http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=LizhitaoRiceWiki - User contributions [en]2026-05-24T21:54:25ZUser contributionsMediaWiki 1.30.0https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0597200&diff=175133Os03g05972002014-05-31T13:27:05Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
The predicted ORF ofYSAencodes a 742-amino acid polypeptide with a calculated molecular mass of 82.5kD. Database searches using Pfam revealed that YSAencodes a member of the P subfamily of PPR-containing proteins. The gene product contains a tandem repeat of 15 PPR motifs with varying degrees of conservation. The second to 15th repeats are contiguous, and the sequence is not well conserved (Fig. 4B). The PPR motif is a degenerate 35-amino acid repeat often arranged in tandem arrays of two to 27 repeats per polypeptide. Thus YSA is a new member of the superfamily of PPR proteins.<br />
===Function===<br />
YSA is required for chloroplast development in early seedling leaves, and disruption of its function causes a seedling stage-specific albino phenotype, but the plant recovers and develops normal green leaves from the four-leaf stage onward.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage.(Su N, Hu ML, Wu DX, et al.2012) <br />
Functional studies of PPR proteins in higher plants remain very sparse. Accumulating data point to an involvement in posttranscriptional processes in organelles. Additional evidence for a role of PPR proteins in regulating organelle gene expression has also come from positional cloning of several cytoplasmic male sterility (CMS) restorer genes from petunia (Petunia hybrida; Bentolila et al., 2002) and radish (Raphanus sativus; Brown et al., 2003; Desloire et al., 2003; Koizuka et al., 2003). Genetic and biochemical data, and structural modeling of PPR tracts based on established tetratricopeptide repeat proteins together suggest that PPR proteins typically bind directly to specific organellar RNA sequences through a surface created by the stacked helical repeating units. However, still very little is known about the functions, substrates, and regulatory mechanisms for the vast majority of PPR proteins.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage. Further investigation showed that the change in leaf color in ysa mutant is associated with changes in chlorophyll content and chloroplast development. The albino phenotype of the young ysaseedlings is caused by a reduction in total chlorophyll content, rather than reduction of a particular pigment.<br />
<br />
<br />
===Expression===<br />
<br />
Tissue localization<br />
Molecular analysis of an F2 population from the cross Taiziyuzhu3ysaplaced the YSAlocus between the markers RM411 and RM8208 on chromosome 3 . The YSAlocus was further narrowed down to a 45-kb region, which includes 10 putative open reading frames(ORFs; Fig. 3, B–D). We sequenced all ORFs and found a 5-bp deletion in Os03g40020, causing a premature stop codon. that the 5-bp deletion in Os03g40020 is responsible for the albino phenotype of ysa mutant. light plays a major role in regulatingYSAexpression.YSA is highly expressed in young leaves and stems, but not in the roots (Fig. 1, A–D). Quantitative real-time reverse transcription (RT)-PCR analysis revealed that the expression of YSA peaked in the fourth leaf (Fig. 2E). Thus, the expression pattern of YSA is consistent with the seedling-stage-specific albino phenotype of ysa mutant and further supports the notion that YSA plays an important role in chloroplast development in the first few leaves of rice seedlings, but plays more minor roles in later stages.<br />
<br />
[[File:picture1.jpg]]<br />
<br />
<br />
Figure 1. Phenotypic analysis of the ysa mutant plants. A to C, Phenotypes of Pei'ai64S (left) and ysa mutant (right) seedlings at 1 (A), 2 (B), and 3 (C) weeks after sowing. D, The pigment contents in leaves of 1-week-old ysa mutants are much lower than that in Pei'ai64S. E, The pigment contents in leaves of 6-week-old ysa mutants are similar to that of Pei'ai64S plants. Chla, Chlorophyll a; Chlb, chlorophyll b; Chl, total chlorophyll; Car, carotenoid. Bars represent sds of three measurements. Student’s t test was performed on the raw data; asterisk indicates statistical significance at P < 0.01. <br />
<br />
Subcellular Localization of YSA Protein<br />
<br />
The YSA protein is predicted to localize to chloroplasts by ChloroP (Emanuelsson et al., 1999) and TargetP (Emanuelsson et al., 2000). To investigate the actual cellular localization of YSA, we constructed the green fluorescent signals of YSA-GFP fusion proteins colocalized with the autofluorescent signals of chlorophylls in the chloroplasts, consistent with the results obtained for GFP fused to the transit peptide of the small subunit of Arabidopsis ribulose bisphosphate carboxylase (Fig. 2, A and B). When GFP fused to the nuclear localization signal of the fibrillarin protein, GFP signals located specifically in the nucleus of Arabidopsis protoplasts (Fig. 2C). In addition, the protoplasts transformed with the empty GFP vector without a specific targeting sequence had green fluorescent signals in both the cytoplasm and the nucleus (Fig.2, D and E). To further confirm the subcellular localization of YSA protein, we transformed the plasmid containing the YSA-GFP fusion constructs into rice protoplasts. Confocal microscopy observations revealed that GFP-YSA was exclusively detected in the chloroplasts (Fig. 2F). These findings suggest that YSA protein is localized to the chloroplast.<br />
<br />
[[File:picture2.jpg]]<br />
<br />
<br />
Figure 2. Subcellular localization of YSA protein. Fluorescence signals were visualized using confocal laser-scanning microscopy. Green fluorescence shows GFP, red fluorescence indicates chloroplast autofluorescence, and yellow fluorescence indicates images with the two types of fluorescence merged. A, GFP signals of the YSA-GFP fusion protein. B, GFP signals from the transit peptide of ribulose bisphosphate carboxylase small subunit (control). C, GFP signals from the nuclear localization signal of fibrillarin (control). D, Empty GFP vector without a specific targeting sequence. E, Untransformed chloroplasts. F,Subcellular localization of YSA protein in rice protoplasts. Bars = 5mm. A to E are Arabidopsis protoplasts and F is rice protoplasts.<br />
<br />
===Evolution===<br />
<br />
Homology with Arabidopsis Similar to At3g53700: MEE40 (maternal effect embryo arrest 40) (HF=7e-1)<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
*National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, People’s Republic of China (N.S., F.-Q.W., G.-L.F., Y.L., X.-L.C.,X.Z., X.-P.G., Z.-J.C., C.-L.L., H.W., J.-M.W.);<br />
*National Key Laboratory for Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, People’s Republic of China (M.-L.H., L.J., J.-M.W.);<br />
*Institute of Industrial Crops, Jiangsu Academy of Agricultural Sciences, Nanjing 210014, People’s Republic of China (M.-L.H., C.-K.Q.);<br />
*State Key Laboratory of Rice Biology, International Atomic Energy Agency Collaborating Center, Institute of Nuclear Agricultural Sciences, Zhejiang University, Hangzhou 310029,People’s Republic of China (D.-X.W., X.-L.S.)<br />
<br />
==References==<br />
<br />
[1] Bentolila S, Alfonso AA, Hanson MR (2002) A pentatricopeptide repeat-containing gene restores fertility to cytoplasmic male-sterile plants. Proc Natl Acad Sci USA 99: 10887–10892<br />
<br />
[2] Brown GG, Formanová N, Jin H, Wargachuk R, Dendy C, Patil P, Laforest M, Zhang J, Cheung WY, Landry BS (2003) The radish Rfo restorer gene of Ogura cytoplasmic male sterility encodes a protein with multiple pentatricopeptide repeats. Plant J 35: 262–272<br />
<br />
[3] Desloire S, Gherbi H, Laloui W, Marhadour S, Clouet V, Cattolico L, Falentin C, Giancola S, Renard M, Budar F, et al. (2003) Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family. EMBO Rep 4: 588–594<br />
<br />
[4] Koizuka N, Imai R, Fujimoto H, Hayakawa T, Kimura Y, Kohno-Murase J, Sakai T, Kawasaki S, Imamura J (2003) Genetic characterization of a pentatricopeptide repeat protein gene, orf687, that restores fertility in the cytoplasmic male-sterile Kosena radish. Plant J 34: 407–415<br />
<br />
[5] Emanuelsson O, Nielsen H, von Heijne G (1999) ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Sci 8: 978–984 <br />
<br />
[6] Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of proteins based on their N-terminal amino acid sequence. J Mol Biol 300: 1005–1016<br />
<br />
[7] Su N, Hu ML, Wu DX, et al.(2012) Disruption of a rice pentatricopeptide repeat protein causes a seedling-specific albino phenotype and its utilization to enhance seed purity in hybrid rice production［J］.Plant Physiology, 159（1）：227-238.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0597200|<br />
Description = Protein prenyltransferase domain containing protein|<br />
Version = NM_001057140.1 GI:115454008 GeneID:4333379|<br />
Length = 5627 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0597200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:22993430..22999056|<br />
CDS = 22996530..22998758|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatga</cdnaseq>|<br />
AA = <aaseq>MPRVCAAPRAPPPPCPCHVGVGPLRPRWRASRHGPLRAAGQEQL LTALREQPDPDAALRMLNAALARDDFAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRR EGHQVKLGVVHSFLDSYEGQQLFDDAVDLILNQLQPLFGIQADTVVYNHLLNVLVEGS KMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETT FTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQ EIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKN GQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVY TFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLK DMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCK DKKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDV VTYGTLINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLF REMAEVGEPPDALTYKIVFRGLCRGGGPIKEAFDFMLEMVDKGFIPEFSSFRMLAEGL LNLGMDDYFIRAIEIIMEKVDLRESDVSAIRGYLKIRKFYDALATFGRFLEINNPQWS YR</aaseq>|<br />
