http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=Liujia 2026-08-27T23:20:11Z User contributions MediaWiki 1.30.0 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180931 2014-06-08T08:10:03Z

<p>Liujia: /* Labs working on this gene */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ===Function===<br /> [[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]][[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> * The expression of Oshox22 is responsive to drought, salinity and ABA treatments, suggesting its role in regulating stress tolerance&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> *S. Zhang, L. Jiang, C.-M. Liu, P. B. F. Ouwerkerk: Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China. e-mail: p.b.f.ouwerkerk.2@gmail.com&lt;br&gt;<br /> *S. Zhang, L. Jiang: Graduate School of Chinese Academy of Sciences, Beijing 100049, China&lt;br&gt;<br /> *S. Zhang, A. H. Meijer, P. B. F. Ouwerkerk: Institute of Biology, Leiden University, P.O. BOX 9505, 2300 RA Leiden, The Netherlands&lt;br&gt;<br /> *I. Haider, W. Kohlen, H. Bouwmeester. Laboratory of Plant Physiology, Wageningen University, Droevendaalsesteeg 1, 6708 PB Wageningen, The Netherlands&lt;br&gt;<br /> *H. Schluepmann. Department of Molecular Plant Physiology, Utrecht University, Padualaan 8, 3584 CH Utrecht, The Netherlands&lt;br&gt;<br /> *A. Agalou, S. Purwantomo, A. Estiati, R. J. de Kam, M. Wang, A. H. Meijer, P. B. F. OuwerkerkInsti: tute of Biology, Clusius Laboratory, Leiden University, P.O. Box 9505, 2300 RA Leiden, The Netherlands. e-mail: p.b.f.ouwerkerk@biology.leidenuniv.nl&lt;br&gt;<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180348 2014-06-07T15:04:56Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ===Function===<br /> [[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]][[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> * The expression of Oshox22 is responsive to drought, salinity and ABA treatments, suggesting its role in regulating stress tolerance&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180344 2014-06-07T15:00:33Z

<p>Liujia: /* Annotated Information */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ===Function===<br /> [[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]][[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180341 2014-06-07T15:00:08Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===[[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]][[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180339 2014-06-07T14:59:20Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; [[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]]<br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;[[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180336 2014-06-07T14:58:33Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; [[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]]<br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;[[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180333 2014-06-07T14:57:36Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; [[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]]<br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA.<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Oshox22_structure.jpg&diff=180332 2014-06-07T14:56:47Z

<p>Liujia: </p> <hr /> <div></div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180330 2014-06-07T14:56:20Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;(Fig. 1).&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA.<br /> [[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]]<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180317 2014-06-07T14:36:40Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180316 2014-06-07T14:36:19Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Oshox22 is demonstrated as a nuclear-localized protein&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180312 2014-06-07T14:32:29Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180310 2014-06-07T14:32:01Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt; Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180306 2014-06-07T14:30:30Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180297 2014-06-07T14:26:08Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 4&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180296 2014-06-07T14:25:06Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 2&quot;/&gt; &lt;ref name=&quot;ref 3&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180295 2014-06-07T14:24:35Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 2&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 3&quot;/&gt; &lt;ref name=&quot;ref 4&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180292 2014-06-07T14:22:48Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 3&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 3&quot;/&gt; &lt;ref name=&quot;ref 4&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> <br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180291 2014-06-07T14:21:54Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 3&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 3&quot;/&gt; &lt;ref name=&quot;ref 4&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180290 2014-06-07T14:17:41Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 3&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 3&quot;/&gt; &lt;ref name=&quot;ref 4&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180286 2014-06-07T14:16:30Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 3&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''&lt;ref name=&quot;ref 4&quot;/&gt; were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180281 2014-06-07T14:15:33Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 3&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS'' were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 4&quot;&gt;<br /> Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180275 2014-06-07T14:08:28Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 3&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS'' were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts &lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Oshox22_binding.jpg&diff=180273 2014-06-07T14:06:41Z

<p>Liujia: </p> <hr /> <div></div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180271 2014-06-07T14:04:40Z

