<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Lily91dan</id>
		<title>RiceWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Lily91dan"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php/Special:Contributions/Lily91dan"/>
		<updated>2026-08-27T17:47:33Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178922</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178922"/>
				<updated>2014-06-06T06:27:08Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|500px|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank : [http://www.ncbi.nlm.nih.gov/nuccore/4521189]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178918</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178918"/>
				<updated>2014-06-06T06:24:43Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
&lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank : [http://www.ncbi.nlm.nih.gov/nuccore/4521189]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178917</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178917"/>
				<updated>2014-06-06T06:24:01Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank : [http://www.ncbi.nlm.nih.gov/nuccore/4521189]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178916</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178916"/>
				<updated>2014-06-06T06:23:40Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank : [http://www.ncbi.nlm.nih.gov/nuccore/4521189]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178915</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178915"/>
				<updated>2014-06-06T06:22:49Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* related Link */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank : [http://www.ncbi.nlm.nih.gov/nuccore/4521189]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178913</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178913"/>
				<updated>2014-06-06T06:19:53Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* related Link */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank = [http://www.ncbi.nlm.nih.gov/nuccore/4521189]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178912</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178912"/>
				<updated>2014-06-06T06:19:24Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* related Link */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank = [http://www.ncbi.nlm.nih.gov/nuccore/4521189:AB013448]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079:AB013449]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178911</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178911"/>
				<updated>2014-06-06T06:15:07Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
=='''related Link'''==&lt;br /&gt;
NCBI GeneBank = [http://www.ncbi.nlm.nih.gov/nuccore/4521189]&lt;br /&gt;
[http://www.ncbi.nlm.nih.gov/nuccore/4689079]&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178908</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178908"/>
				<updated>2014-06-06T06:11:48Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178907</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178907"/>
				<updated>2014-06-06T06:11:24Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
=='''Annotated Information'''==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''References'''==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=='''Labs working on this gene'''==&lt;br /&gt;
1.International Rice Research Institute (IRRI), DAPO Box 7777, Metro Manila, Philippines; &amp;lt;br&amp;gt;&lt;br /&gt;
2.Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1, Ohwashi, Tsukuba, Ibaraki 305-8686, Japan; &amp;lt;br&amp;gt;&lt;br /&gt;
 3.Indonesian Center for Rice Research (ICRR), JL. Raya Muara No. 25A Ciapus Bogor, Subang, West Java, Indonesia; &amp;lt;br&amp;gt;&lt;br /&gt;
4.Agricultural Genetics Institute, Conhue, Tuliem, Hanoi, Vietnam; &amp;lt;br&amp;gt;&lt;br /&gt;
5.Faculty of Agricultural Sciences, University of Burundi, BP 2940 Bujumbura, Burundi; &amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178890</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178890"/>
				<updated>2014-06-06T05:50:41Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Figure2 expression.jpg|right|thumb|]]&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure2_expression.jpg&amp;diff=178888</id>
		<title>File:Figure2 expression.jpg</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure2_expression.jpg&amp;diff=178888"/>
				<updated>2014-06-06T05:49:07Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: Expression of the Pib gene upon inoculation with a incompatible rice