DNA = <dnaseqindica>299..2527#ctcctgttcccctctgcctgccttcacggagaacacgccgccgcacgcccgcaaagttgtcgctccgccgccgggtcctgcggccacttcctccctctccctgtgcatgcgctctcttccccacctgtactttactttagctgctcctctgcccagttgcccacgacctgacgacccggacatggcgcaggctgaggcggggacgacgacatcgccggcgggttgacgcagaaaggagcgaccacccgagggctccgctggattttcaggtagctgagctgagctgaactgaaccccaatgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatgaagcagaatacataactgggacaaattacttgaatagtattagggaaatctcaaagagtggatggaatttttgctggttgcttaggggaatgaaagtcttaaattgattataataggtgattgtgttcattcctcggtagggatgaagtcagagcatgaagaagctcatcttggtgcagaaacttagcttattggaacagaatctaggtgctaggtgctgtctgctgccagattagtacctagcgccttaacgaacagtggctgcagatcccatccgcttattttgatcaaatctgattcattttctattccctaataaaagcctgattcatcttcattgcatatggtcgaacctaaggctatcatgtacagttagatcccaacccttcgttctatgagatgttgtcccatagaagaaatatcttctgagtatatcctagtactctaaaatgttcactaatatgttcaacttaattagttttgtaacctcctaaaatagttctattagttttgtaaccttctaaaatatgaattagttttgatctggctgatcttcctttggttaggtactacaaattcttaattcagacacatatttggttttctgaaaatttcatctatatttggtcaggctggcatttgaagttcttattttagtcatatactttagttttttacaattttcatttgttaaagatgataatttatttgttagcacagagcatgtttagaaatctgaaatattaaaacatgcatgttctcatgaaaataaatgttagttttgtttaaattccaatccacatattttttaatcaatgtcagaaattaccatgcttcacttattgacctagtatatgtatagtatttgatggatcatgttgatttggatttgctctactaacttgttcctattccaacaaagatttatatgcatcttgtgttctaaaaatgctacatgtgtcaagttgaaggaaaattctagctatgtggtgtcctaattttggtagatggtacctagtaatagataacaattctgttttatagtgatgagtaaatttgactaaatcgagtctagaaagtgatataattttctggagaagtctttcttggtgatttgggaaagggccattacctatactgatatgaaatctggaactagaaagatctgaacatcaatgttctaaagttttttgtctgaatttcttgtgcagaatatgaaggaaggtggatctggaataggtatttacatgtcctgttcagattcctgcaatctgataaactactgcaatccaataaactcttgatctattgttttctggatttttttttgggtgtagagtattaggaaggtatttgctttgttacaggggttggttggatgttcagaaaaccaaaatctgaatacactaacacattagccagtgttttattttagtttatgttattctgaccacaacaccagcagcttcaattggtagtagaacacactctgatgcaattggtaggtgtacaacagataatttgccgtgaatgctacttaattcaaccattttttttccatacagtgctatacaatggcacacaaacatccttcagttggactcaaatttgtttcagctttgctattttacagtcacctgcagttttttctaatccatcagtcgattttgttggcagtagattctgcttcaagatctgtgcacgcagtggaggcacatttggttacaggctgcttcaccagacccgttaacccatgggccatggatgctcccctagtagcatatgttgttttttccaccaactgcctcttgtaaatcaagatgctcccctctccacatttgctgcagacttcctccccgtggatctgagacgaactccggcgaccggcggcgtctacgagccagcgttcaccaatttctcaggtatatgagtcgtcatctatgtgcatctgctactttttttttttggctgattggacgggttgagaaggaggtgtttggggggaagagagcagaataatcccattgcgaaacaagcgaggaaggcttgtcgatggtggcggcggtggccttgattatcgaagatgcatgcgtgagggaaactgtgtgccagggaggcaagcttggtggcacacatcgagtggtatatcttcaggttactgctagatcgaagatcctttggtgcttgatgtgtgctgttggtttggtagttttggtggtactgtggcaagtgaagacacgaaagaggagctagtagaggcttagagtctggagtcgtaatcgatgtgcaagagcatcaatgccatcagttcctctgggcagcacggctctgcacttttcatctgagaaacatatatattttgttgattctgattttgacgaattatccaaacatgcagtttttttgggttccgcgtgcaaagacgattttgatctcctggcagatttaagggtggtgattttgtttttgttttgcatgtagatgatgcattttgtaaatcattttaggttgccccttttttttttgtttttgcgagttcttactgaatttggataagttctggttgattggatcgacattctgtacatttgcaaggggattctatgggtttttgcttattgctaatcaaattattttgtgagttttggtttattggatggtgagaaagcaagattacatggattttgcttcattgctgattttgtcgaaatttatcaggcatgcggtttttggtttcttgaatacgaactacacggacagtactcctatattcttggtgattttgaagtgtatttgttattttggggaggtggaatggttaatattttgttcaaggggacacttctacagatgtatacattacttttgtcattttcagcataacaaagagatttggtagattcagaattcagatggcaactacacgtcgaatgatgtatgcgaagacatggggaattctgatgctgattccactgaagaaagctaaacataattttaatttatttaccaactcatttttctgtcaacacatttgctagatagttgctacccgataaacgacatcttgaaatctgagttatacttcagtctattttttttcc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057140.1 RefSeq:Os03g0597200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=175132Os12g01016002014-05-31T13:22:34Z<p>Lizhitao: /* References */</p>
<hr />
<div><br />
==Annotated Information==<br />
narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was<br />
remarkably reduced to almost a half of wild-type. The number of SVs between LVs was quite irregular in each leaf blade, and the vein distribution on the left and right side of the midrib was different. Sawtooth hairs at the leaf margins were significantly reduced (Fig. 1d). Ligule, auricle, leaf sheath and stems were also<br />
narrower and thinner (Fig. 1e,f; Table S2). Despite the reduction in leaf width, the lengths of leaf blades and leaf sheaths, and plant height were similar to wild-type (Table S2). These results indicate that NAL2/3function is mainly associated with vein patterning during leaf development and lateral-axis expansion during shoot organogenesis<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
<br />
=== Knowledge Extension ===<br />
map-based cloning to identifyNAL2and NAL3on chromosomes 11 and 12, respectively. They encode an identical OsWOX3A/OsNS protein that is homologous to NS of<br />
maize and PRS of Arabidopsis, all of which belong to the same WOX3subfamily (Figs S5b, S6; Zhang et al., 2007). Both NS andPRSplay an important role in the recruitment of founder cells for margin development of lateral organ primordia in monocots and eudicots, respectively (Nardmann et al., 2004). However, the functions ofNS/PRShomologues in other plant species remain unknown. Our histological and molecular studies show that in rice, OsWOX3Ais involved in differentiation of lemma and palea in spikelets, and tiller and LR production, in addition to lateral-axis expansion in leaves.<br />
Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions. <br />
== Labs working on this gene ==<br />
*Department of Plant Science, Plant Genomics and Breeding Institute, Research Institute for Agriculture and Life Sciences, Seoul National University, Seoul, 151-921, Korea;Department of Molecular Biotechnology, Dong-A University, Busan, 604-714, Korea<br />
<br />
== References ==<br />
* Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek.The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development New Phytologist, 2013, 198(4): 1071-1084<br />
*Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28. <br />
*Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149<br />
*Dai M, Hu Y, Zhao Y, Liu H, Zhou DX. 2007.AWUSCHEL-LIKE HOMEOBOXgene represses aYABBYgene expression required for rice leaf development.Plant Physiology144: 380–390<br />
*Zhang X, Madi S, Borsuk L, Nettleton D, Elshire RJ, Buckner B, JanickBuckner D, Beck J, Timmermans M, Schnable PSet al.2007.Laser microdissection of narrow sheath mutant maize uncovers novel gene expression in the shoot apical meristem.PLoS Genetics3: 1040–1052.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=175131Os12g01016002014-05-31T13:21:01Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div><br />
==Annotated Information==<br />
narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was<br />
remarkably reduced to almost a half of wild-type. The number of SVs between LVs was quite irregular in each leaf blade, and the vein distribution on the left and right side of the midrib was different. Sawtooth hairs at the leaf margins were significantly reduced (Fig. 1d). Ligule, auricle, leaf sheath and stems were also<br />
narrower and thinner (Fig. 1e,f; Table S2). Despite the reduction in leaf width, the lengths of leaf blades and leaf sheaths, and plant height were similar to wild-type (Table S2). These results indicate that NAL2/3function is mainly associated with vein patterning during leaf development and lateral-axis expansion during shoot organogenesis<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
<br />
=== Knowledge Extension ===<br />
map-based cloning to identifyNAL2and NAL3on chromosomes 11 and 12, respectively. They encode an identical OsWOX3A/OsNS protein that is homologous to NS of<br />
maize and PRS of Arabidopsis, all of which belong to the same WOX3subfamily (Figs S5b, S6; Zhang et al., 2007). Both NS andPRSplay an important role in the recruitment of founder cells for margin development of lateral organ primordia in monocots and eudicots, respectively (Nardmann et al., 2004). However, the functions ofNS/PRShomologues in other plant species remain unknown. Our histological and molecular studies show that in rice, OsWOX3Ais involved in differentiation of lemma and palea in spikelets, and tiller and LR production, in addition to lateral-axis expansion in leaves.<br />
Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions. <br />
== Labs working on this gene ==<br />
*Department of Plant Science, Plant Genomics and Breeding Institute, Research Institute for Agriculture and Life Sciences, Seoul National University, Seoul, 151-921, Korea;Department of Molecular Biotechnology, Dong-A University, Busan, 604-714, Korea<br />
<br />
== References ==<br />
. Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek<br />
The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development<br />
New Phytologist, 2013, 198(4): 1071-1084<br />
.Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28. <br />
.Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149<br />
. Dai M, Hu Y, Zhao Y, Liu H, Zhou DX. 2007.AWUSCHEL-LIKE HOMEOBOXgene represses aYABBYgene expression required for rice leaf development.Plant Physiology144: 380–390<br />
.Zhang X, Madi S, Borsuk L, Nettleton D, Elshire RJ, Buckner B, JanickBuckner D, Beck J, Timmermans M, Schnable PSet al.2007.Laser microdissection of narrow sheath mutant maize uncovers novel gene expression in the shoot apical meristem.PLoS Genetics3: 1040–1052.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0512200&diff=175128Os07g05122002014-05-31T13:17:07Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
<br />
An essential protein in the yeast or Arabidopsis autophagic pathway is Atg8. OsAtg8 conjugation pathway may be conserved in rice and may play important roles in rice autophagy.[1]<br />
<br />
Autophagy occurs at low basal levels in virtually all cells to perform homeostatic functions such as protein and organelle turnover. It is rapidly upregulated when cells need to generate intracellular nutrients and energy, for example, during starvation or high bioenergetic demands. Autophagy is also upregulated when cells are preparing to undergo structural remodeling such as during developmental transitions or to rid themselves of damaging cytoplasmic components, for example, during oxidative stress, infection, or protein aggregate accumulation. Nutritional status, hormonal factors, and other cues like temperature, oxygen concentrations, and cell density are important in the control of autophagy. [2]<br />
<br />
===Expression===<br />
<br />
<br />
OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]<br />
<br />
===Evolution===<br />