<p>Liujia: /* Function */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions&lt;ref name=&quot;ref 1&quot;/&gt;.&lt;br&gt;&lt;br&gt; <br /> * Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains&lt;ref name=&quot;ref 1&quot;/&gt;. This is typical of HD-Zip I family transcription factors&lt;ref name=&quot;ref 3&quot;/&gt;.&lt;br&gt;&lt;br&gt;<br /> * Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS'' were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present (Fig. 2c). The interaction is less effective at the AH1 site than that at AH2.&lt;br&gt;&lt;br&gt;<br /> * Agalou et al.&lt;ref name=&quot;ref 2&quot;/&gt; demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars.&lt;br&gt;&lt;br&gt;<br /> [[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts.&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180231 2014-06-07T13:28:31Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180230 2014-06-07T13:27:36Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 3&quot;&gt;<br /> Meijer AH, de Kam RJ, d’Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180192 2014-06-07T12:54:51Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180190 2014-06-07T12:54:22Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumb|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180187 2014-06-07T12:53:21Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180186 2014-06-07T12:52:36Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> * Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.&lt;br&gt;&lt;br&gt;<br /> * Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a).&lt;br&gt;&lt;br&gt;<br /> * They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature&lt;ref name=&quot;ref 1&quot;/&gt; .[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''&lt;ref name=&quot;ref 1&quot;/&gt; .]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180179 2014-06-07T12:48:17Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature.[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''.]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. In the picture,after each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180166 2014-06-07T12:43:15Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature.[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''.]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|thumbnail|'''Fig. 5''' Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180165 2014-06-07T12:42:38Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature.[[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''.]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|'''Fig. 5''' Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180157 2014-06-07T12:38:23Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature.[[File:Oshox22 expression.jpg|right|Fig. 3]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|'''Fig. 5''' Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Oshox22_expression.jpg&diff=180151 2014-06-07T12:35:48Z

<p>Liujia: </p> <hr /> <div></div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180148 2014-06-07T12:35:15Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature.[[File:Oshox22 expression.jpg|right|Fig. 3]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180146 2014-06-07T12:34:22Z

<p>Liujia: /* Expression */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. Zhang S et al.&lt;ref name=&quot;ref 1&quot;/&gt; use quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). They also monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature.[[File:expression.jpg|right|Fig. 3]]<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180109 2014-06-07T12:04:15Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref 1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref 2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180107 2014-06-07T12:02:20Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref2&quot;&gt;<br /> Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180104 2014-06-07T12:00:52Z

<p>Liujia: /* References */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> 1.Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.<br /> 2.Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=180089 2014-06-07T11:51:09Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:HD-ZIP_tree.jpg&diff=178723 2014-06-06T02:48:08Z

<p>Liujia: uploaded a new version of &amp;quot;File:HD-ZIP tree.jpg&amp;quot;</p> <hr /> <div></div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=178721 2014-06-06T02:45:32Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22''belongs to subfamily IB.[[File:HD-ZIP tree.jpg|50px|frame|right|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=178715 2014-06-06T02:44:08Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22''belongs to subfamily IB.[[File:HD-ZIP tree.jpg|200px|frame|left|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=178710 2014-06-06T02:41:45Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22''belongs to subfamily IB.[[File:HD-ZIP tree.jpg|200px|thumb|left|Fig. 5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neighbour-joining methods on an amino acid alignment of the complete HD-Zip domains as in Supplemental Figure 2. Family I is subdivided in clades ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. After each gene, the intron subfamily is indicated with a box (family I), circle (family II) and triangle (family III), respectively, in different grey tones or patterns. Below: Subfamily division based on exon-intron organization. The exon-intron pattern is divided into seven subfamilies for family I (IA, IB, IC, ID, IE, IF and IG), and both family II (IIA, IIB, IIC and IID) and III (IIIA, IIIB, IIIC and IIID) have four subfamilies. Open and filled boxes represent coding and conserved domains, respectively. The HD, Zip and START<br /> domains are indicated in light grey, dark grey and black, respectively. The position of the introns is shown with black arrowheads. The white arrowhead and star (*) refers to an alternative transcript occurring with Oshox6 in subfamily IB]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=178688 2014-06-06T02:32:47Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22''belongs to subfamily IB.<br /> <br /> <br /> [[File:HD-ZIP tree.jpg]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0541700&diff=178686 2014-06-06T02:32:23Z

