" />. <br />
<br />
OsNAC5 interacts with other OsNACs including itself to form homodimers and heterodimers. It also suggests that NAC-domain plays complex roles in binding to DNA and proteins <ref name="ref6" />.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os11g0184900|<br />
Description = Similar to NAC-domain protein 5-7|<br />
Version = NM_001072451.1 GI:115484514 GeneID:4349963|<br />
Length = 2507 bp|<br />
Definition = Oryza sativa Japonica Group Os11g0184900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br />
AP = Chromosome 11:4282487..4284993|<br />
CDS = 4283269..4283796,4284345..4284640,4284730..4284895|<br />
GCID = <gbrowseImage1><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008404:4282487..4284993<br />
source=RiceChromosome11<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccgagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcaggttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaa</cdnaseq>|<br />
AA = <aaseq>MECGGALQLPPGFRFHPTDDELVMYYLCRKCGGLPLAAPVIAEV DLYKFNPWDLPERAMGGEKEWYFFSPRDRKYPNGQRPNRAAGTGYWKATGADKPVGSP RAVAIKKALVFYAGKPPKGVKTNWIMHEYRLADVDRSAAARKLSKSSHNALRLDDWVL CRIYNKKGVIERYDTVDAGEDVKPAAAAAAAKGGRIGGGGGAAAMKVELSDYGFYDQE PESEMLCFDRSGSADRDSMPRLHTDSSGSEHVLSPSPSPDDFPGGGDHDYAESQPSGG CGGWPGVDWAAVGDDGFVIDSSLFELPSPAAFSRAAGDGAAFGDMFTYLQKPF</aaseq>|<br />
DNA = <dnaseqindica>1198..1725#354..649#99..264#attccaaaactttcgaaagcttccattagcgactaatccagccttcgttaagggtgattagaatttgattaatttcaaggcctcagatcggagattgaatggagtgcggtggtgcgctgcagctgccgccggggttcaggttccacccgacggacgacgagctggtgatgtactacctgtgccgcaagtgcggcggcctccccctcgccgccccggtgatcgccgaggtggacctctacaagttcaacccatgggatctccccggtaagcaagagcaaaagcagatcgaatcgaatcgaggaaattgaagtcgaattcaaattcaattaattggggatttggaattgttgcagagagggcgatgggaggggagaaggagtggtacttcttctcgccgcgggaccggaagtacccgaacgggcagcggccgaacagggcggcggggacggggtactggaaggcgacgggggcggacaagccggtggggtcgccgcgggcggtggcgatcaagaaggcgctcgtcttctacgccgggaagccgcccaagggcgtcaagaccaactggatcatgcacgagtaccgcctcgccgacgtcgaccgctccgccgccgcccgcaagctctccaagtcctcccacaacgccctcagggttagtatttacttcttttaattacttacttctcctaatctaatcatctcttgctttcaatcatttctcctcaccaacgaatttacccccattttattttttaaaattctacaaggaaaaaaaacagaaaagaaattgccgtatactgtatttgttcatatagtggtctcaatctagagagctctaggaagatatgggcaaatcaatcatcagtagaggtttgataaaatgatttttatttaaaatttgagaaaagaatttgaaaggtgtgccaaattggcaagttgcagcacgcctgagttgtcgctttcgtagcatggctgtagccgctaggtataggctcggatggcgtcatggctcacgcacgcgcagatagagacaagcccgcgcccaacctttatcgaatttaacgtcacctcggaaaacgtaatcacaccgaatttatttaccaaaaactttttaccaccaccactcgcatgcattccacatcaatcttgatcactttgctaataatttcagttttttttttggttaatttttttttgcagttggatgattgggtgttgtgccgaatctacaacaagaagggagtgatcgagaggtacgacacggtggacgccggcgaggacgtgaagccggcggcggcggcggcggcggcgaagggtggtcgcatcggcggcggcggcggcgcggcggcgatgaaggtggagctctccgactatgggttctacgaccaggagccggagtcggagatgctgtgcttcgaccggtcggggtcggcggaccgcgactcgatgccgcggctgcacaccgactccagcgggtcggagcacgtgctgtcgccgtcgccgtcgccggacgacttccccggcggcggcgaccacgactacgccgagagccagcccagcggcggatgcggcgggtggcccggcgtcgactgggccgccgtcggcgacgatggcttcgtcatcgacagctccctcttcgagctgccctcgccggcggcgttctcccgcgccgccggcgacggcgccgccttcggcgacatgttcacgtacctgcagaagccgttctaattaacggaacgtgacgcctctgcaaacgctaattagctcactaaccactgtcaggtcgatcgtgtaattcttttaccagtctagggtacagccaaaaaaccaaaaattaaccgtgctcgatcgatcgatcgatccatggatcgatgatcgcctccaccggcagatcaaaatcgaagcaaaaaatcagggagaattcttggtacttccagtacctctcgtcgacaccacgtgtcgggttttctgcaccgcggatcctcgctggccgcatcgtaacggcgagcgaggttaaaaatagtggagaattcaagaacacatccctgatttttgtttctgccggatggggagtaccgtgagcatggtagaaatgactggtaaaattttcgttgatgataggtagccagagtcgatgtaaccagtcgattttttttttttttggttttagttgacatgccttcctgatagattcagaacaaacaatagagaagagaggagaaaaaaacacagaggagaaattcagagaccaaagttcaaagttttggaattttcaggggcgccagcagctgatggtattgtcagtcgtgtctaggttcgtagaggaaattaaaatgtagaagaacgggtacttcagttcacttcaggttcgttcgtgccaaacaggtctctgacactttagttaggttttgatttttttttctctttttttctggttttttgtcgtttggtaatgtaatgtaagggtgattgcgacatggtatttatgtgattagagtcgctttcagttg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072451.1 RefSeq:Os11g0184900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 11]]<br />
[[Category:Chromosome 11]]</div>Lifengjiao13