The formation of the autophagosome is carried out by a set of autophagy-related proteins (Atg), highly conserved from yeast to mammals. The Atg8s play an essential role in autophagosome biogenesis. This family of proteins comprises a single member in yeast and several mammalian homologues.[3]<br />
<br />
A recent genome-wide search revealed significant conservation among autophagy genes (Atgs) in yeast and Arabidopsis, indicating that the molecular basis of autophagy is well conserved in yeast and plants. In Arabidopsis, 25 Atg genes that are homologous to 12 of yeast Atg genes were found [4]. Among them, AtAtg7 and AtAtg9 have been shown to be involved in Arabidopsis autophagy [5], AtAtg8 and AtAtg4 are essential for Arabidopsis autophagy [6].<br />
<br />
==Labs working on this gene==<br />
Wei Su, Haijie Ma, Chao Liu, Jiaxu Wu<br />
Institute of Genetics, State Key Laboratory of Genetic<br />
Engineering, School of Life Sciences, Fudan University, 220<br />
Handan Road, Shanghai 200433, China<br />
<br />
==References==<br />
[1]Wei Su ,Haijie Ma ,etc.(2006)Identification and characterization of two rice autophagy associated genes, OsAtg8 and OsAtg4.Mol Biol Rep (2006) 33:273–278<br />
<br />
[2]Beth Levine and Guido Kroemer.(2008)Autophagy in the Pathogenesis of Disease.Cell 132, January 11, 2008<br />
<br />
[3]Slobodkin MR1, Elazar Z.(2013)The Atg8 family: multifunctional ubiquitin-like key regulators of autophagy.Essays Biochem. 2013;55:51-64.<br />
<br />
[4]Hanaoka H, Noda T, Shirano Y, Kato T, Hayashi H, Shibata D, Tabata S, Ohsumi Y (2002) Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene. Plant Physiol 129:1181–1193<br />
<br />
[5]Doelling JH, Walker JM, Friedman EM, Thompson AR, Vierstra RD (2002) The APG8/12-activating enzyme APG7 is required for proper nutrient recycling and senescence in Arabidopsis thaliana. J Biol Chem 277:33105–33114<br />
<br />
[6]Yoshimoto K, Hanaoka H, Sato S, Kato T, Tabata S, Noda T, Ohsumi Y (2004) Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for<br />
plant autophagy. Plant Cell 16:2967–2983<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os07g0512200|<br />
Description = Similar to Symbiosis-related like protein|<br />
Version = NM_001066302.1 GI:115472336 GeneID:4343365|<br />
Length = 2701 bp|<br />
Definition = Oryza sativa Japonica Group Os07g0512200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|<br />
AP = Chromosome 7:20285683..20288383|<br />
CDS = 20286147..20286241,20286327..20286445,20286846..20286898,20286988..20287043,20288034..20288070<br>|<br />
GCID = <gbrowseImage1><br />
name=NC_008400:20285683..20288383<br />
source=RiceChromosome07<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008400:20285683..20288383<br />
source=RiceChromosome07<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggccaggacttccttcaagctcgagcacccactggaaaggaggcaagcagaatctgccaggatccgtgagaagtactcagacagaattccggtgatcgttgagaaggctgacaagaccgatgttccagaaattgacaaaaagaagtaccttgtccctgctgatcttactgttggccagtttgtctatgtggttcggaagaggattaagcttagcccagaaaaggccatctttgtctttgtgaagaacacattgccgccaactgcttctttgatgtctgcaatctacgaagagaacaaggatgaggacggcttcctctacatgacttacagtggcgagaacacattcggctctgcgtaa</cdnaseq>|<br />
AA = <aaseq>MARTSFKLEHPLERRQAESARIREKYSDRIPVIVEKADKTDVPE IDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDE DGFLYMTYSGENTFGSA</aaseq>|<br />
DNA = <dnaseqindica>2143..2237#1939..2057#1486..1538#1341..1396#314..350#aaaccctaccgcgacttccttccttccttccggttgcttccgccgatcgacttctcgccccccaaatcgattcgccccccgcctcgatctatcgattccgcggcagcgccccttcgatcggtgagcctctcgtctcgatcccccaacggagccggccgaattcgcgaggattcgggaggttttccctctgcgttcgtttctgcggatgatttgttttttttttcttttggtggatcggtttgatcgaggggagacgttgaccttgggggtttgtttctgatgatcgattgatgatttgattcgcaggttggagatggccaggacttccttcaagctcgagcacccactgggtttgttgcttcttctctctcgccccattacctctttgccctgtcaatttgttgcgattaggttgcaatctgtgattcgatcgatggtgtggtggtagattgattgcgagtttgtagatgggcgttttataatcggaactagctttgcgtttttgtgtggtatatgatgatctgattgtagattatatatgagtactacttttgtggagactgccttgtgtgtgggattgttttgtcgggcgttgtgtttgttgttggagtatgatttggcccacccaaggattgattttttcttttggttgcgtgtgttgcatattggtcttgagctgttttttagttgcagaagaggactctgtagtttacggtcgcttgtttccagaacaaaagtttaaactctgggatacttgttttattcccagttgcaaaagggtttttcatcatattcggactaacacaatgcttattgtatagatttttgtcggtagttctattactcgtaacacaatgcttattcttcggtagttccattactcgtggcagataacatcaaatgtccaattaagcaaacatatttgttcttgttgatctagtctgttttatgattgaattgtgttcaatgcgcattgttgtttcaataataaactgtttcatgtattgaacttgtttacttcagtcttcaatatatcatgattctcttgattagcagtaccctgtttactggtggttggaacatgctgtactttgtatttatttgattgagccttgaacatatttgctaatctaagaaaagctagcttgtacaagaggttgagatgatattttttcttctatttatctgctttacacttagcacagattacccctaattccattagtgtagcagaaccaactgtgaaaagaaaaaaaaaacattcccgactatgtttatgtcaaccacatgtaatttgcatatagcatcttatgatgtttgtattttgaatgatattgcagaaaggaggcaagcagaatctgccaggatccgtgagaagtactcagacagaattccggtaatatatctctgctgtttactttttcgtttgtgcatatctcctatatgcatctgtcttatcaaaaattctgcgatatgctatttcaggtgatcgttgagaaggctgacaagaccgatgttccagaaattgacaaaaagaagtaagctttcttttccacatctcctttattatgacgggagatgttctatctcatggttgcttatatcagctactaaagctttttttttatgtatgagagggcttccatttttcctctcctttttaacacctgctttagttggaggaagataaaataggagcaacttttctttcacattgggttctatctaactcaatcaggcctaatttcgctttagatgtcctgtattctctggaatttggcttgctatgttctatttgtttggttagtacttagtactctttatttatgttgcttattgacttagaatacccaggcatctgctattaattgaattgaaatcctgaaatattaaccttctcttggatacacacatctttgttttttttttctgatgtaggtaccttgtccctgctgatcttactgttggccagtttgtctatgtggttcggaagaggattaagcttagcccagaaaaggccatctttgtctttgtgaagaacacattgccgccaactggtaaattcattgttcttgatttgtcattgtcatatcacctacccttttggtttccttatattttgcgcatacattctattggcagcttctttgatgtctgcaatctacgaagagaacaaggatgaggacggcttcctctacatgacttacagtggcgagaacacattcggctctgcgtaattcatcaactgttgctgctgctgtaaataaacatggatggccaggtgtcatggtcaacctcctgtgtacatagcatgtccctgtgctggattgcctcaatggtctaatgcgtccttagctttttaagtggttcgtatgctatcgtttgaaagttggaacgacccatagaactgatattattcattctgggttgatgacgtttcttattctaccattatgcatttgcaacgtgttttaagtctgaagtgtgattgggcgtttcaatttcagttatctgttatcattgttaattgcaactgattcaggccaataagaaatcaaggccttcttaatcgtcatatctcgcatggttgcacgcatgattgttttttttttttggtagttgttgttgatgttggagactgcaccgtgttttcttctcgtctcattccatcagttattttcattttatcaatttggtgttt</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066302.1 RefSeq:Os07g0512200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 7]]<br />
[[Category:Chromosome 7]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0799100&diff=175126Os02g07991002014-05-31T13:14:07Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>The ''Ossgo1''gene encodes the protein OsSGO1 which maintains synaptonemal complex stabilization in addition to protecting centromeric cohesion during rice meiosis.<br />
<br />
==Annotated Information==<br />
===Function===<br />
Os02g0799100 is the rice(''Oryza sativa'') homologue of the maize Sgo1 gene. It encodes an homolog of shugoshin protein ZmSGO1 in maize (Zea mays), named OsSGO1. The gene ''OsSGO1'' is essential for rice meiosis and plays an important role in protecting centromeric cohesion during meiosis. The knockdown of ''OsSGO1'' may cause precocious disassociation and random segregation of sister chromatids at telophaseⅠand anaphase II, respectively, which finally leads to sterile pollen formation.And the ''OsSGO1'' localizes to centromere from the result of immunostaining experiments <ref name="ref1" />. In addition to the meiosisspecific maintenance of centromeric cohesion, OsSGO1 is required for the timely assembly and maintenance of SCs during early prophase I. Furthermore, the centromeric localization of OsSGO1 depends on OsAM1 <ref name="ref2" />. OsAM1 is the homolog of Arabidopsis SWI1 and maize AM1 in rice and is required for the leptotene–zygotene transition <ref name="ref3" />. OsSGO1 is specifically required to protect centromeric cohesion during meiosis.OsSGO1 transfers from nucleoli onto centromeres at the onset of prophase in both meiosis and mitosis.The relocalization of OsSGO1 onto centromeres is OsAM1-dependent.The maintenance of SCs in prophase I is affected in ''Ossgo1'' <ref name="ref2" />.<br />
<br />
===Mutation===<br />
[[File:Figure S1.jpg|right|thumb|250px|''Schematic representation of OsSGO1 gene (from reference <ref name="ref2" />).'']]<br />
An OsSGO1-RNAi vector is transformed into rice calli by Agrobacterium-mediated DNA transfer. OsSGO1-RNAi lines isobtained by screening the plants regenerated from the transformed calli by PCR. One single ''Tos17''-insertion mutant line of the ''OsSGO1'' gene, ''Ossgo1-1'', is identified by screening the public insertion line collections. Sequence analysis of its PCR products confirmed that ''Tos17'' is inserted into exon 15, only 5 bp upstream from the stop codon(Figure S1). <ref name="ref2" /> .<br />
<br />
===Expression（Mutant VS Wild type）===<br />
[[File:FigureS2.jpg|right|thumb|250px|''Expression analysis of OsSGO1 (from reference <ref name="ref2" />).'']]<br />
[[File:FigureS3.jpg|right|thumb|250px|''Characterization of the phenotype of ''Ossgo1'' mutants (from reference <ref name="ref2" />).'']]<br />
[[File:FigureS4.jpg|right|thumb|250px|''The defective cDNA sequence from ''Ossgo1-1'' mutant (from reference <ref name="ref2" />).'']]<br />
[[File:FigureS5.jpg|right|thumb|250px|''Western blotting analysis of OsSGO1 expression (from reference <ref name="ref2" />).'']]<br />
<br />
''OsSGO1'' is expressed most highly in the roots, secondly in the panicles, and at a relatively low level in leaves(Figure S3)<ref name="ref2" />. <br />
The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophase Ⅰand anaphase II, respectively, which finally leads to sterile pollen formation<ref name="ref1" />. The homozygous ''Ossgo1-1'' mutant grows normally in the vegetative stage but is sterile during the flowering phase, and its pollen is completely non-viable when evaluated by 1% I2-KI solution staining (Figure S4). The transcription level of OsSGO1 is slightly decreased in the ''Ossgo1-1'' mutant (Figure S3). Additionally, by performing RT-PCR, it is found that the ''Ossgo1-1'' cDNA sequence is altered downstream of the ''Tos17''-insertion position by the addition of 71 nucleotides, and the whole cDNA lacks a stop codon (Figure S5). Additionally, an allelic mutant of ''Ossgo1-1'' with a deletion of 15 bp (nucleotides 1773–1787 in the gene) from the mutants induced by 60 Co~γ-ray radiation is identified and is named as ''Ossgo1-2'' (Figure S1), which results in five amino acids missing in OsSGO1. The homozygous ''Ossgo1-2'' mutant is also normal in the vegetative stage but completely sterile (Figure S4). Neither of the mutants set seeds when pollinated with pollen from the wild-type plants. Additionally, through immunoblotting, it is found that the expression level of OsSGO1 protein is indeed down-regulated in Ossgo1-1 and OsSGO1RNAi plants (Figure S5) <ref name="ref2" />.<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="3"|Gene amplication<br />