blast strain ARCP90-18C. Two microgram aliquots of poly(A)+ RNA were
extracted from leaf tissue of Tohoku IL9 at 0, 12, 24 and 96 h after
inoculation (HAI), and from Sasanishiki at 0 and&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Expression of the Pib gene upon inoculation with a incompatible rice&lt;br /&gt;
blast strain ARCP90-18C. Two microgram aliquots of poly(A)+ RNA were&lt;br /&gt;
extracted from leaf tissue of Tohoku IL9 at 0, 12, 24 and 96 h after&lt;br /&gt;
inoculation (HAI), and from Sasanishiki at 0 and 24 HAI.&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178886</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178886"/>
				<updated>2014-06-06T05:47:37Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Gene structure */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1 gene struture.png|down| ]]&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure1_gene_struture.png&amp;diff=178881</id>
		<title>File:Figure1 gene struture.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure1_gene_struture.png&amp;diff=178881"/>
				<updated>2014-06-06T05:44:54Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178879</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178879"/>
				<updated>2014-06-06T05:43:52Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178865</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178865"/>
				<updated>2014-06-06T05:33:24Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* Structured Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName =Os02g57310|&lt;br /&gt;
Description =Magnaporthe grisea resistance-b |&lt;br /&gt;
Version = AB013448.1  GI:4521189|&lt;br /&gt;
Length = 10322 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group gene for Pib, complete cds|&lt;br /&gt;
Source = Oryza sativa Japonica Group (Japanese rice)&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
&lt;br /&gt;
}}&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178858</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178858"/>
				<updated>2014-06-06T05:30:29Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName =Os02g57310|&lt;br /&gt;
Description =Magnaporthe grisea resistance-b |&lt;br /&gt;
Version = AB013448.1  GI:4521189|&lt;br /&gt;
Length = 10322 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group gene for Pib, complete cds|&lt;br /&gt;
Source = Oryza sativa Japonica Group (Japanese rice)&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|&lt;br /&gt;
CDS =35118769 - 35113637 |&lt;br /&gt;
GCID = &lt;br /&gt;
GSID = &lt;br /&gt;
NCBI GeneBank = [http://www.ncbi.nlm.nih.gov/nuccore/4521189 http://www.ncbi.nlm.nih.gov/nuccore/4689079]|&lt;br /&gt;
}}&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178831</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178831"/>
				<updated>2014-06-06T05:05:41Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178830</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178830"/>
				<updated>2014-06-06T05:05:03Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
LOCUS       AB013448               10322 bp    DNA     linear   PLN 15-FEB-2008&lt;br /&gt;
DEFINITION  Oryza sativa Japonica Group gene for Pib, complete cds.&lt;br /&gt;
ACCESSION   AB013448&lt;br /&gt;
VERSION     AB013448.1  GI:4521189&lt;br /&gt;
KEYWORDS    .&lt;br /&gt;
SOURCE      Oryza sativa Japonica Group (Japanese rice)&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
REFERENCE   1&lt;br /&gt;
  AUTHORS   Wang,Z.X., Yano,M., Yamanouchi,U., Iwamoto,M., Monna,L.,&lt;br /&gt;
            Hayasaka,H., Katayose,Y. and Sasaki,T.&lt;br /&gt;
  TITLE     The Pib gene for rice blast resistance belongs to the nucleotide&lt;br /&gt;
            binding and leucine-rich repeat class of plant disease resistance&lt;br /&gt;
            genes&lt;br /&gt;
  JOURNAL   Plant J. 19 (1), 55-64 (1999)&lt;br /&gt;
   PUBMED   10417726&lt;br /&gt;
REFERENCE   2  (bases 1 to 10322)&lt;br /&gt;
  AUTHORS   Sasaki,T. and Yano,M.&lt;br /&gt;
  TITLE     Direct Submission&lt;br /&gt;
  JOURNAL   Submitted (28-APR-1998) Contact:Takuji Sasaki National Institute of&lt;br /&gt;
            Agrobiological Resources, Rice Genome Research Program; Kannondai&lt;br /&gt;
            2-1-2, Tsukuba, Ibaraki 305-8602, Japan&lt;br /&gt;
FEATURES             Location/Qualifiers&lt;br /&gt;
     source          1..10322&lt;br /&gt;
                     /organism=&amp;quot;Oryza sativa Japonica Group&amp;quot;&lt;br /&gt;
