Please input one-sentence summary here.

==Annotated Information==
===Function===
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating AM at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein trafficking<ref name="ref1" />. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility<ref name="ref2" />.

===Mutation===
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX.

An insertion of a retro transposon was detected in the lax-1 allele<ref name="ref2" />.

The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele<ref name="ref2" />.

A 59-bp region was deleted in lax-3.

Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
[[File:Phenotypic analysis of lax mutant..jpg|right|thumb|320px|'''Figure 1.''' ''Phenotypic analysis of lax mutant<ref name="ref2" />'']]

===Expression===
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem<ref name="ref2" />.
[[File:Expression pattern of the LAX gene..jpg|none|500px|caption]]

===Evolution===
The LAX bHLH domain showed high sequence similarity to that of other plant bHLH proteins and bHLH proteins predicted from the rice genome sequence. Outside of the bHLH region, however, no other conserved domains were identified. A database search failed to identify cognate homologs of LAX in the Arabidopsis genome, suggesting a possibility that LAX represents a grass-specific regulator of shoot branching<ref name="ref2" />.
[[File:Comparison of the bHLH domain of LAX and the most closely related gene of.jpg|none|400px|caption]]

===Knowledge Extension===
By map-based cloning, LAX2 was isolated fromthe lax2 (LAX PANICLE 2)mutant, which has a similar phenotype to lax1 in that it lacks an AM in most of the lateral branches of the panicle, and has a reduced number of AMs at the vegetative stage. LAX2 encodes a nuclear protein that physically interacts with LAX1, suggesting that the two LAXs may act together in regulating rice AM formation process<ref name="ref3" />.

==Labs working on this gene==
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan

2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan

3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan

4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan

5.Crop Development Division, National Agriculture and Food Research Organization Agricultural Research Center, Niigata 943-0193, Japan

6.National Center for Plant Gene Research, Key Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, People’s Republic of China

7.Department of Biological Mechanisms and Functions, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan

8.Photosynthesis and Photobiology Research Unit, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan

9.State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, People’s Republic of China

10.Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachi-ohmiya 319-2293, Japan

11.Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan

12.Rice Research Division, National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba 305-8518, Japan

13.Department of Agricultural and Environmental biology, Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113-8657, Japan

14.Precursory Research for Embryonic Science and Technology, Japan Science and Technology Agency, Kawaguchi 332-0012, Japan

==References==
<references>
<ref name="ref1">Oikawa, T. and J. Kyozuka (2009). "Two-Step Regulation of LAX PANICLE1 Protein Accumulation in Axillary Meristem Formation in Rice." Plant Cell 21(4): 1095-1108.</ref>
<ref name="ref2">Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.</ref>
<ref name="ref3">Tabuchi, H., et al. (2011). "LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems." Plant Cell 23(9): 3276-3287.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0831000|
Description = Transcription factor LAX PANICLE, a basic helix-loop-helix (bHLH) transcription factor|
Version = NM_001051234.1 GI:115440838 GeneID:4327431|
Length = 1078 bp|
Definition = Oryza sativa Japonica Group Os01g0831000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:37313995..37315072|
CDS = 37314110..37314757|
GCID = <gbrowseImage1>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq>|
AA = <aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq>|
DNA = <dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051234.1 RefSeq:Os01g0831000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:Positional cloning of the LAX gene..jpg

2014-05-12T07:35:29Z

Lixiaoman13:

File:Phenotypic analysis of lax mutant..jpg

2014-05-12T07:34:29Z

Lixiaoman13: uploaded a new version of "File:Phenotypic analysis of lax mutant..jpg"

File:Expression pattern of the LAX gene. RNA in situ hybridization of LAX (A–D, F–H, and J) and OSH1 (E, I, and K)..jpg

2014-05-12T07:33:21Z

Lixiaoman13:

Os01g0831000

2014-05-09T00:58:53Z

Lixiaoman13: /* Structured Information */

Please input one-sentence summary here.

==Annotated Information==
===Function===
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating AM at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein trafficking<ref name="ref1" />. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility<ref name="ref2" />.

===Mutation===
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX.

An insertion of a retro transposon was detected in the lax-1 allele<ref name="ref2" />.

The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele<ref name="ref2" />.

A 59-bp region was deleted in lax-3.

Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
[[File:Phenotypic analysis of lax mutant..jpg|none|400px|caption]]

===Expression===
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem<ref name="ref2" />.
[[File:Expression pattern of the LAX gene..jpg|none|500px|caption]]

===Evolution===
The LAX bHLH domain showed high sequence similarity to that of other plant bHLH proteins and bHLH proteins predicted from the rice genome sequence. Outside of the bHLH region, however, no other conserved domains were identified. A database search failed to identify cognate homologs of LAX in the Arabidopsis genome, suggesting a possibility that LAX represents a grass-specific regulator of shoot branching<ref name="ref2" />.
[[File:Comparison of the bHLH domain of LAX and the most closely related gene of.jpg|none|400px|caption]]

===Knowledge Extension===
By map-based cloning, LAX2 was isolated fromthe lax2 (LAX PANICLE 2)mutant, which has a similar phenotype to lax1 in that it lacks an AM in most of the lateral branches of the panicle, and has a reduced number of AMs at the vegetative stage. LAX2 encodes a nuclear protein that physically interacts with LAX1, suggesting that the two LAXs may act together in regulating rice AM formation process<ref name="ref3" />.

==Labs working on this gene==
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan

2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan

3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan

4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan

5.Crop Development Division, National Agriculture and Food Research Organization Agricultural Research Center, Niigata 943-0193, Japan

6.National Center for Plant Gene Research, Key Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, People’s Republic of China

7.Department of Biological Mechanisms and Functions, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan

8.Photosynthesis and Photobiology Research Unit, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan

9.State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, People’s Republic of China

10.Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachi-ohmiya 319-2293, Japan

11.Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan

12.Rice Research Division, National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba 305-8518, Japan

13.Department of Agricultural and Environmental biology, Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113-8657, Japan

14.Precursory Research for Embryonic Science and Technology, Japan Science and Technology Agency, Kawaguchi 332-0012, Japan

==References==
<references>
<ref name="ref1">Oikawa, T. and J. Kyozuka (2009). "Two-Step Regulation of LAX PANICLE1 Protein Accumulation in Axillary Meristem Formation in Rice." Plant Cell 21(4): 1095-1108.</ref>
<ref name="ref2">Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.</ref>
<ref name="ref3">Tabuchi, H., et al. (2011). "LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems." Plant Cell 23(9): 3276-3287.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0831000|
Description = Transcription factor LAX PANICLE, a basic helix-loop-helix (bHLH) transcription factor|
Version = NM_001051234.1 GI:115440838 GeneID:4327431|
Length = 1078 bp|
Definition = Oryza sativa Japonica Group Os01g0831000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:37313995..37315072|
CDS = 37314110..37314757|
GCID = <gbrowseImage1>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq>|
AA = <aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq>|
DNA = <dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051234.1 RefSeq:Os01g0831000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0831000

2014-05-09T00:53:50Z

Lixiaoman13: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating AM at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein trafficking<ref name="ref1" />. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility<ref name="ref2" />.

===Mutation===
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX.

An insertion of a retro transposon was detected in the lax-1 allele<ref name="ref2" />.

The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele<ref name="ref2" />.

A 59-bp region was deleted in lax-3.

Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
[[File:Phenotypic analysis of lax mutant..jpg|none|400px|caption]]

===Expression===
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem<ref name="ref2" />.
[[File:Expression pattern of the LAX gene..jpg|none|500px|caption]]

===Evolution===
The LAX bHLH domain showed high sequence similarity to that of other plant bHLH proteins and bHLH proteins predicted from the rice genome sequence. Outside of the bHLH region, however, no other conserved domains were identified. A database search failed to identify cognate homologs of LAX in the Arabidopsis genome, suggesting a possibility that LAX represents a grass-specific regulator of shoot branching<ref name="ref2" />.
[[File:Comparison of the bHLH domain of LAX and the most closely related gene of.jpg|none|400px|caption]]

===Knowledge Extension===
By map-based cloning, LAX2 was isolated fromthe lax2 (LAX PANICLE 2)mutant, which has a similar phenotype to lax1 in that it lacks an AM in most of the lateral branches of the panicle, and has a reduced number of AMs at the vegetative stage. LAX2 encodes a nuclear protein that physically interacts with LAX1, suggesting that the two LAXs may act together in regulating rice AM formation process<ref name="ref3" />.