| | 5'-CGAAACCTCATCGGATTCCT-3'<br />
| | 5'-GCCAATGGTGTTTGTGCTCT-3' (used to amplify the predicted coding regions of ''OsSGO1'' <ref name="ref2" />)<br />
|-<br />
| | 5'-ATTGTTAGGTTGCAAGTTAGTTAAGA'<br />
| | 5'-GCCTCGAACAAAGAGGACTG-3' (used to amplify the ''Tos17'' inserted regions of ''ossgo1'' <ref name="ref2" />)<br />
|-<br />
| | 5'-GTGAATTCCCATTGAGGATCCAGAGCCACCA-3'<br />
| | 5'-AGTCTCGAGTACCTATCACCTGCTCGTCAGA-3' (used to amplify the fragment of ''OsSGO1'' cDNA <ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5'-TCAATCAGCTGTGCCATCTT-3'<br />
| | 5'-CATCTTGCCACCACA AATCA-3' <ref name="ref2" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Figure S2.jpg|right|thumb|250px|''Alignment of OsSGO1 with ZmSGO1 in maize (from reference <ref name="ref2" />).'']]<br />
''SGO1'' gene is the first meiosis specificity expressed gene in yeast cDNA library screening conducted in Watanabe Lab, as well as to the lack of corresponding mutant phenotype analysis, identified as the homologous gene of Drosophila melanogaster Mei - S332 <ref name="ref4" /><ref name="ref5" />. Many researches of SGO function have been investigated in animals and yeast <ref name="ref6" />, while relatively few has been reported in plants. In plants, ''SGO1'' gene is first found in maize, and the mutant of premature-dissociation centromeric cohesion which locates in the centromere at the stage of anaphase Ⅰ. And the phenotype is due to the deletion of ZmSGO1 protein. ZmSGO1 is found to be located in the centromere from the eptotene stage Previous studies indicates that ZmSGO1 plays an important role in protecting of centromeric cohesion during meiosis I <ref name="ref7" />. The OsSGO1 protein sequence,which comprises 486 amino acid residues, shows a high similarity toZmSGO1(209/537 residues identical and 278/537 residues positive(Figure S2)<ref name="ref2" />.<br />
<br />
===Knowledge Extension===<br />
<br />
OsSGO1 is a shugoshin protein. Shugoshin is a conserved protein in eukaryotes that protects the centromeric cohesin of sister chromatids from cleavage by separase during meiosis [2]. Shugoshins (Japanese for ‘guardian spirit’) are the conserved proteins required to protect the cohesin adjacent to the centromeres from cleavage by separase. Drosophila Mei-S332 was the first protein in the shugoshin family to be discovered， which is necessary for chromosome precise separation [4] [8] [9]. From then, shugoshins have been identified in various organisms from yeast to humans. Saccharomyces cerevisiae and Drosophila have only one kinds of shugoshin, which is expressed in both mitosis and meiosis, while Schizosaccharomyces pombe and mammals have two (Sgo1 and Sgo2) [4] [10]. There are two conserved domains in shugoshin proteins: one is the coiled-coil that is located near the N-terminal, which may mediate homodimerization and interactions with other proteins; the other is the basic region in the C-terminal, which is required for chromosomal localization [4] [11]. The activity of shugoshin is controlled by an accurate and complicated process during cell divisions. In S. pombe, the location of Sgo1 is regulated by the kinase, Bub1, and its degradation at anaphase I is controlled by the anaphasepromoting complex (APC) [4].<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*State Key Laboratory of Plant Genomics and Center for Plant Gene Research, Institute of Genetics and Developmental Biology,Chinese Academy of Sciences, Beijing 100101, China<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> ChiZhengchang. (2010) Functional Analysis of the Meiotic Gene ''OsSGO1'' in ''Oryza sativa''. Yangzhou university </ref><br />
<ref name="ref2"> Mo Wang, Ding Tang, Kejian Wang, et.al. (2011) OsSGO1 maintains synaptonemal complex stabilization in addition to protecting centromeric cohesion during rice meiosis. The Plant Journal. 67 : 583-594 </ref><br />
<ref name="ref3">Che, L., Tang, D., Wang, K., et.al. (2011) OsAM1 is required for leptotene-zygotene transition in rice. Cell Res.21 :654–665.</ref><br />
<ref name="ref4">Tomoya S. Kitajima1, Shigehiro A. Kawashima1,Yoshinori Watanabe1.(2004) The conserved kinetochore protein shugoshin protects centromeric cohesion during meiosis. Nature. 427 :510–517.</ref><br />
<ref name="ref5">Kiburz, B.M., Reynolds, D.B., Megee, P.C., et.al. (2005) The core centromere and ''Sgo1'' establish a 50-kb cohesin-protected domain around centromeres during meiosis I. EMBO J. 22 :3017-3030.</ref><br />
<ref name="ref6">Vahan B. Indjeian, Bodo M. Stern, Andrew W. Murray. (2005) OsAM1 is required for leptotene-zygotene transition in rice. Science. 307 :130–133.</ref><br />
<ref name="ref7">Olivier Hamant, Inna Golubovskaya, Robert Meeley, et.al. (2005) A REC8-Dependent Plant Shugoshin Is Required for Maintenance of Centromeric Cohesion during Meiosis and Has No Mitotic Functions. Current Biology. 15 : 948–954.</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os02g0799100|<br />
Description = Hypothetical protein|<br />
Version = NM_001186253.1 GI:297721638 GeneID:9266998|<br />
Length = 3610 bp|<br />
Definition = Oryza sativa Japonica Group Os02g0799100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|<br />
AP = Chromosome 2:34917690..34921299|<br />
CDS = 34920472..34920601,34920706..34920743,34920892..34921040,34921133..34921148|<br />
GCID = <gbrowseImage1><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcggccgctgcaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggagaacgccaagttgcgtcatctgcttgctgagcgaaacaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattag</cdnaseq>|<br />
AA = <aaseq>MAAAAGAAARGGGVIPAGKGGSLRSPGKPVVLADITNTGRPNPT GSVHAIADVLKENAKLRHLLAERNKVIEVSRVELQKIRLALQAMQQKNLQLVQANSQM FAVCLLIH</aaseq>|<br />
DNA = <dnaseqindica>699..828#557..594#260..408#152..167#tctccgaaacctcatcggattcctctccgcgcggctaccggagcgccgcctctctctccccgcgcgcgcgctgcggctccgagggtcctcgccggcttcacctccggcggtggcgtgcgcaaccacaggccccgcggccgctgggccagccatggcggccgctgcaggtaaaaatcgtatcccctagatttcgagctacccgtggcattccatggtggggttctctcgggctcagcttccgcacctcctcctaaaccaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggtgatttcagttctagctctattttttttttcttcgggggatttcggttctaactcaaacaagcagacaaccctagcagcgccaagttgaatgctagtaattccgatttccatccgattaaaccatttaattcctcccttgctttcaggagaacgccaagttgcgtcatctgcttgctgagcgaaagtatgcattgcctctaccatccattttgttgtcggaggataaaacctgcggtttctcaagtagcacagttttttttaaattattttttgctttcttatttgcagcaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattagctccctacctcaccattcttgtgtcaatgtttgtttatacttgtgcaatgctggttcaccaggcctgtaggttgagcacatagtttgagttatagctatgcataatggcaaatgagaagtgtttgtcttacttcattgctgattgttttgtggtagttacagactgtttgatatgtctatgttttcttcttccttgcaggaaataaatcaaggaaaagatagagtaagctgcctctggttctttgttgtttgaattttcaaatgcagtatgatttctgatttggggattaatctgtggatatgacatgcagatcaagttattgcaacatgaacttgcatgcacaatagccgtgctcaaagtaaagggttctgaactcgaggtaattctaaagcttgactgtatgaacctctgtttgttacatataacatgcttttctcatcgtctactattgcagaagatgagtaagacttctaacaatcaacaaaatagagcaaagatattggtatgcagtcaaattcttaagcaaatgattcaccatgtttagctgcattatttctagttctgaattctgaaatcgttctgttcgtgcaacataatcaggagaaaaaaaccaggtcttccaaatgcgcaccaactaaggctcatcaaatggctgcaggttctattagagaacatttggttgaaattcaatgtaatgctcactcttctcactatttctttcttgaactagatactatacctggcaatcgtttcatctatcctactttatggttataatttaccccctttatatgaagcaattgaagttttatgttttttcctctgccataagttaggacactagtaaaattctaatcttcatttgttgccaatttcttctcagcagctgtgccatcttatactagctgtcatgagcctccacaggataaaacaaacaagaggtattttcatctctttactgatgtttgagtgggtgactggttgaccgggttatagtagcctatttcatgcatcactacttattcagcatgtttgcaaacaggtgcacaaataggcggaagtcagaatcatgtgaagttacaatggataccaacacagtgcaacatagctgcagacctcatgtggaatataatgggtcatcgcatgatgatgatccaaggtaatcaatgcttaatgcttataacagaatgcgttcattgttgcatcattatctgatttaagcttgttcaaaactcttgggcacatgtggtcagaaaaactcgacggagaaggtctgccagattgaaccctggatcttttgaggtcgcagagatctgtgataaattgcatgaggatgctactgttccttcggctcctagttctaatgttccaaagctgcaggaaccaaatgctggaaaagatatggtagggttttactatttctttctgtttttctgtttcaaaaaaaatttcacaatgtggttatgattttgtgctagatttgtggtggcaagatgaagtcattgcaaaaagaacttccatgtgatgcaatagcgcaagtagtagaggctccagaactcaaggtaattgagcagagtggttcgcatcaaatttttgctagtcttacatatattaatttattttttagtaaaatctggatcctgattgtatgtactagaaaaaacgaagtatgcacacacaaaaggaagtgtatctggaggtgggcaggacagttcttatgtaaataatcctcacatttatccatgaagaagtcttaattcttattatgttcctacttctttcgtccaatgaaattaggagatacaagaagcaggttccagcgttgctggaggtgaggcgcataaatttgatattgaggatccagagccaccaaggtatggcacatcattttagcagggtttaagatgcatggtacatcacacaattcacctaaacaatatgctctgtccaatcagaaaatcaatgcgtattgatgcaaacaaacggaagctggaatcatttgagagtcgattggcctcgaacaaagaggactgcatcaatgccatatgcgactcaacttcaagcgtgccaattcagcatgaacaaaagaggtaactctctcctatattccaacgatgcactttcctctgcatggaacatgtcaatcatggctgcccttaatactgcagaaaattgtcaaggagaaaatcctcaagactggaccctggaccttgggaggtcacaaatggcacttttgaaattgtccaggaagatacagttgccccgtctgctccttccagttcaaatgctttgatcgagcagaccaaaaatgatatgcaaaacgaccgcagttgctcgactaaaccttctgacgagcaggtgataggtagaagatcttcagttgggaggccctcaagacgggcagcagaaaagatagtctcctacaaggaggtgcccttgaatattaagatgcgacgaccatgatccccacttgcatgcaaagagcacaaacaccattggcatttattttatggtgtagaatcaagtttgttgtgtatctatctgttttggtcgctgtcaataggtaggttagctcctctatctaccccaacatggatactcaccctgcatcccagtttcaaactgaccatggaatttatctgatttagcctcagtctggactgatgatgccgataacaaccagcaaaccattgttcctgttctgatgaagtagagaccagacaacaataatgtggttagtactgttttattttcttgatggttctcatatgttgagagatc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186253.1 RefSeq:Os02g0799100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 2]]<br />
[[Category:Chromosome 2]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0799100&diff=175125Os02g07991002014-05-31T13:13:48Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>The ''Ossgo1''gene encodes the protein OsSGO1 which maintains synaptonemal complex stabilization in addition to protecting centromeric cohesion during rice meiosis.<br />
<br />
==Annotated Information==<br />
===Function===<br />