                     /mol_type=&amp;quot;genomic DNA&amp;quot;&lt;br /&gt;
                     /cultivar=&amp;quot;Tohoku IL-9&amp;quot;&lt;br /&gt;
                     /db_xref=&amp;quot;taxon:39947&amp;quot;&lt;br /&gt;
                     /chromosome=&amp;quot;2&amp;quot;&lt;br /&gt;
                     /clone=&amp;quot;cos140/EagI10k&amp;quot;&lt;br /&gt;
                     /tissue_type=&amp;quot;green leaf&amp;quot;&lt;br /&gt;
     gene            2293..9202&lt;br /&gt;
                     /gene=&amp;quot;PIB&amp;quot;&lt;br /&gt;
     mRNA            join(2293..2446,2570..2698,3509..4586,5927..6682,&lt;br /&gt;
                     6991..9202)&lt;br /&gt;
                     /gene=&amp;quot;PIB&amp;quot;&lt;br /&gt;
     CDS             join(3573..4586,5927..6682,6991..8976)&lt;br /&gt;
                     /gene=&amp;quot;PIB&amp;quot;&lt;br /&gt;
                     /codon_start=1&lt;br /&gt;
                     /product=&amp;quot;Pib&amp;quot;&lt;br /&gt;
                     /protein_id=&amp;quot;BAA76281.2&amp;quot;&lt;br /&gt;
                     /db_xref=&amp;quot;GI:37777009&amp;quot;&lt;br /&gt;
                     /translation=&amp;quot;MEATALSVGKSVLNGALGYAKSAFAEEVALQLGIQKDHTFVADE&lt;br /&gt;
                     LEMMRSFMMEAHEEQDNSKVVKTWVKQVRDTAYDVEDSLQDFAVHLKRPSWWRFPRTL&lt;br /&gt;
                     LERHRVAKQMKELRNKVEDVSQRNVRYHLIKGSAKATINSTEQSSVIATAIFGIDDAR&lt;br /&gt;
                     RAAKQDNQRVDLVQLINSEDQDLKVIAVWGTSGDMGQTTIIRMAYENPDVQIRFPCRA&lt;br /&gt;
                     WVRVMHPFSPRDFVQSLVNQLHATQGVEALLEKEKTEQDLAKKFNGCVNDRKCLIVLN&lt;br /&gt;
                     DLSTIEEWDQIKKCFQKCRKGSRIIVSSTQVEVASLCAGQESQASELKQLSADQTLYA&lt;br /&gt;
                     FYDKGSQIIEDSVKPVSISDVAITSTNNHTVAHGEIIDDQSMDADEKKVARKSLTRIR&lt;br /&gt;
                     TSVGASEESQLIGREKEISEITHLILNNDSQQVQVISVWGMGGLGKTTLVSGVYQSPR&lt;br /&gt;
                     LSDKFDKYVFVTIMRPFILVELLRSLAEQLHKGSSKKEELLENRVSSKKSLASMEDTE&lt;br /&gt;
                     LTGQLKRLLEKKSCLIVLDDFSDTSEWDQIKPTLFPLLEKTSRIIVTTRKENIANHCS&lt;br /&gt;
                     GKNGNVHNLKVLKHNDALCLLSEKVFEEATYLDDQNNPELVKEAKQILKKCDGLPLAI&lt;br /&gt;
                     VVIGGFLANRPKTPEEWRKLNENINAELEMNPELGMIRTVLEKSYDGLPYHLKSCFLY&lt;br /&gt;
                     LSIFPEDQIISRRRLVHRWAAEGYSTAAHGKSAIEIANGYFMELKNRSMILPFQQSGS&lt;br /&gt;
                     SRKSIDSCKVHDLMRDIAISKSTEENLVFRVEEGCSAYIHGAIRHLAISSNWKGDKSE&lt;br /&gt;
                     FEGIVDLSRIRSLSLFGDWKPFFVYGKMRFIRVLDFEGTRGLEYHHLDQIWKLNHLKF&lt;br /&gt;
                     LSLRGCYRIDLLPDLLGNLRQLQMLDIRGTYVKALPKTIIKLQKLQYIHAGRKTDYVW&lt;br /&gt;
                     EEKHSLMQRCRKVGCICATCCLPLLCEMYGPLHKALARRDAWTFACCVKFPSIMTGVH&lt;br /&gt;
                     EEEGAMVPSGIRKLKDLHTLRNINVGRGNAILRDIGMLTGLHKLGVAGINKKNGRAFR&lt;br /&gt;
                     LAISNLNKLESLSVSSAGMPGLCGCLDDISSPPENLQSLKLYGSLKTLPEWIKELQHL&lt;br /&gt;
                     VKLKLVSTRLLEHDVAMEFLGELPKVEILVISPFKSEEIHFKPPQTGTAFVSLRVLKL&lt;br /&gt;
                     AGLWGIKSVKFEEGTMPKLERLQVQGRIENEIGFSGLEFLQNINEVQLSVWFPTDHDR&lt;br /&gt;
                     IRAARAAGADYETAWEEEVQEARRKGGELKRKIREQLARNPNQPIIT&amp;quot;&lt;br /&gt;
ORIGIN      &lt;br /&gt;
        1 cggccgcata atacgactca ctatagggat ctcctctaga gttactttgc cgtgctccat&lt;br /&gt;
       61 actatcctat tctatattgg attatactat cgatccaacg attcagatta actctatact&lt;br /&gt;
      121 agtgaagtct acacttatgg tatgggtaat atacatatgt agtatagtat agcataaggg&lt;br /&gt;
      181 tatttcattt tgcaggttag ccgtttatct gctggtgctc ctcttgctgt agtagtgttg&lt;br /&gt;
      241 ttggtgttgc tgctgatgac ctaaaatgct tgcatgtttc tatcatgttc tccataatgt&lt;br /&gt;
      301 agtatcatgt actccatctt ccttgttggt ttttgtccat aatctccacc ttggcagctt&lt;br /&gt;
      361 gcatcatctt actctcgagc ttgtccacct tgagattcaa ctcctggaac gcggctccca&lt;br /&gt;
      421 gttcatccac cctcttctcc acggcaggaa tccgtgactc caccgtacgc ttgagatctt&lt;br /&gt;
      481 ggtactccgc cctggtgcgc tcatcagcct caactcgttt cttctcattc ccttccacaa&lt;br /&gt;
      541 gttgcagaag gaggtccaac ttcttatcag tctccatggc ctcggatctg gatcaggtac&lt;br /&gt;
      601 ctactgctct cgctccgaat tccgcgaacc ttagggggca agtttccttt tcgcggtgcc&lt;br /&gt;
      661 gatccgaaga tcagctccaa tccaccccaa ggaacaattt caccgcagaa tcaagagaat&lt;br /&gt;
      721 ttgagaagca agagaggctc tgataccaga ttgtcaggat ctcaagaaat cagcaaagaa&lt;br /&gt;
      781 caacaagaac acacaaggat tcaggcaact agtttggatt gatctgctcc aacccaacag&lt;br /&gt;
      841 gattgagcct tccgccgcca ccgccaccga gttgccagtt catagttgtc tttctcgagt&lt;br /&gt;
      901 tcatcttatt tatacagtag tatctcccta ctcacacgac acacacagta gccagctgta&lt;br /&gt;