==Labs working on this gene==
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan

2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan

3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan

4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan

5.Crop Development Division, National Agriculture and Food Research Organization Agricultural Research Center, Niigata 943-0193, Japan

6.National Center for Plant Gene Research, Key Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, People’s Republic of China

7.Department of Biological Mechanisms and Functions, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan

8.Photosynthesis and Photobiology Research Unit, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan

9.State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, People’s Republic of China

10.Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachi-ohmiya 319-2293, Japan

11.Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan

12.Rice Research Division, National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba 305-8518, Japan

13.Department of Agricultural and Environmental biology, Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113-8657, Japan

14.Precursory Research for Embryonic Science and Technology, Japan Science and Technology Agency, Kawaguchi 332-0012, Japan

==References==
<references>
<ref name="ref1">Oikawa, T. and J. Kyozuka (2009). "Two-Step Regulation of LAX PANICLE1 Protein Accumulation in Axillary Meristem Formation in Rice." Plant Cell 21(4): 1095-1108.</ref>
<ref name="ref2">Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.</ref>
<ref name="ref3">Tabuchi, H., et al. (2011). "LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems." Plant Cell 23(9): 3276-3287.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0831000|
Description = Transcription factor LAX PANICLE|
Version = NM_001051234.1 GI:115440838 GeneID:4327431|
Length = 1078 bp|
Definition = Oryza sativa Japonica Group Os01g0831000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:37313995..37315072|
CDS = 37314110..37314757|
GCID = <gbrowseImage1>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq>|
AA = <aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq>|
DNA = <dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051234.1 RefSeq:Os01g0831000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0831000

2014-05-08T14:03:13Z

Lixiaoman13: /* Labs working on this gene */

Please input one-sentence summary here.

==Annotated Information==
===Function===
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating AM at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein trafficking<ref name="ref1" />. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility.

===Mutation===
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX.

An insertion of a retro transposon was detected in the lax-1 allele<ref name="ref2" />.

The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele<ref name="ref2" />.

A 59-bp region was deleted in lax-3.

Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
[[File:Phenotypic analysis of lax mutant..jpg|none|400px|caption]]

===Expression===
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem<ref name="ref2" />.
[[File:Expression pattern of the LAX gene..jpg|none|500px|caption]]

===Evolution===
The LAX bHLH domain showed high sequence similarity to that of other plant bHLH proteins and bHLH proteins predicted from the rice genome sequence. Outside of the bHLH region, however, no other conserved domains were identified. A database search failed to identify cognate homologs of LAX in the Arabidopsis genome, suggesting a possibility that LAX represents a grass-specific regulator of shoot branching<ref name="ref2" />.
[[File:Comparison of the bHLH domain of LAX and the most closely related gene of.jpg|none|400px|caption]]

===Knowledge Extension===
By map-based cloning, LAX2 was isolated fromthe lax2 (LAX PANICLE 2)mutant, which has a similar phenotype to lax1 in that it lacks an AM in most of the lateral branches of the panicle, and has a reduced number of AMs at the vegetative stage. LAX2 encodes a nuclear protein that physically interacts with LAX1, suggesting that the two LAXs may act together in regulating rice AM formation process<ref name="ref3" />.

==Labs working on this gene==
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan

2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan

3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan

4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan

5.Crop Development Division, National Agriculture and Food Research Organization Agricultural Research Center, Niigata 943-0193, Japan

6.National Center for Plant Gene Research, Key Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, People’s Republic of China

7.Department of Biological Mechanisms and Functions, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan

8.Photosynthesis and Photobiology Research Unit, National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan

9.State Key Laboratory of Rice Biology, China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, People’s Republic of China

10.Institute of Radiation Breeding, National Institute of Agrobiological Sciences, Hitachi-ohmiya 319-2293, Japan

11.Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan

12.Rice Research Division, National Institute of Crop Science, National Agriculture and Food Research Organization, Tsukuba 305-8518, Japan

13.Department of Agricultural and Environmental biology, Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo 113-8657, Japan

14.Precursory Research for Embryonic Science and Technology, Japan Science and Technology Agency, Kawaguchi 332-0012, Japan