Os02g0799100 is the rice(''Oryza sativa'') homologue of the maize Sgo1 gene. It encodes an homolog of shugoshin protein ZmSGO1 in maize (Zea mays), named OsSGO1. The gene ''OsSGO1'' is essential for rice meiosis and plays an important role in protecting centromeric cohesion during meiosis. The knockdown of ''OsSGO1'' may cause precocious disassociation and random segregation of sister chromatids at telophaseⅠand anaphase II, respectively, which finally leads to sterile pollen formation.And the ''OsSGO1'' localizes to centromere from the result of immunostaining experiments <ref name="ref1" />. In addition to the meiosisspecific maintenance of centromeric cohesion, OsSGO1 is required for the timely assembly and maintenance of SCs during early prophase I. Furthermore, the centromeric localization of OsSGO1 depends on OsAM1 <ref name="ref2" />. OsAM1 is the homolog of Arabidopsis SWI1 and maize AM1 in rice and is required for the leptotene–zygotene transition <ref name="ref3" />. OsSGO1 is specifically required to protect centromeric cohesion during meiosis.OsSGO1 transfers from nucleoli onto centromeres at the onset of prophase in both meiosis and mitosis.The relocalization of OsSGO1 onto centromeres is OsAM1-dependent.The maintenance of SCs in prophase I is affected in ''Ossgo1'' <ref name="ref2" />.<br />
<br />
===Mutation===<br />
[[File:Figure S1.jpg|right|thumb|250px|''Schematic representation of OsSGO1 gene (from reference <ref name="ref2" />).'']]<br />
An OsSGO1-RNAi vector is transformed into rice calli by Agrobacterium-mediated DNA transfer. OsSGO1-RNAi lines isobtained by screening the plants regenerated from the transformed calli by PCR. One single ''Tos17''-insertion mutant line of the ''OsSGO1'' gene, ''Ossgo1-1'', is identified by screening the public insertion line collections. Sequence analysis of its PCR products confirmed that ''Tos17'' is inserted into exon 15, only 5 bp upstream from the stop codon(Figure S1). <ref name="ref2" /> .<br />
<br />
===Expression（Mutant VS Wild type）===<br />
[[File:FigureS2.jpg|right|thumb|250px|''Expression analysis of OsSGO1 (from reference <ref name="ref2" />).'']]<br />
[[File:FigureS3.jpg|right|thumb|250px|''Characterization of the phenotype of ''Ossgo1'' mutants (from reference <ref name="ref2" />).'']]<br />
[[File:FigureS4.jpg|right|thumb|250px|''The defective cDNA sequence from ''Ossgo1-1'' mutant (from reference <ref name="ref2" />).'']]<br />
[[File:FigureS5.jpg|right|thumb|250px|''Western blotting analysis of OsSGO1 expression (from reference <ref name="ref2" />).'']]<br />
<br />
''OsSGO1'' is expressed most highly in the roots, secondly in the panicles, and at a relatively low level in leaves(Figure S3)<ref name="ref2" />. <br />
The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophase Ⅰand anaphase II, respectively, which finally leads to sterile pollen formation<ref name="ref1" />. The homozygous ''Ossgo1-1'' mutant grows normally in the vegetative stage but is sterile during the flowering phase, and its pollen is completely non-viable when evaluated by 1% I2-KI solution staining (Figure S4). The transcription level of OsSGO1 is slightly decreased in the ''Ossgo1-1'' mutant (Figure S3). Additionally, by performing RT-PCR, it is found that the ''Ossgo1-1'' cDNA sequence is altered downstream of the ''Tos17''-insertion position by the addition of 71 nucleotides, and the whole cDNA lacks a stop codon (Figure S5). Additionally, an allelic mutant of ''Ossgo1-1'' with a deletion of 15 bp (nucleotides 1773–1787 in the gene) from the mutants induced by 60 Co~γ-ray radiation is identified and is named as ''Ossgo1-2'' (Figure S1), which results in five amino acids missing in OsSGO1. The homozygous ''Ossgo1-2'' mutant is also normal in the vegetative stage but completely sterile (Figure S4). Neither of the mutants set seeds when pollinated with pollen from the wild-type plants. Additionally, through immunoblotting, it is found that the expression level of OsSGO1 protein is indeed down-regulated in Ossgo1-1 and OsSGO1RNAi plants (Figure S5) <ref name="ref2" />.<br />
<br />
{| class='wikitable' style="text-align:center"<br />
|-<br />
! | Primer<br />
! | Forward primer<br />
! | Reverse primer<br />
|-<br />
| rowspan="3"|Gene amplication<br />
| | 5'-CGAAACCTCATCGGATTCCT-3'<br />
| | 5'-GCCAATGGTGTTTGTGCTCT-3' (used to amplify the predicted coding regions of ''OsSGO1'' <ref name="ref2" />)<br />
|-<br />
| | 5'-ATTGTTAGGTTGCAAGTTAGTTAAGA'<br />
| | 5'-GCCTCGAACAAAGAGGACTG-3' (used to amplify the ''Tos17'' inserted regions of ''ossgo1'' <ref name="ref2" />)<br />
|-<br />
| | 5'-GTGAATTCCCATTGAGGATCCAGAGCCACCA-3'<br />
| | 5'-AGTCTCGAGTACCTATCACCTGCTCGTCAGA-3' (used to amplify the fragment of ''OsSGO1'' cDNA <ref name="ref2" />)<br />
|-<br />
| rowspan="2"|RT-PCR<br />
| | 5'-TCAATCAGCTGTGCCATCTT-3'<br />
| | 5'-CATCTTGCCACCACA AATCA-3' <ref name="ref2" /><br />
|}<br />
<br />
===Evolution===<br />
[[File:Figure S2.jpg|right|thumb|250px|''Alignment of OsSGO1 with ZmSGO1 in maize (from reference <ref name="ref2" />).'']]<br />
''SGO1'' gene is the first meiosis specificity expressed gene in yeast cDNA library screening conducted in Watanabe Lab, as well as to the lack of corresponding mutant phenotype analysis, identified as the homologous gene of Drosophila melanogaster Mei - S332 <ref name="ref4" /><ref name="ref5" />. Many researches of SGO function have been investigated in animals and yeast <ref name="ref6" />, while relatively few has been reported in plants. In plants, ''SGO1'' gene is first found in maize, and the mutant of premature-dissociation centromeric cohesion which locates in the centromere at the stage of anaphase Ⅰ. And the phenotype is due to the deletion of ZmSGO1 protein. ZmSGO1 is found to be located in the centromere from the eptotene stage Previous studies indicates that ZmSGO1 plays an important role in protecting of centromeric cohesion during meiosis I <ref name="ref7" />. The OsSGO1 protein sequence,which comprises 486 amino acid residues, shows a high similarity toZmSGO1(209/537 residues identical and 278/537 residues positive(Figure S2)<ref name="ref2" />.<br />
<br />
===Knowledge Extension===<br />
<br />
OsSGO1 is a shugoshin protein. Shugoshin is a conserved protein in eukaryotes that protects the centromeric cohesin of sister chromatids from cleavage by separase during meiosis [2]. Shugoshins (Japanese for ‘guardian spirit’) are the conserved proteins required to protect the cohesin adjacent to the centromeres from cleavage by separase. Drosophila Mei-S332 was the first protein in the shugoshin family to be discovered， which is necessary for chromosome precise separation [4] [8] [9]. From then, shugoshins have been identified in various organisms from yeast to humans. Saccharomyces cerevisiae and Drosophila have only one kinds of shugoshin, which is expressed in both mitosis and meiosis, while Schizosaccharomyces pombe and mammals have two (Sgo1 and Sgo2) [4] [10]. There are two conserved domains in shugoshin proteins: one is the coiled-coil that is located near the N-terminal, which may mediate homodimerization and interactions with other proteins; the other is the basic region in the C-terminal, which is required for chromosomal localization [4] [11]. The activity of shugoshin is controlled by an accurate and complicated process during cell divisions. In S. pombe, the location of Sgo1 is regulated by the kinase, Bub1, and its degradation at anaphase I is controlled by the anaphasepromoting complex (APC) [4].<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*State Key Laboratory of Plant Genomics and Center for Plant Gene Research, Institute of Genetics and Developmental Biology,<br />
Chinese Academy of Sciences, Beijing 100101, China<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> ChiZhengchang. (2010) Functional Analysis of the Meiotic Gene ''OsSGO1'' in ''Oryza sativa''. Yangzhou university </ref><br />
<ref name="ref2"> Mo Wang, Ding Tang, Kejian Wang, et.al. (2011) OsSGO1 maintains synaptonemal complex stabilization in addition to protecting centromeric cohesion during rice meiosis. The Plant Journal. 67 : 583-594 </ref><br />
<ref name="ref3">Che, L., Tang, D., Wang, K., et.al. (2011) OsAM1 is required for leptotene-zygotene transition in rice. Cell Res.21 :654–665.</ref><br />
<ref name="ref4">Tomoya S. Kitajima1, Shigehiro A. Kawashima1,Yoshinori Watanabe1.(2004) The conserved kinetochore protein shugoshin protects centromeric cohesion during meiosis. Nature. 427 :510–517.</ref><br />
<ref name="ref5">Kiburz, B.M., Reynolds, D.B., Megee, P.C., et.al. (2005) The core centromere and ''Sgo1'' establish a 50-kb cohesin-protected domain around centromeres during meiosis I. EMBO J. 22 :3017-3030.</ref><br />
<ref name="ref6">Vahan B. Indjeian, Bodo M. Stern, Andrew W. Murray. (2005) OsAM1 is required for leptotene-zygotene transition in rice. Science. 307 :130–133.</ref><br />
<ref name="ref7">Olivier Hamant, Inna Golubovskaya, Robert Meeley, et.al. (2005) A REC8-Dependent Plant Shugoshin Is Required for Maintenance of Centromeric Cohesion during Meiosis and Has No Mitotic Functions. Current Biology. 15 : 948–954.</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os02g0799100|<br />
Description = Hypothetical protein|<br />
Version = NM_001186253.1 GI:297721638 GeneID:9266998|<br />
Length = 3610 bp|<br />
Definition = Oryza sativa Japonica Group Os02g0799100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|<br />
AP = Chromosome 2:34917690..34921299|<br />
CDS = 34920472..34920601,34920706..34920743,34920892..34921040,34921133..34921148|<br />
GCID = <gbrowseImage1><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcggccgctgcaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggagaacgccaagttgcgtcatctgcttgctgagcgaaacaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattag</cdnaseq>|<br />
AA = <aaseq>MAAAAGAAARGGGVIPAGKGGSLRSPGKPVVLADITNTGRPNPT GSVHAIADVLKENAKLRHLLAERNKVIEVSRVELQKIRLALQAMQQKNLQLVQANSQM FAVCLLIH</aaseq>|<br />