      961 caacagatag ctgggctacg caacccactc ggacccatgg taacgaggat tgggctttgg&lt;br /&gt;
     1021 ccctcttgtg ggtcttgctc ttcctggagt agtagtctgt atctcctcct cctggacttc&lt;br /&gt;
     1081 agcttctgct tcatcaggtt ctccttcttc aggttccttc tctccctgtt cagcttctgc&lt;br /&gt;
     1141 ttcatcaggt tctccttctt cagtacccat agtgacaggc aggttcctga caaaattctg&lt;br /&gt;
     1201 ctcgtttgcg accaatggta gtgatcatag ttgcaaccag gagggggggg ggggaaatcg&lt;br /&gt;
     1261 ccgtcccctc cgctcctctc ccgtcgtccc caacgcctcg ttcgcgcatt tcgttgaaca&lt;br /&gt;
     1321 ccatgacggc gccgaattcg cagtgtccgc acatctcctc ctcccccgtc ctctccaaac&lt;br /&gt;
     1381 cccaaaccct atctccaccc ccgaggcagg cgcccccatg cacttgtaag tcgattggat&lt;br /&gt;
     1441 gtcctgtccc agaagacata tcgagcgagg aggcggaggg ggacgaaggg aacatatcga&lt;br /&gt;
     1501 gcgaggaagc ggagggtgga tcggcatccc ccatttcaag gtactatact agtccattat&lt;br /&gt;
     1561 agtagtagtg cttttgcatc ttagaaaaaa aaatatgttc attagccatt gagagcttct&lt;br /&gt;
     1621 gaagttgttg attttgttcc aaccccaact gtgagtttca gttcaggtca tccactgatt&lt;br /&gt;
     1681 ttcactatgc caattctctg aaacaacttt accactgtca catgaacaca ctgaaacagt&lt;br /&gt;
     1741 ttggtgtaga cgtgtagtga agaatgtagc atatatacct tcacttaatt tttcttgcaa&lt;br /&gt;
     1801 ttattggcca ttactagtta tgcgaggtag aagtgttcta aggtactgta tcatttttat&lt;br /&gt;
     1861 gtactaatta attaagttta ataaaaactt ttattatcta aaaataaatg actattacta&lt;br /&gt;
     1921 gctcggtact ccctttattt tatattataa gacgttttga tttttttata tacaactttc&lt;br /&gt;
     1981 tttaagtttg attatactta taaaaaatta gcaaacatat atattttttt tacattaata&lt;br /&gt;
     2041 gtgcaagtga gcacgcttaa atgcattgta cttccttcgt aaaaaaacat caaactttta&lt;br /&gt;
     2101 cggacgaata tggataaatg catatctaaa ttcatcctca ataattgatt ctttttggag&lt;br /&gt;
     2161 gagtacaatt ggttggtgcg ctttgtcctt ggaccctaca ataatgatga ttgtttcttt&lt;br /&gt;
     2221 aatctattga ccttgactta ccacatgggc tatgtttatc ccttcctgaa tcctgagcac&lt;br /&gt;
     2281 tgactaccga ggcaccgagt gtgagcggca acggcggtca gggagcaggc gtggctcgtc&lt;br /&gt;
     2341 ggcgagcggc tacgggcaac ggcgccttgg cgtcaggcat ccgccgtcac tcacctcaag&lt;br /&gt;
     2401 cttgcgggct ctgcgaccac cctctcatag tcataggcca cagaaggtgt agtagtactt&lt;br /&gt;
     2461 catacatttc gagcagtttc tttcagattg tttgtttttg agcttctaat tttgggatgc&lt;br /&gt;
     2521 attagatagt gatgaaagcc tgaattattg gaattttggt gttggtactc acactctcac&lt;br /&gt;
     2581 agtcagaaca tactcctata tattttgcag cacatttgcc ttgtgcgtgc tgttcgtctg&lt;br /&gt;
     2641 ttccactcgt gaacatcaga cgcgaagatt atagattcac ccctgttcac agattcaggt&lt;br /&gt;
     2701 actgccaatt gcctggatga acaccagtcc atttgctctc tttcgcctta caatttttct&lt;br /&gt;
     2761 ctgcattgta ctagcagccg tagctcgaaa gcctcgaata tgattccttt tcaagatttt&lt;br /&gt;
     2821 atatttatgg aatataattc acttttaaga tgccttgatg gtgaaatagt agacatgtga&lt;br /&gt;
     2881 gactccaaat ctcgtcctaa aagagcatgg aggtaaaaaa agaaaaaggt agacatcgct&lt;br /&gt;
     2941 attgtagaca tggagagctg gaatacgatt actttcaaga tattatattc aatgagcatt&lt;br /&gt;
     3001 cattcttaca catatgccac aaaggtaaaa aaaaacagag aaagagagag agaggggaaa&lt;br /&gt;
     3061 gaagccaagt tctttcttct actatcattt aggttgagtt cgtttgttaa ggttcccaac&lt;br /&gt;
     3121 ctacgattcc tcgtttcccg cgtgcacgat tcccaaacta ctaaatggta tgctttttaa&lt;br /&gt;
     3181 aatatttcgt agaaaaattg ctttaaaaaa tcatattaat ttatttttta agttgtttag&lt;br /&gt;
     3241 ctaatactca attaatcatg cattaatttg ccgctccgtt ttagtggaag tcatctgaaa&lt;br /&gt;
     3301 ggatcaaagg aagcaacacc aagtccttat ttcgactccg actctctcac tctcgccatt&lt;br /&gt;
     3361 tattcttttc tttctgttat tttaaaagtt gctactttag cttcagccac gtgaattctt&lt;br /&gt;
     3421 gatatttcat tatttttctc atcaaacaat agcatcttct tctggaaatc gaattcaggg&lt;br /&gt;
     3481 cttatatgtt gcttattctg atatataggt ctgtcacgag gcgtatgatc atcaactctg&lt;br /&gt;
     3541 ccacaaaatc cattcaaaaa tagaacagag caatggaggc gacggcgctg agtgtgggca&lt;br /&gt;
     3601 aatccgtgct gaatggagcg cttggctacg caaaatctgc atttgctgag gaggtggcct&lt;br /&gt;
     3661 tgcagcttgg tatccagaaa gaccacacat ttgttgcaga tgagcttgag atgatgaggt&lt;br /&gt;
     3721 ctttcatgat ggaggcgcac gaggagcaag ataacagcaa ggtggtcaag acttgggtga&lt;br /&gt;
     3781 agcaagtccg tgacactgcc tatgatgttg aggacagcct ccaggatttc gctgttcatc&lt;br /&gt;
     3841 ttaagaggcc atcctggtgg cgatttcctc gtacgctgct cgagcggcac cgtgtggcca&lt;br /&gt;
     3901 agcagatgaa ggagcttagg aacaaggtcg aggatgtcag ccagaggaat gtgcggtacc&lt;br /&gt;
     3961 acctcatcaa gggctctgcc aaggccacca tcaattccac tgagcaatct agcgttattg&lt;br /&gt;