<p>Liujia: /* Evolution */</p> <hr /> <div>Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.<br /> <br /> [mailto:huanghuasheng@xtbg.ac.cn email me]<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles.<br /> <br /> ===Evolution===<br /> Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants&lt;ref name=&quot;ref 1&quot;/&gt;The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2&lt;ref name=&quot;ref 2&quot;/&gt;. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22''belongs to subfamily IB.<br /> [[File:HD-ZIP tree.jpg]]<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Please input cited references here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os04g0541700|<br /> Description = Homeodomain-like containing protein|<br /> Version = NM_001059981.2 GI:297603098 GeneID:4336542|<br /> Length = 944 bp|<br /> Definition = Oryza sativa Japonica Group Os04g0541700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|<br /> AP = Chromosome 4:27522725..27523668|<br /> CDS = 27522763..27523206,27523324..27523668|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008397:27522725..27523668<br /> source=RiceChromosome04<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MDRGDHHHLQQQHQFLMPPPAPVVPPQLCMPAMMADEQYMDLGG GGAAAAPGRGGAGERKRRFTEEQIRSLESMFHAHHAKLEPREKAELARELGLQPRQVA IWFQNKRARWRSKQLEHDYAALRSKYDALHSRVESLKQEKLALTVQLHELRERLRERE ERSGNGGAATTAASSSSCNGSGSEEVDDDDDKRNAAAGCLDLEPPESCVLGGATCATP ADVSVESDQCDDQLDYDEGLFPESFCATPELWEPWPLVEWNAVA&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;39..482#600..944#atggtcgaacacagctagctagctgggctaggatcgccatggatcggggtgaccaccaccacctccagcagcagcaccagttcttgatgccaccgcctgcgccggtggtgccgccgcagctgtgcatgccggcgatgatggcggacgagcagtacatggacctgggcggtggcggggcggcggcggcgccggggaggggcggggccggggagaggaagcggcggttcacggaggagcagatacggtcgctggagtccatgttccacgcgcaccacgccaagctggagccccgcgagaaggcggagctggcgcgcgagctgggcctgcagccgcggcaggtggccatctggttccagaacaagcgcgcgcggtggcgctccaagcagctcgagcacgactacgccgcactccgctccaagtacgacgccctccactcccgcgtcgagtccctcaagcaagagaagctcgctctcaccgtccaggtaattaacgatgaattaagcaagctagcttagctactaatcgtaggaacatgcagatcatgtgttccataattaattcaaacgctaacttgattgctctttgcatgtaatatgcagttgcacgagctaagagagaggctgagggaacgggaggagaggagcggcaacggtggtgccgccacgacggcagcaagcagcagcagctgcaacggatcaggcagcgaggaggtcgacgacgacgacgacaagaggaacgccgccgcggggtgcctggacctcgagccgccggagagctgcgtgctcggcggcgcgacgtgcgccacgccggcggacgtgtcggtggagtcggatcagtgcgacgaccagcttgactacgatgagggcttgttcccggagtccttctgcgccacgccggagctgtgggagccatggccgctcgtcgagtggaatgcggtggcttga&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001059981.2 RefSeq:Os04g0541700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 4]]<br /> [[Category:Chromosome 4]]</div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:HD-ZIP_tree.jpg&diff=178683 2014-06-06T02:30:41Z

<p>Liujia: uploaded a new version of &amp;quot;File:HD-ZIP tree.jpg&amp;quot;: Fig.5 Phylogenetic tree showing the predicted relationship between HD-ZIP I, II and III genes from rice, Arabidopsis and C. plantagineum. The tree was created with the PAUP program using Neig</p> <hr /> <div></div>

Liujia https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:HD-ZIP_tree.jpg&diff=178671 2014-06-06T02:21:55Z

<p>Liujia: </p> <hr /> <div></div>

Liujia