DNA = <dnaseqindica>699..828#557..594#260..408#152..167#tctccgaaacctcatcggattcctctccgcgcggctaccggagcgccgcctctctctccccgcgcgcgcgctgcggctccgagggtcctcgccggcttcacctccggcggtggcgtgcgcaaccacaggccccgcggccgctgggccagccatggcggccgctgcaggtaaaaatcgtatcccctagatttcgagctacccgtggcattccatggtggggttctctcgggctcagcttccgcacctcctcctaaaccaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggtgatttcagttctagctctattttttttttcttcgggggatttcggttctaactcaaacaagcagacaaccctagcagcgccaagttgaatgctagtaattccgatttccatccgattaaaccatttaattcctcccttgctttcaggagaacgccaagttgcgtcatctgcttgctgagcgaaagtatgcattgcctctaccatccattttgttgtcggaggataaaacctgcggtttctcaagtagcacagttttttttaaattattttttgctttcttatttgcagcaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattagctccctacctcaccattcttgtgtcaatgtttgtttatacttgtgcaatgctggttcaccaggcctgtaggttgagcacatagtttgagttatagctatgcataatggcaaatgagaagtgtttgtcttacttcattgctgattgttttgtggtagttacagactgtttgatatgtctatgttttcttcttccttgcaggaaataaatcaaggaaaagatagagtaagctgcctctggttctttgttgtttgaattttcaaatgcagtatgatttctgatttggggattaatctgtggatatgacatgcagatcaagttattgcaacatgaacttgcatgcacaatagccgtgctcaaagtaaagggttctgaactcgaggtaattctaaagcttgactgtatgaacctctgtttgttacatataacatgcttttctcatcgtctactattgcagaagatgagtaagacttctaacaatcaacaaaatagagcaaagatattggtatgcagtcaaattcttaagcaaatgattcaccatgtttagctgcattatttctagttctgaattctgaaatcgttctgttcgtgcaacataatcaggagaaaaaaaccaggtcttccaaatgcgcaccaactaaggctcatcaaatggctgcaggttctattagagaacatttggttgaaattcaatgtaatgctcactcttctcactatttctttcttgaactagatactatacctggcaatcgtttcatctatcctactttatggttataatttaccccctttatatgaagcaattgaagttttatgttttttcctctgccataagttaggacactagtaaaattctaatcttcatttgttgccaatttcttctcagcagctgtgccatcttatactagctgtcatgagcctccacaggataaaacaaacaagaggtattttcatctctttactgatgtttgagtgggtgactggttgaccgggttatagtagcctatttcatgcatcactacttattcagcatgtttgcaaacaggtgcacaaataggcggaagtcagaatcatgtgaagttacaatggataccaacacagtgcaacatagctgcagacctcatgtggaatataatgggtcatcgcatgatgatgatccaaggtaatcaatgcttaatgcttataacagaatgcgttcattgttgcatcattatctgatttaagcttgttcaaaactcttgggcacatgtggtcagaaaaactcgacggagaaggtctgccagattgaaccctggatcttttgaggtcgcagagatctgtgataaattgcatgaggatgctactgttccttcggctcctagttctaatgttccaaagctgcaggaaccaaatgctggaaaagatatggtagggttttactatttctttctgtttttctgtttcaaaaaaaatttcacaatgtggttatgattttgtgctagatttgtggtggcaagatgaagtcattgcaaaaagaacttccatgtgatgcaatagcgcaagtagtagaggctccagaactcaaggtaattgagcagagtggttcgcatcaaatttttgctagtcttacatatattaatttattttttagtaaaatctggatcctgattgtatgtactagaaaaaacgaagtatgcacacacaaaaggaagtgtatctggaggtgggcaggacagttcttatgtaaataatcctcacatttatccatgaagaagtcttaattcttattatgttcctacttctttcgtccaatgaaattaggagatacaagaagcaggttccagcgttgctggaggtgaggcgcataaatttgatattgaggatccagagccaccaaggtatggcacatcattttagcagggtttaagatgcatggtacatcacacaattcacctaaacaatatgctctgtccaatcagaaaatcaatgcgtattgatgcaaacaaacggaagctggaatcatttgagagtcgattggcctcgaacaaagaggactgcatcaatgccatatgcgactcaacttcaagcgtgccaattcagcatgaacaaaagaggtaactctctcctatattccaacgatgcactttcctctgcatggaacatgtcaatcatggctgcccttaatactgcagaaaattgtcaaggagaaaatcctcaagactggaccctggaccttgggaggtcacaaatggcacttttgaaattgtccaggaagatacagttgccccgtctgctccttccagttcaaatgctttgatcgagcagaccaaaaatgatatgcaaaacgaccgcagttgctcgactaaaccttctgacgagcaggtgataggtagaagatcttcagttgggaggccctcaagacgggcagcagaaaagatagtctcctacaaggaggtgcccttgaatattaagatgcgacgaccatgatccccacttgcatgcaaagagcacaaacaccattggcatttattttatggtgtagaatcaagtttgttgtgtatctatctgttttggtcgctgtcaataggtaggttagctcctctatctaccccaacatggatactcaccctgcatcccagtttcaaactgaccatggaatttatctgatttagcctcagtctggactgatgatgccgataacaaccagcaaaccattgttcctgttctgatgaagtagagaccagacaacaataatgtggttagtactgttttattttcttgatggttctcatatgttgagagatc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186253.1 RefSeq:Os02g0799100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 2]]<br />
[[Category:Chromosome 2]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=175123Os01g02573002014-05-31T13:10:05Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
''OsRAA1''(Oryza sativa Root Architecture Associated1) encodes a small protein (109 aa in length) conserved in plants <br />
including -GVWV/IF domain, -GWERYY domain ,-DLIS/ALP- and -H/YMYDI/VVV/I- domain. The OsRAA1 promoter(1,987 bp in length)includes elements of GA and auxin response, but it was a very weak response to GA3 treatment and it probably regulated by auxin. The OsRAA1 mRNA was specifically transcripted in the organs of roots and spikes, including root apex, cortex of root apical meristem ,pericycle of root apex, lateral roots, apical meristem of young spikes, collenchyma cells of margin vascular bundles between shoot and roots.In Ubi::OsRAA1 transgenic plants, overexpression ''OsRAA1'' in the root results in reduced growth of primary root, increased number of adventitious roots and helix primary root, and delayed gravitropic, which are similar to the phenotypes of the wild-type plant treated with auxin. Furthermore, the leaves and filaments are longer at the last stage of plant development in the transgenic plants. ''OsRAA1'' expression is induced by auxin. At the same time, overexpression of ''OsRAA1'' also causes endogenous indole-3-acetic acid to increase. These data suggest that ''OsRAA1'' as a new gene functions in the development of rice root systems,which are mediated by auxin.<br />
<br />
OsRAA1 Regulates Primary Root Development by Modulating Mitosis. OsRAA1 may function at the transition from metaphase to anaphase during cell division.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
Immunoassay of a cell line with GFP alone showed immunofluorescence in the whole cell during the cell cycle.In contrast, in the OsRAA1-GFP transgenic line, OsRAA1 GFP was enriched at spindles, including tubulins, from metaphase to anaphase during cell division<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
*Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, The Chinese Academy of Sciences,Beijing 100093, China<br />
*State Key Laboratory of Plant Physiology and Biochemistry, Department of Plant Sciences, College of Biological Sciences, China Agricultural University, Beijing 100094,China<br />
*Department Plant Biology, Carnegie Institution of Washington, and Department of Biological Sciences, Stanford University, Stanford, California 94305<br />
*National Research Center for Plant Gene, Beijing 100093, China<br />
*Graduate School of the Chinese Academy of Sciences, Beijing 100049, China<br />
<br />
==References==<br />
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0799100&diff=174725Os02g07991002014-05-30T15:50:55Z<p>Lizhitao: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
Os02g0799100 is the rice(Oryza sativa) homologue of the maize Sgo1 gene. It encodes an homolog of shugoshin protein ZmSGO1 in maize (Zea mays), named OsSGO1. The gene OsSGO1 is essential for rice meiosis and plays an important role in protecting centromeric cohesion during meiosis. The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophaseⅠand anaphase II, respectively, which finally leads to sterile pollen formation.And the OsSGO1 localizes to centromere from the result of immunostaining experiments[1]. In addition to the meiosisspecific maintenance of centromeric cohesion, OsSGO1 is required for the timely assembly and maintenance of SCs during early prophase I. Furthermore, the centromeric localization of OsSGO1 depends on OsAM1[2]. OsAM1 is the homolog of Arabidopsis SWI1 and maize AM1 in rice and is required for the leptotene–zygotene transition (Che et al., 2011).OsSGO1 is specifically required to protect centromeric cohesion during meiosis.OsSGO1 transfers from nucleoli onto centromeres at the onset of prophase in both meiosis and mitosis.The relocalization of OsSGO1 onto centromeres is OsAM1-dependent.The maintenance of SCs in prophase I is affected inOssgo1.<br />
<br />
===Mutation===<br />
An OsSGO1-RNAi vector is transformed into rice calli by Agrobacterium-mediated DNA transfer. OsSGO1-RNAi lines isobtained by screening the plants regenerated from the transformed calli by PCR[1]. One single Tos17-insertion mutant line of the OsSGO1 gene, Ossgo1-1, was identified by screening the public insertion line collections. Sequence analysis of its PCR products confirmed that Tos17 was inserted into exon 15, only 5 bp upstream from the stop codon (Figure S1) [2].<br />
<br />
===Expression===<br />
OsSGO1 is expressed most highly in the roots, secondly in the panicles, and at a relatively low level in leaves (Figure S3) [2]. <br />
The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophase Ⅰand anaphase II, respectively, which finally leads to sterile pollen formation[1]. The homozygous Ossgo1-1 mutant grew normally in the vegetative stage but was sterile during the flowering phase, and its pollen was completely non-viable when evaluated by 1% I2-KI solution staining (Figure S4). The transcription level of OsSGO1 was slightly decreased in the Ossgo1-1 mutant (Figure S3). Additionally, by performing RT-PCR, we found that the Ossgo1-1 cDNA sequence is altered downstream of the Tos17-insertion position by the addition of 71 nucleotides, and the whole cDNA lacks a stop codon (Figure S5). Additionally, we identified an allelic mutant of Ossgo1-1 with a deletion of 15 bp (nucleotides 1773–1787 in the gene) from the mutants induced by 60Co�c-ray radiation and named as Ossgo1-2 (Figure S1), which results in five amino acids missing in OsSGO1. The homozygous Ossgo1-2 mutant was also normal in the vegetative stage but completely sterile (Figure S4). Neither of the mutants set seeds when pollinated with pollen from the wild-type plants [2].<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
===Knowledge Extension===<br />
Please input evolution information here.<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*Cloning the full-lengthOsSGO1cDNA<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Construction of theOsSGO1RNA interference cassette and rice transformation<br />
*Antibody production and protein gel blot analysis<br />
*Meiotic chromosome preparation and FISH<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Immunofluorescence<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
[1] OsSGO1 maintains synaptonemal complex stabilization in addition to protecting centromeric cohesion during rice meiosis The Plant Journal, 2011, 67(4): 583-594<br />
<br />
[2] OsAM1 is required for leptotene-zygotene transition in rice.Cell Res.21, 654–665<br />
<br />
[3] Disjunction of homologous chromosomes in meiosis I depends on proteolytic cleavage of the meiotic cohesin Rec8 by separin.Cell, 103, 387–398<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os02g0799100|<br />
Description = Hypothetical protein|<br />
Version = NM_001186253.1 GI:297721638 GeneID:9266998|<br />
Length = 3610 bp|<br />