     4021 ctacagccat attcggcatt gacgatgcaa ggcgtgccgc aaagcaggac aatcagagag&lt;br /&gt;
     4081 tggatcttgt ccaactaatc aacagtgagg atcaggacct aaaagtgatc gcggtctggg&lt;br /&gt;
     4141 gaacaagtgg tgatatgggc caaacaacaa taatcaggat ggcttatgag aacccagatg&lt;br /&gt;
     4201 tccaaatcag attcccatgc cgtgcatggg taagggtgat gcatcctttc agtccaagag&lt;br /&gt;
     4261 actttgtcca gagcttggtg aatcagcttc atgcaaccca aggggttgaa gctctgttgg&lt;br /&gt;
     4321 agaaagagaa gacagaacaa gatttagcta agaaattcaa tggatgtgtg aatgatagga&lt;br /&gt;
     4381 agtgtctaat tgtgcttaat gacctatcca ccattgaaga gtgggaccag attaagaaat&lt;br /&gt;
     4441 gcttccaaaa atgcaggaaa ggaagccgaa tcatagtgtc aagcactcaa gttgaagttg&lt;br /&gt;
     4501 caagcttatg tgctgggcaa gaaagccaag cctcagagct aaagcaattg tctgctgatc&lt;br /&gt;
     4561 agacccttta cgcattctac gacaaggtaa tatacttgct cttcaagcat acctctcgat&lt;br /&gt;
     4621 atcattttta attcagttat gcctttagta atttctaatt caattgtgta taggctagtt&lt;br /&gt;
     4681 gaagtgcgtg ggagttacca ttccattaga aacacatgac ctaatgcaac taacaagtgc&lt;br /&gt;
     4741 tcctcctgtt ctctctcatt tgccttttgg gaatgcatgc actcaacatt ttaagattac&lt;br /&gt;
     4801 agccaaaata tatgtatttg gatttgtcaa aacaaagatg tatgctagaa aaagaaatgg&lt;br /&gt;
     4861 tctaatacag gtttacaaat aagacaacga tgcaaaaagg gcaactaaaa acatattgat&lt;br /&gt;
     4921 tccctcatct gccactgcaa ttgccttaaa ttctagtcca ttctactatc tccgtttcat&lt;br /&gt;
     4981 attataagtc actctagttt ttttccagtc aaacttcttt agtttgacca agtttataca&lt;br /&gt;
     5041 aaaatttagc aacatatcca acacgaaatt agtttcatta aatgtagcat tgaatatatt&lt;br /&gt;
     5101 ttgatagtat gtttgttttg tgttgaaaat gctgctatat tttttaaaaa aacttggtca&lt;br /&gt;
     5161 aacctaaaca agtttgacta ggagaaaagt cgaaacgact tataatatga aatagaggga&lt;br /&gt;
     5221 gaatgttcga agtttggcta acggtcaatg ctagtgcttt aagtgggtaa gccgcaaatc&lt;br /&gt;
     5281 caattatagg ccaaaataca tgggtttgtg gcttattttg gctataagtg ggtttcgcgg&lt;br /&gt;
     5341 gttagccact tacaccccta gtcaatgcta atgaaagtag aagtgatgct attcaaggaa&lt;br /&gt;
     5401 aatgtattgg ataccgagat tgccttgaat aaagaataaa attgaggtag tagattggat&lt;br /&gt;
     5461 aatagattga cccacaaaat tgtacaagta tgtaatgtag cacaagtcct ctttgcacaa&lt;br /&gt;
     5521 ttaaaatttt gaagctccta tttcacaaat aattttgata tggattaatt gatttcatat&lt;br /&gt;
     5581 ccaattcgca cagtttattg aatttggaga tttatttcct ctatatgtga gagatgattg&lt;br /&gt;
     5641 taaaatgggc aaatctagca aatgcatcct ctcatccttt ggattaaatg tagtgtactt&lt;br /&gt;
     5701 atcccattat tttaaagtta aattaataca tattttattg aacagtcaga tatacgtttt&lt;br /&gt;
     5761 tcaaaatagg atccaaaact aaggtttata ctagactgca aattaatgaa aggaattatc&lt;br /&gt;
     5821 attattgttt tgtatacttt catgaccgaa aacaaggcta aacactatcc atgtatgaaa&lt;br /&gt;
     5881 atttaaggct aaaagttgtt cttaatcatt gctccctttt gtttagggtt cccaaattat&lt;br /&gt;
     5941 agaggattca gtgaagccag tgtctatctc ggatgtggcc atcacaagta caaacaatca&lt;br /&gt;
     6001 tacagtggcc catggtgaga ttatagatga tcaatcaatg gatgctgatg agaagaaggt&lt;br /&gt;
     6061 ggctagaaag agtcttactc gcattaggac aagtgttggt gcttcggagg aatcacaact&lt;br /&gt;
     6121 tattgggcga gagaaagaaa tatctgaaat aacacactta attttaaaca atgatagcca&lt;br /&gt;
     6181 gcaggttcag gtgatctctg tgtggggaat gggtggcctt ggaaaaacca ccctagtaag&lt;br /&gt;
     6241 cggtgtttat caaagcccaa ggctgagtga taagtttgac aagtatgttt ttgtcacaat&lt;br /&gt;
     6301 catgcgtcct ttcattcttg tagagctcct taggagtttg gctgagcaac tacataaagg&lt;br /&gt;
     6361 atcttctaag aaggaagaac tgttagaaaa tagagtcagc agtaagaaat cactagcatc&lt;br /&gt;
     6421 gatggaggat accgagttga ctgggcagtt gaaaaggctt ttagaaaaga aaagttgctt&lt;br /&gt;
     6481 gattgttcta gatgatttct cagatacctc agaatgggac cagataaaac caacgttatt&lt;br /&gt;
     6541 ccccctgttg gaaaagacaa gccgaataat tgtgactaca agaaaagaga atattgccaa&lt;br /&gt;
     6601 ccattgctca gggaaaaatg gaaatgtgca caaccttaaa gttcttaaac ataatgatgc&lt;br /&gt;
     6661 attgtgcctc ttgagtgaga aggtaatata agtgtgctcc atttttcttg gtttgatatt&lt;br /&gt;
     6721 cttttaatca tttgagttat ccaatcaaga tgatatttgt gcatgcagaa atagcatata&lt;br /&gt;
     6781 ctagattcat atacaactta atctgttctc acaacaatag caatgcagtt cctaaaatga&lt;br /&gt;
     6841 cctgcattgg atggacgtta gatgtgactt tgtttttgta tgtaatggtg gccttcattc&lt;br /&gt;
     6901 cttagtttta atagtaaaga cgtatttcta aatttaattt tttttgtttt actttagagc&lt;br /&gt;
     6961 acaataaagc ttaaattgta tcaatgtcag gtatttgagg aggctacata tttggatgat&lt;br /&gt;
     7021 cagaacaatc cagagttggt taaagaagca aaacaaatcc taaagaagtg cgatggactg&lt;br /&gt;
     7081 ccccttgcaa tagttgtcat aggtggattc ttggcaaacc gaccaaagac cccagaagag&lt;br /&gt;