==References==
<references>
<ref name="ref1">Oikawa, T. and J. Kyozuka (2009). "Two-Step Regulation of LAX PANICLE1 Protein Accumulation in Axillary Meristem Formation in Rice." Plant Cell 21(4): 1095-1108.</ref>
<ref name="ref2">Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.</ref>
<ref name="ref3">Tabuchi, H., et al. (2011). "LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems." Plant Cell 23(9): 3276-3287.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0831000|
Description = Transcription factor LAX PANICLE|
Version = NM_001051234.1 GI:115440838 GeneID:4327431|
Length = 1078 bp|
Definition = Oryza sativa Japonica Group Os01g0831000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:37313995..37315072|
CDS = 37314110..37314757|
GCID = <gbrowseImage1>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq>|
AA = <aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq>|
DNA = <dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051234.1 RefSeq:Os01g0831000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:Lesions in lax alleles..jpg

2014-05-08T13:51:42Z

Lixiaoman13:

Os01g0831000

2014-05-08T13:50:16Z

Lixiaoman13: /* Evolution */

Please input one-sentence summary here.

==Annotated Information==
===Function===
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant, and/or maintenance during rice reproductive development, and functions redundantly with SPA (SMALL PANICLE) in the same genetic pathway. LAX may transiently accumulate in the initiating AM at the plastochron 4 stage, which strictly regulates mRNA expression and subsequent control of protein trafficking<ref name="ref1" />. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility.

===Mutation===
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX.

An insertion of a retro transposon was detected in the lax-1 allele<ref name="ref2" />.

The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele<ref name="ref2" />.

A 59-bp region was deleted in lax-3.

Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.
[[File:Phenotypic analysis of lax mutant..jpg|none|400px|caption]]

===Expression===
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem<ref name="ref2" />.
[[File:Expression pattern of the LAX gene..jpg|none|500px|caption]]

===Evolution===
The LAX bHLH domain showed high sequence similarity to that of other plant bHLH proteins and bHLH proteins predicted from the rice genome sequence. Outside of the bHLH region, however, no other conserved domains were identified. A database search failed to identify cognate homologs of LAX in the Arabidopsis genome, suggesting a possibility that LAX represents a grass-specific regulator of shoot branching<ref name="ref2" />.
[[File:Comparison of the bHLH domain of LAX and the most closely related gene of.jpg|none|400px|caption]]

===Knowledge Extension===
By map-based cloning, LAX2 was isolated fromthe lax2 (LAX PANICLE 2)mutant, which has a similar phenotype to lax1 in that it lacks an AM in most of the lateral branches of the panicle, and has a reduced number of AMs at the vegetative stage. LAX2 encodes a nuclear protein that physically interacts with LAX1, suggesting that the two LAXs may act together in regulating rice AM formation process<ref name="ref3" />.

==Labs working on this gene==
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan

2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan

3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan

4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan

==References==
<references>
<ref name="ref1">Oikawa, T. and J. Kyozuka (2009). "Two-Step Regulation of LAX PANICLE1 Protein Accumulation in Axillary Meristem Formation in Rice." Plant Cell 21(4): 1095-1108.</ref>
<ref name="ref2">Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.</ref>
<ref name="ref3">Tabuchi, H., et al. (2011). "LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems." Plant Cell 23(9): 3276-3287.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0831000|
Description = Transcription factor LAX PANICLE|
Version = NM_001051234.1 GI:115440838 GeneID:4327431|
Length = 1078 bp|
Definition = Oryza sativa Japonica Group Os01g0831000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:37313995..37315072|
CDS = 37314110..37314757|
GCID = <gbrowseImage1>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq>|
AA = <aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq>|
DNA = <dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051234.1 RefSeq:Os01g0831000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Lixiaoman13: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility.

===Mutation===
In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX.

An insertion of a retro transposon was detected in the lax-1 allele(as showed in fig1).

The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele.

A 59-bp region was deleted in lax-3.

Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.

[[File:Phenotypic analysis of lax mutant..jpg|none|500px|caption]]

===Expression===
LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem(as showed in fig2).
[[File:Expression pattern of the LAX gene..jpg|none|400px|caption]]

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan

2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan

3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan

4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan

==References==
1.Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0831000|
Description = Transcription factor LAX PANICLE|
Version = NM_001051234.1 GI:115440838 GeneID:4327431|
Length = 1078 bp|
Definition = Oryza sativa Japonica Group Os01g0831000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:37313995..37315072|
CDS = 37314110..37314757|
GCID = <gbrowseImage1>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:37313995..37315072
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq>|
AA = <aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq>|
DNA = <dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051234.1 RefSeq:Os01g0831000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]