Definition = Oryza sativa Japonica Group Os02g0799100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|<br />
AP = Chromosome 2:34917690..34921299|<br />
CDS = 34920472..34920601,34920706..34920743,34920892..34921040,34921133..34921148|<br />
GCID = <gbrowseImage1><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcggccgctgcaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggagaacgccaagttgcgtcatctgcttgctgagcgaaacaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattag</cdnaseq>|<br />
AA = <aaseq>MAAAAGAAARGGGVIPAGKGGSLRSPGKPVVLADITNTGRPNPT GSVHAIADVLKENAKLRHLLAERNKVIEVSRVELQKIRLALQAMQQKNLQLVQANSQM FAVCLLIH</aaseq>|<br />
DNA = <dnaseqindica>699..828#557..594#260..408#152..167#tctccgaaacctcatcggattcctctccgcgcggctaccggagcgccgcctctctctccccgcgcgcgcgctgcggctccgagggtcctcgccggcttcacctccggcggtggcgtgcgcaaccacaggccccgcggccgctgggccagccatggcggccgctgcaggtaaaaatcgtatcccctagatttcgagctacccgtggcattccatggtggggttctctcgggctcagcttccgcacctcctcctaaaccaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggtgatttcagttctagctctattttttttttcttcgggggatttcggttctaactcaaacaagcagacaaccctagcagcgccaagttgaatgctagtaattccgatttccatccgattaaaccatttaattcctcccttgctttcaggagaacgccaagttgcgtcatctgcttgctgagcgaaagtatgcattgcctctaccatccattttgttgtcggaggataaaacctgcggtttctcaagtagcacagttttttttaaattattttttgctttcttatttgcagcaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattagctccctacctcaccattcttgtgtcaatgtttgtttatacttgtgcaatgctggttcaccaggcctgtaggttgagcacatagtttgagttatagctatgcataatggcaaatgagaagtgtttgtcttacttcattgctgattgttttgtggtagttacagactgtttgatatgtctatgttttcttcttccttgcaggaaataaatcaaggaaaagatagagtaagctgcctctggttctttgttgtttgaattttcaaatgcagtatgatttctgatttggggattaatctgtggatatgacatgcagatcaagttattgcaacatgaacttgcatgcacaatagccgtgctcaaagtaaagggttctgaactcgaggtaattctaaagcttgactgtatgaacctctgtttgttacatataacatgcttttctcatcgtctactattgcagaagatgagtaagacttctaacaatcaacaaaatagagcaaagatattggtatgcagtcaaattcttaagcaaatgattcaccatgtttagctgcattatttctagttctgaattctgaaatcgttctgttcgtgcaacataatcaggagaaaaaaaccaggtcttccaaatgcgcaccaactaaggctcatcaaatggctgcaggttctattagagaacatttggttgaaattcaatgtaatgctcactcttctcactatttctttcttgaactagatactatacctggcaatcgtttcatctatcctactttatggttataatttaccccctttatatgaagcaattgaagttttatgttttttcctctgccataagttaggacactagtaaaattctaatcttcatttgttgccaatttcttctcagcagctgtgccatcttatactagctgtcatgagcctccacaggataaaacaaacaagaggtattttcatctctttactgatgtttgagtgggtgactggttgaccgggttatagtagcctatttcatgcatcactacttattcagcatgtttgcaaacaggtgcacaaataggcggaagtcagaatcatgtgaagttacaatggataccaacacagtgcaacatagctgcagacctcatgtggaatataatgggtcatcgcatgatgatgatccaaggtaatcaatgcttaatgcttataacagaatgcgttcattgttgcatcattatctgatttaagcttgttcaaaactcttgggcacatgtggtcagaaaaactcgacggagaaggtctgccagattgaaccctggatcttttgaggtcgcagagatctgtgataaattgcatgaggatgctactgttccttcggctcctagttctaatgttccaaagctgcaggaaccaaatgctggaaaagatatggtagggttttactatttctttctgtttttctgtttcaaaaaaaatttcacaatgtggttatgattttgtgctagatttgtggtggcaagatgaagtcattgcaaaaagaacttccatgtgatgcaatagcgcaagtagtagaggctccagaactcaaggtaattgagcagagtggttcgcatcaaatttttgctagtcttacatatattaatttattttttagtaaaatctggatcctgattgtatgtactagaaaaaacgaagtatgcacacacaaaaggaagtgtatctggaggtgggcaggacagttcttatgtaaataatcctcacatttatccatgaagaagtcttaattcttattatgttcctacttctttcgtccaatgaaattaggagatacaagaagcaggttccagcgttgctggaggtgaggcgcataaatttgatattgaggatccagagccaccaaggtatggcacatcattttagcagggtttaagatgcatggtacatcacacaattcacctaaacaatatgctctgtccaatcagaaaatcaatgcgtattgatgcaaacaaacggaagctggaatcatttgagagtcgattggcctcgaacaaagaggactgcatcaatgccatatgcgactcaacttcaagcgtgccaattcagcatgaacaaaagaggtaactctctcctatattccaacgatgcactttcctctgcatggaacatgtcaatcatggctgcccttaatactgcagaaaattgtcaaggagaaaatcctcaagactggaccctggaccttgggaggtcacaaatggcacttttgaaattgtccaggaagatacagttgccccgtctgctccttccagttcaaatgctttgatcgagcagaccaaaaatgatatgcaaaacgaccgcagttgctcgactaaaccttctgacgagcaggtgataggtagaagatcttcagttgggaggccctcaagacgggcagcagaaaagatagtctcctacaaggaggtgcccttgaatattaagatgcgacgaccatgatccccacttgcatgcaaagagcacaaacaccattggcatttattttatggtgtagaatcaagtttgttgtgtatctatctgttttggtcgctgtcaataggtaggttagctcctctatctaccccaacatggatactcaccctgcatcccagtttcaaactgaccatggaatttatctgatttagcctcagtctggactgatgatgccgataacaaccagcaaaccattgttcctgttctgatgaagtagagaccagacaacaataatgtggttagtactgttttattttcttgatggttctcatatgttgagagatc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186253.1 RefSeq:Os02g0799100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 2]]<br />
[[Category:Chromosome 2]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0799100&diff=174723Os02g07991002014-05-30T15:50:32Z<p>Lizhitao: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
Os02g0799100 is the rice(Oryza sativa) homologue of the maize Sgo1 gene. It encodes an homolog of shugoshin protein ZmSGO1 in maize (Zea mays), named OsSGO1. The gene OsSGO1 is essential for rice meiosis and plays an important role in protecting centromeric cohesion during meiosis. The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophaseⅠand anaphase II, respectively, which finally leads to sterile pollen formation.And the OsSGO1 localizes to centromere from the result of immunostaining experiments[1]. In addition to the meiosisspecific maintenance of centromeric cohesion, OsSGO1 is required for the timely assembly and maintenance of SCs during early prophase I. Furthermore, the centromeric localization of OsSGO1 depends on OsAM1[2]. OsAM1 is the homolog of Arabidopsis SWI1 and maize AM1 in rice and is required for the leptotene–zygotene transition (Che et al., 2011).OsSGO1 is specifically required to protect centromeric cohesion during meiosis.OsSGO1 transfers from nucleoli onto centromeres at the onset of prophase in both meiosis and mitosis.The relocalization of OsSGO1 onto centromeres is OsAM1-dependent.The maintenance of SCs in prophase I is affected inOssgo1.<br />
<br />
===Mutation===<br />
An OsSGO1-RNAi vector is transformed into rice calli by Agrobacterium-mediated DNA transfer. OsSGO1-RNAi lines isobtained by screening the plants regenerated from the transformed calli by PCR[1]. One single Tos17-insertion mutant line of the OsSGO1 gene, Ossgo1-1, was identified by screening the public insertion line collections. Sequence analysis of its PCR products confirmed that Tos17 was inserted into exon 15, only 5 bp upstream from the stop codon (Figure S1) [2].<br />
<br />
===Expression===<br />
OsSGO1 is expressed most highly in the roots, secondly in the panicles, and at a relatively low level in leaves (Figure S3) [2]. <br />
The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophase Ⅰand anaphase II, respectively, which finally leads to sterile pollen formation[1]. The homozygous Ossgo1-1 mutant grew normally in the vegetative stage but was sterile during the flowering phase, and its pollen was completely non-viable when evaluated by 1% I2-KI solution staining (Figure S4). The transcription level of OsSGO1 was slightly decreased in the Ossgo1-1 mutant (Figure S3). Additionally, by performing RT-PCR, we found that the Ossgo1-1 cDNA sequence is altered downstream of the Tos17-insertion position by the addition of 71 nucleotides, and the whole cDNA lacks a stop codon (Figure S5). Additionally, we identified an allelic mutant of Ossgo1-1 with a deletion of 15 bp (nucleotides 1773–1787 in the gene) from the mutants induced by 60Co�c-ray radiation and named as Ossgo1-2 (Figure S1), which results in five amino acids missing in OsSGO1. The homozygous Ossgo1-2 mutant was also normal in the vegetative stage but completely sterile (Figure S4). Neither of the mutants set seeds when pollinated with pollen from the wild-type plants [2].<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
===Knowledge Extension===<br />
Please input evolution information here.<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*Cloning the full-lengthOsSGO1cDNA<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Construction of theOsSGO1RNA interference cassette and rice transformation<br />
*Antibody production and protein gel blot analysis<br />
*Meiotic chromosome preparation and FISH<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Immunofluorescence<br />
<br />
==References==<br />
Please input cited references here.<br />
[1] OsSGO1 maintains synaptonemal complex stabilization in addition to protecting centromeric cohesion during rice meiosis The Plant Journal, 2011, 67(4): 583-594<br />
[2] OsAM1 is required for leptotene-zygotene transition in rice.Cell Res.21, 654–665<br />
[3] Disjunction of homologous chromosomes in meiosis I depends on proteolytic cleavage of the meiotic cohesin Rec8 by separin.Cell, 103, 387–398<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os02g0799100|<br />
Description = Hypothetical protein|<br />
Version = NM_001186253.1 GI:297721638 GeneID:9266998|<br />
Length = 3610 bp|<br />
Definition = Oryza sativa Japonica Group Os02g0799100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|<br />
AP = Chromosome 2:34917690..34921299|<br />
CDS = 34920472..34920601,34920706..34920743,34920892..34921040,34921133..34921148|<br />
GCID = <gbrowseImage1><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcggccgctgcaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggagaacgccaagttgcgtcatctgcttgctgagcgaaacaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattag</cdnaseq>|<br />
AA = <aaseq>MAAAAGAAARGGGVIPAGKGGSLRSPGKPVVLADITNTGRPNPT GSVHAIADVLKENAKLRHLLAERNKVIEVSRVELQKIRLALQAMQQKNLQLVQANSQM FAVCLLIH</aaseq>|<br />