     7141 tggagaaaat tgaacgagaa tatcaatgct gagttggaaa tgaatccaga gcttggaatg&lt;br /&gt;
     7201 ataagaaccg tccttgaaaa aagctatgat ggtttaccat accatctcaa gtcatgtttt&lt;br /&gt;
     7261 ttatatctgt ccattttccc tgaagaccag atcattagtc gaaggcgttt ggtgcatcgt&lt;br /&gt;
     7321 tgggcagcag aaggttactc aactgcagca catgggaaat ctgccattga aatagctaac&lt;br /&gt;
     7381 ggctacttca tggaactcaa gaatagaagc atgattttac cattccagca atcaggtagc&lt;br /&gt;
     7441 agcaggaaat caattgactc ttgcaaagtc catgatctca tgcgtgacat cgccatctca&lt;br /&gt;
     7501 aagtcaacgg aggaaaacct tgtttttagg gtggaggaag gctgcagcgc gtacatacat&lt;br /&gt;
     7561 ggtgcaattc gtcatcttgc tataagtagc aactggaagg gagataagag tgaattcgag&lt;br /&gt;
     7621 ggcatagtgg acctgtcccg aatacgatcg ttatctctgt ttggggattg gaagccattt&lt;br /&gt;
     7681 tttgtttatg gcaagatgag gtttatacga gtgcttgact ttgaagggac tagaggtcta&lt;br /&gt;
     7741 gaatatcatc accttgatca gatttggaag cttaatcacc taaaattcct ttctctacga&lt;br /&gt;
     7801 ggatgctatc gtattgatct actgccagat ttactgggca acctgaggca actccagatg&lt;br /&gt;
     7861 ctagacatca gaggtacata tgtaaaggct ttgccaaaaa ccatcatcaa gcttcagaag&lt;br /&gt;
     7921 ctacagtaca ttcatgctgg gcgcaaaaca gactatgtat gggaggaaaa gcatagttta&lt;br /&gt;
     7981 atgcagaggt gtcgtaaggt gggatgtata tgtgcaacat gttgcctccc tcttctttgc&lt;br /&gt;
     8041 gaaatgtatg gccctctcca taaggcccta gcccggcgtg atgcgtggac tttcgcttgc&lt;br /&gt;
     8101 tgcgtgaaat tcccatctat catgacggga gtacatgaag aggaaggcgc tatggtgcca&lt;br /&gt;
     8161 agtgggatta gaaaactgaa agacttgcac acactaagga acataaatgt cggaagggga&lt;br /&gt;
     8221 aatgccatcc tacgagatat cggaatgctc acaggattac acaagttagg agtggctggc&lt;br /&gt;
     8281 atcaacaaga agaatggacg agcgtttcgc ttggccattt ccaacctcaa caagctggaa&lt;br /&gt;
     8341 tcactgtctg tgagttcagc agggatgccg ggcttgtgtg gttgcttgga tgatatatcc&lt;br /&gt;
     8401 tcgcctccgg aaaacctaca gagcctcaag ctgtacggca gtttgaaaac gttgccggaa&lt;br /&gt;
     8461 tggatcaagg agctccagca tctcgtgaag ttaaaactag tgagtactag gctattggag&lt;br /&gt;
     8521 cacgacgttg ctatggaatt ccttggggaa ctaccgaagg tggaaattct agttatttca&lt;br /&gt;
     8581 ccgtttaaga gtgaagaaat tcatttcaag cctccgcaga ctgggactgc ttttgtaagc&lt;br /&gt;
     8641 ctcagggtgc tcaagcttgc aggattatgg ggcatcaaat cagtgaagtt tgaggaagga&lt;br /&gt;
     8701 acaatgccca aacttgagag gctgcaggtc caagggcgaa tagaaaatga aattggcttt&lt;br /&gt;
     8761 tctgggttag agtttctcca aaacatcaac gaagtccagc tcagtgtttg gtttcccacg&lt;br /&gt;
     8821 gatcatgata ggataagagc cgcgcgcgcc gcgggcgctg attatgagac tgcctgggag&lt;br /&gt;
     8881 gaagaggtac aggaagcaag gcgcaaggga ggtgaactga agaggaaaat ccgagaacag&lt;br /&gt;
     8941 cttgctcgga atccaaacca acccatcatt acctgagctc ctttggagtt actttgccgt&lt;br /&gt;
     9001 gctccatact atcctacaag tgagatcctc tgcagtactg catgctcact gacatgtgga&lt;br /&gt;
     9061 cccgaggggc tgtggggccc acatgtcagt gagcagtact gtgcagtact gcagaggacc&lt;br /&gt;
     9121 tgcatccact atcctatatt ataatggatt gtactatcga tccaactatt cagattaact&lt;br /&gt;
     9181 ctatactagt gaacttattt ttttttgccg ggccggcaaa tagctggtcg atgtatatta&lt;br /&gt;
     9241 agaataagaa agggaatgta caagatagcg cggtgcgtca atgcaccacc attacagacg&lt;br /&gt;
     9301 taaaaggaaa gctaaaatct cacagaatga gttgctacag agtgacacat ggggctaaca&lt;br /&gt;
     9361 agacctgcag ctatccaagt ctcccattca tcccccatgg cagaacagaa ctggggaacc&lt;br /&gt;
     9421 gttgccgcga tcccttcaaa cacccttgcg tttcgctctt tcgaaatcaa ccaggttaca&lt;br /&gt;
     9481 aggatcaccc ttgcatcgaa cgttttgcgg tcaaccttag caacagattt ccgggctgca&lt;br /&gt;
     9541 agccaccaat cagcaaaatc agccgacgat gaggagcacg aaaggaccag gcgtgtgcgc&lt;br /&gt;
     9601 acctgacctc aaatctcctg ggtgtaagag cagcccacga agatgtgctg gcaggtttcc&lt;br /&gt;
     9661 ccgtcattgg agcagaaata gcacaccgga gcaagcttcc atctgtgacg ttgtagattg&lt;br /&gt;
     9721 ttggcagtga ggcaagcatt gcgctcggcg agaaacataa agaacttaca tctcgccggg&lt;br /&gt;
     9781 gcaagagact tccaaataat ggtatacata tgtagtatat agtatagtat agtatagtat&lt;br /&gt;
     9841 aagggtattc attttgcagg ttagcggtta tctgctgctg ttcctcctgc tgcggcgtgc&lt;br /&gt;
     9901 tggagtagtg ttgttggtgg tggtgctgat gacctaaaat gcttgcttgt ttctatcaag&lt;br /&gt;
     9961 ttctccagaa tgtagtatgt actgcatctt gttgattttt gtccataaac ggattgcatt&lt;br /&gt;
    10021 atctgtatat gacccaatca acaataaacg gtgttgcatt ttgttcctaa aagctcttag&lt;br /&gt;
    10081 agtctgacca gttatctctg tacgcatctt catgctgttc tttgggcact ggtcatggtt&lt;br /&gt;
    10141 aaatcacagt tcaccgaaac ttattttctg tagacttatt ctgaaatact gagaaattga&lt;br /&gt;
    10201 aatgtagtaa ctattgtctg tagactgctt tctcgttttt cttttgcggt cgccatctcc&lt;br /&gt;
    10261 agtcagtatc tacagaagaa gagccaatgc agcctattgt cctttttttg ccgggtcggc&lt;br /&gt;
    10321 cg&lt;br /&gt;
//&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178827</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178827"/>
				<updated>2014-06-06T05:03:08Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178824</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178824"/>
				<updated>2014-06-06T05:02:20Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated.&amp;lt;br&amp;gt;&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&amp;lt;br&amp;gt;&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system.&amp;lt;br&amp;gt; &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&amp;lt;br&amp;gt;&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain.&amp;lt;br&amp;gt;&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&amp;lt;br&amp;gt;&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
1.Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;br&amp;gt;&lt;br /&gt;
2.Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64.&amp;lt;br&amp;gt;&lt;br /&gt;
3.Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
4.Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．&amp;lt;br&amp;gt;&lt;br /&gt;
5.Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/&amp;lt;br&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178821</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178821"/>
				<updated>2014-06-06T04:57:42Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
=== Gene structure===&lt;br /&gt;
The Pib gene encodes a polypeptide of 1251 amino acids, it contains an NBS region and C-terminal LRRs, but no distinct transmembrane domain. Thus, the Pib gene belongs to the NBS-LRR class of plant disease resistance genes and is predicted to encode a cytoplasmic&lt;br /&gt;
protein. Interestingly, the Pib protein contains an N-terminal duplication of the conserved kinase 1a (P-loop), 2 and 3a domains of the NBS region. The duplicated segments shared 32% identity&lt;br /&gt;
and 55% similarity to each other. It is interesting that only the kinase 1a (P-loop), 2 and 3a domains are duplicated&lt;br /&gt;
The C-terminal LRR domain of Pib contains 17 repeats with similarity to the cytoplasmic LRR consensus sequence. Interestingly, there are eight cysteine residues clustered in LRR 7 and 8 which have not been reported for other R genes. Of these, two fall at LRR consensus&lt;br /&gt;
positions indicating that they are likely to be buried in the hydrophobic core of the protein. &lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
The inheritance of host resistance to rice blast has been studied extensively. At least 68 resistance loci have been identified in rice. Many genes for blast resistance have been mapped by using restriction fragment length polymorphism (RFLP) markers.&lt;br /&gt;
The rice blast resistance genes confer a high race specific resistance to blast fungus races. The specific interaction between resistance genes in rice plant and avirulence genes in the fungal pathogen can be well explained by the gene-for-gene system. &lt;br /&gt;
Pib, on chromosome 2, shows resistant reaction to 5 of 20 standard differential blast isolates from Philippines selected by Telebanco-Yanoria et al. (2008).&lt;br /&gt;
Another rice blast resistance genes, Pish, was identified by Imbe and Matsumoto from a Japonica-type rice variety, Shin 2. As the monogenic resistance line with Pish developed by Tsunematsu et al showed a moderate and a broad spectrum resistant reaction to the isolates from&lt;br /&gt;
Philippines. There has been a research confirming the additive effect of Pish and Pib in the pyramided lines by their reaction patterns to blast isolates, suggesting the potential availabilities of the combinations of these genes.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
The expression of Pib was investigated by Northern blot analysis. Tohoku IL9 and Sasanishiki plants were inoculated with rice blast incompatible strain ARCP90±18C. Pib mRNA was detected in all Tohoku IL9 samples, but not in Sasanishiki samples in both cases.  Pib was expressed at a low level at the zero time point, was further induced at 12 and 24 h after inoculation (HAI) with incompatible strain&lt;br /&gt;
There has been extensive investigation of the expression of the Pib gene family (Pib, PibH8, HPibH8-1, HPibH8-2) under various environmental and chemical treatments. PibH8 shows 42% identity and 60% similarity to Pib and, like Pib, has a duplication of the kinase 1a, 2, and 3a motifs of the NBS region in the N-terminal half of the protein. Interestingly, genes of the Pib family exhibit a diurnal rhythm of expression. Their expression was regulated dramatically by environmental signals, such as temperature, light and water availability. Their expression was also induced by chemical treatments, such as jasmonic acid, salicylic acid, ethylene and probenazole. The findings suggest that expression of the Pib gene family is up-regulated by environmental conditions that would favour pathogen infection. This may reflect the evolution of anticipatory control of R gene expression.&lt;br /&gt;
Expression of Pib was low under non-challenged conditions, but strongly induced by the blast-causing fungal pathogen Magnaporthe grisea, thereby conferring resistance to the pathogen. It is generally established that cytosine methylation of the promoter-region often plays a repressive role in modulating expression of the gene in question. Two critical regions of the Pib promoter were heavily CG cytosine-methylated in both cultivars studied.Surprisingly, induced expression of Pib by M. grisea infection did not entail its promoter demethylation,and partial demethylation by 5-azacytidine-treatment actually reduced Pib expression relative to wildtype plants. Accordingly, the blast disease-resistance was compromised in the 5’-azaC-treated plants relative to wild-type. In contrast, the disease susceptibility was not affected by the 5’-azaC treatment in another two rice cultivars that did not contain the Pib gene, ruling out effects of other R genes and non-specific genotoxic effects by the drug-treatment as a cause for the compromised Pib-conditioned blast-resistance. Taken together, these results suggest that promoter DNA methylation plays a novel enhancing role in conditioning high-level of induced expression of the Pib gene in times of M. grisea infection, and its conferred resistance to the pathogen.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Shinoda, H., Toriyama, K., Yunoki, T., Ezuka,  A. and Sakurai, Y., 1971, Studies in the varietal resistance of rice to blast. 6. Linkage relationship of blast resistance genes (in Japanese with English summary) Bull. Chugoku Agric. Exp. Stn. Ser. A, 20, 1-25.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Wang, Z. X., M. Yano, U. Yamanouchi, M. Iwamoto, L. Monna, H. Hayasaka, Y. Katayose, and T. Sasaki, 1999, The Pib gene for riceblast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes. Plant J. 19, 55—64..\&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Y. Koide;A. Kawasaki;M. J. Telebanco-Yanoria;A. Hairmansis;N. T. M. Nguyet;J. Bigirimana;D. Fujita;N. Kobayashi;Y. Fukut, 2010, Development of pyramided lines with two resistance genes, Pish and Pib, for blast disease (Magnaporthe oryzae B. Couch) in rice (Oryza sativa L.)Plant Breeding, 129(6): 670-675&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;&lt;br /&gt;
Wang Z X，Yamanouchi U，Katayose Y，et al., 2001, Expression of the pib rice blast resistance gene family is up － regulated by environmental conditions favoring infection and by chemical signals that trigger secondary plant defenses［J］ ． Plant Molecular Biology， 47: 653－ 661．.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;&lt;br /&gt;
Yuan Li, Qiong Xia, Hongping Kou, Dan Wang, Xiuyun Lin, Ying Wu, Chunming Xu, Shaochen Xing and Bao Liu, 2011, Induced Pib Expression and Resistance to Magnaporthe grisea are Compromised by Cytosine Demethylation at Critical Promoter Regions in Rice, J Integr Plant Biol, doi: 10.1111/ &amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178519</id>
		<title>Os02g57310</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g57310&amp;diff=178519"/>
				<updated>2014-06-05T14:26:57Z</updated>
		
		<summary type="html">&lt;p&gt;Lily91dan: Created page with &amp;quot;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first b...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice blast, caused by the fungal pathogen Magnaporthe grisea, is one of the most serious diseases of rice. Os02g57310, namely Magnaporthe grisea resistance-b, pib, the first blast-resistance gene to be cloned belonging to the nucleotide binding site (NBS) and leucine-rich repeat (LRR) superfamily. pib has been mapped to the distal end of the long arm of chromosome 2 (Shinoda et al., 1971),and has been cloned and identified at the molecular level (Wang et al. 1999).&lt;br /&gt;
&lt;br /&gt;
fuction&lt;/div&gt;</summary>
		<author><name>Lily91dan</name></author>	</entry>

	</feed>