DNA = <dnaseqindica>699..828#557..594#260..408#152..167#tctccgaaacctcatcggattcctctccgcgcggctaccggagcgccgcctctctctccccgcgcgcgcgctgcggctccgagggtcctcgccggcttcacctccggcggtggcgtgcgcaaccacaggccccgcggccgctgggccagccatggcggccgctgcaggtaaaaatcgtatcccctagatttcgagctacccgtggcattccatggtggggttctctcgggctcagcttccgcacctcctcctaaaccaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggtgatttcagttctagctctattttttttttcttcgggggatttcggttctaactcaaacaagcagacaaccctagcagcgccaagttgaatgctagtaattccgatttccatccgattaaaccatttaattcctcccttgctttcaggagaacgccaagttgcgtcatctgcttgctgagcgaaagtatgcattgcctctaccatccattttgttgtcggaggataaaacctgcggtttctcaagtagcacagttttttttaaattattttttgctttcttatttgcagcaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattagctccctacctcaccattcttgtgtcaatgtttgtttatacttgtgcaatgctggttcaccaggcctgtaggttgagcacatagtttgagttatagctatgcataatggcaaatgagaagtgtttgtcttacttcattgctgattgttttgtggtagttacagactgtttgatatgtctatgttttcttcttccttgcaggaaataaatcaaggaaaagatagagtaagctgcctctggttctttgttgtttgaattttcaaatgcagtatgatttctgatttggggattaatctgtggatatgacatgcagatcaagttattgcaacatgaacttgcatgcacaatagccgtgctcaaagtaaagggttctgaactcgaggtaattctaaagcttgactgtatgaacctctgtttgttacatataacatgcttttctcatcgtctactattgcagaagatgagtaagacttctaacaatcaacaaaatagagcaaagatattggtatgcagtcaaattcttaagcaaatgattcaccatgtttagctgcattatttctagttctgaattctgaaatcgttctgttcgtgcaacataatcaggagaaaaaaaccaggtcttccaaatgcgcaccaactaaggctcatcaaatggctgcaggttctattagagaacatttggttgaaattcaatgtaatgctcactcttctcactatttctttcttgaactagatactatacctggcaatcgtttcatctatcctactttatggttataatttaccccctttatatgaagcaattgaagttttatgttttttcctctgccataagttaggacactagtaaaattctaatcttcatttgttgccaatttcttctcagcagctgtgccatcttatactagctgtcatgagcctccacaggataaaacaaacaagaggtattttcatctctttactgatgtttgagtgggtgactggttgaccgggttatagtagcctatttcatgcatcactacttattcagcatgtttgcaaacaggtgcacaaataggcggaagtcagaatcatgtgaagttacaatggataccaacacagtgcaacatagctgcagacctcatgtggaatataatgggtcatcgcatgatgatgatccaaggtaatcaatgcttaatgcttataacagaatgcgttcattgttgcatcattatctgatttaagcttgttcaaaactcttgggcacatgtggtcagaaaaactcgacggagaaggtctgccagattgaaccctggatcttttgaggtcgcagagatctgtgataaattgcatgaggatgctactgttccttcggctcctagttctaatgttccaaagctgcaggaaccaaatgctggaaaagatatggtagggttttactatttctttctgtttttctgtttcaaaaaaaatttcacaatgtggttatgattttgtgctagatttgtggtggcaagatgaagtcattgcaaaaagaacttccatgtgatgcaatagcgcaagtagtagaggctccagaactcaaggtaattgagcagagtggttcgcatcaaatttttgctagtcttacatatattaatttattttttagtaaaatctggatcctgattgtatgtactagaaaaaacgaagtatgcacacacaaaaggaagtgtatctggaggtgggcaggacagttcttatgtaaataatcctcacatttatccatgaagaagtcttaattcttattatgttcctacttctttcgtccaatgaaattaggagatacaagaagcaggttccagcgttgctggaggtgaggcgcataaatttgatattgaggatccagagccaccaaggtatggcacatcattttagcagggtttaagatgcatggtacatcacacaattcacctaaacaatatgctctgtccaatcagaaaatcaatgcgtattgatgcaaacaaacggaagctggaatcatttgagagtcgattggcctcgaacaaagaggactgcatcaatgccatatgcgactcaacttcaagcgtgccaattcagcatgaacaaaagaggtaactctctcctatattccaacgatgcactttcctctgcatggaacatgtcaatcatggctgcccttaatactgcagaaaattgtcaaggagaaaatcctcaagactggaccctggaccttgggaggtcacaaatggcacttttgaaattgtccaggaagatacagttgccccgtctgctccttccagttcaaatgctttgatcgagcagaccaaaaatgatatgcaaaacgaccgcagttgctcgactaaaccttctgacgagcaggtgataggtagaagatcttcagttgggaggccctcaagacgggcagcagaaaagatagtctcctacaaggaggtgcccttgaatattaagatgcgacgaccatgatccccacttgcatgcaaagagcacaaacaccattggcatttattttatggtgtagaatcaagtttgttgtgtatctatctgttttggtcgctgtcaataggtaggttagctcctctatctaccccaacatggatactcaccctgcatcccagtttcaaactgaccatggaatttatctgatttagcctcagtctggactgatgatgccgataacaaccagcaaaccattgttcctgttctgatgaagtagagaccagacaacaataatgtggttagtactgttttattttcttgatggttctcatatgttgagagatc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186253.1 RefSeq:Os02g0799100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 2]]<br />
[[Category:Chromosome 2]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0799100&diff=174712Os02g07991002014-05-30T15:43:29Z<p>Lizhitao: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
Os02g0799100 is the rice(Oryza sativa) homologue of the maize Sgo1 gene. It encodes an homolog of shugoshin protein ZmSGO1 in maize (Zea mays), named OsSGO1. The gene OsSGO1 is essential for rice meiosis and plays an important role in protecting centromeric cohesion during meiosis. The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophaseⅠand anaphase II, respectively, which finally leads to sterile pollen formation.And the OsSGO1 localizes to centromere from the result of immunostaining experiments[1]. In addition to the meiosisspecific maintenance of centromeric cohesion, OsSGO1 is required for the timely assembly and maintenance of SCs during early prophase I. Furthermore, the centromeric localization of OsSGO1 depends on OsAM1[2]. OsAM1 is the homolog of Arabidopsis SWI1 and maize AM1 in rice and is required for the leptotene–zygotene transition (Che et al., 2011).OsSGO1 is specifically required to protect centromeric cohesion during meiosis.OsSGO1 transfers from nucleoli onto centromeres at the onset of prophase in both meiosis and mitosis.The relocalization of OsSGO1 onto centromeres is OsAM1-dependent.The maintenance of SCs in prophase I is affected inOssgo1.<br />
<br />
===Mutation===<br />
An OsSGO1-RNAi vector is transformed into rice calli by Agrobacterium-mediated DNA transfer. OsSGO1-RNAi lines isobtained by screening the plants regenerated from the transformed calli by PCR[1]. One single Tos17-insertion mutant line of the OsSGO1 gene, Ossgo1-1, was identified by screening the public insertion line collections. Sequence analysis of its PCR products confirmed that Tos17 was inserted into exon 15, only 5 bp upstream from the stop codon (Figure S1) [2].<br />
<br />
===Expression===<br />
OsSGO1 is expressed most highly in the roots, secondly in the panicles, and at a relatively low level in leaves (Figure S3) [2]. <br />
The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophase Ⅰand anaphase II, respectively, which finally leads to sterile pollen formation[1]. The homozygous Ossgo1-1 mutant grew normally in the vegetative stage but was sterile during the flowering phase, and its pollen was completely non-viable when evaluated by 1% I2-KI solution staining (Figure S4). The transcription level of OsSGO1 was slightly decreased in the Ossgo1-1 mutant (Figure S3). Additionally, by performing RT-PCR, we found that the Ossgo1-1 cDNA sequence is altered downstream of the Tos17-insertion position by the addition of 71 nucleotides, and the whole cDNA lacks a stop codon (Figure S5). Additionally, we identified an allelic mutant of Ossgo1-1 with a deletion of 15 bp (nucleotides 1773–1787 in the gene) from the mutants induced by 60Co�c-ray radiation and named as Ossgo1-2 (Figure S1), which results in five amino acids missing in OsSGO1. The homozygous Ossgo1-2 mutant was also normal in the vegetative stage but completely sterile (Figure S4). Neither of the mutants set seeds when pollinated with pollen from the wild-type plants [2].<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
===Knowledge Extension===<br />
Please input evolution information here.<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*Cloning the full-lengthOsSGO1cDNA<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Construction of theOsSGO1RNA interference cassette and rice transformation<br />
*Antibody production and protein gel blot analysis<br />
*Meiotic chromosome preparation and FISH<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Immunofluorescence<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os02g0799100|<br />
Description = Hypothetical protein|<br />
Version = NM_001186253.1 GI:297721638 GeneID:9266998|<br />
Length = 3610 bp|<br />
Definition = Oryza sativa Japonica Group Os02g0799100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|<br />
AP = Chromosome 2:34917690..34921299|<br />
CDS = 34920472..34920601,34920706..34920743,34920892..34921040,34921133..34921148|<br />
GCID = <gbrowseImage1><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcggccgctgcaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggagaacgccaagttgcgtcatctgcttgctgagcgaaacaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattag</cdnaseq>|<br />
AA = <aaseq>MAAAAGAAARGGGVIPAGKGGSLRSPGKPVVLADITNTGRPNPT GSVHAIADVLKENAKLRHLLAERNKVIEVSRVELQKIRLALQAMQQKNLQLVQANSQM FAVCLLIH</aaseq>|<br />
DNA = <dnaseqindica>699..828#557..594#260..408#152..167#tctccgaaacctcatcggattcctctccgcgcggctaccggagcgccgcctctctctccccgcgcgcgcgctgcggctccgagggtcctcgccggcttcacctccggcggtggcgtgcgcaaccacaggccccgcggccgctgggccagccatggcggccgctgcaggtaaaaatcgtatcccctagatttcgagctacccgtggcattccatggtggggttctctcgggctcagcttccgcacctcctcctaaaccaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggtgatttcagttctagctctattttttttttcttcgggggatttcggttctaactcaaacaagcagacaaccctagcagcgccaagttgaatgctagtaattccgatttccatccgattaaaccatttaattcctcccttgctttcaggagaacgccaagttgcgtcatctgcttgctgagcgaaagtatgcattgcctctaccatccattttgttgtcggaggataaaacctgcggtttctcaagtagcacagttttttttaaattattttttgctttcttatttgcagcaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattagctccctacctcaccattcttgtgtcaatgtttgtttatacttgtgcaatgctggttcaccaggcctgtaggttgagcacatagtttgagttatagctatgcataatggcaaatgagaagtgtttgtcttacttcattgctgattgttttgtggtagttacagactgtttgatatgtctatgttttcttcttccttgcaggaaataaatcaaggaaaagatagagtaagctgcctctggttctttgttgtttgaattttcaaatgcagtatgatttctgatttggggattaatctgtggatatgacatgcagatcaagttattgcaacatgaacttgcatgcacaatagccgtgctcaaagtaaagggttctgaactcgaggtaattctaaagcttgactgtatgaacctctgtttgttacatataacatgcttttctcatcgtctactattgcagaagatgagtaagacttctaacaatcaacaaaatagagcaaagatattggtatgcagtcaaattcttaagcaaatgattcaccatgtttagctgcattatttctagttctgaattctgaaatcgttctgttcgtgcaacataatcaggagaaaaaaaccaggtcttccaaatgcgcaccaactaaggctcatcaaatggctgcaggttctattagagaacatttggttgaaattcaatgtaatgctcactcttctcactatttctttcttgaactagatactatacctggcaatcgtttcatctatcctactttatggttataatttaccccctttatatgaagcaattgaagttttatgttttttcctctgccataagttaggacactagtaaaattctaatcttcatttgttgccaatttcttctcagcagctgtgccatcttatactagctgtcatgagcctccacaggataaaacaaacaagaggtattttcatctctttactgatgtttgagtgggtgactggttgaccgggttatagtagcctatttcatgcatcactacttattcagcatgtttgcaaacaggtgcacaaataggcggaagtcagaatcatgtgaagttacaatggataccaacacagtgcaacatagctgcagacctcatgtggaatataatgggtcatcgcatgatgatgatccaaggtaatcaatgcttaatgcttataacagaatgcgttcattgttgcatcattatctgatttaagcttgttcaaaactcttgggcacatgtggtcagaaaaactcgacggagaaggtctgccagattgaaccctggatcttttgaggtcgcagagatctgtgataaattgcatgaggatgctactgttccttcggctcctagttctaatgttccaaagctgcaggaaccaaatgctggaaaagatatggtagggttttactatttctttctgtttttctgtttcaaaaaaaatttcacaatgtggttatgattttgtgctagatttgtggtggcaagatgaagtcattgcaaaaagaacttccatgtgatgcaatagcgcaagtagtagaggctccagaactcaaggtaattgagcagagtggttcgcatcaaatttttgctagtcttacatatattaatttattttttagtaaaatctggatcctgattgtatgtactagaaaaaacgaagtatgcacacacaaaaggaagtgtatctggaggtgggcaggacagttcttatgtaaataatcctcacatttatccatgaagaagtcttaattcttattatgttcctacttctttcgtccaatgaaattaggagatacaagaagcaggttccagcgttgctggaggtgaggcgcataaatttgatattgaggatccagagccaccaaggtatggcacatcattttagcagggtttaagatgcatggtacatcacacaattcacctaaacaatatgctctgtccaatcagaaaatcaatgcgtattgatgcaaacaaacggaagctggaatcatttgagagtcgattggcctcgaacaaagaggactgcatcaatgccatatgcgactcaacttcaagcgtgccaattcagcatgaacaaaagaggtaactctctcctatattccaacgatgcactttcctctgcatggaacatgtcaatcatggctgcccttaatactgcagaaaattgtcaaggagaaaatcctcaagactggaccctggaccttgggaggtcacaaatggcacttttgaaattgtccaggaagatacagttgccccgtctgctccttccagttcaaatgctttgatcgagcagaccaaaaatgatatgcaaaacgaccgcagttgctcgactaaaccttctgacgagcaggtgataggtagaagatcttcagttgggaggccctcaagacgggcagcagaaaagatagtctcctacaaggaggtgcccttgaatattaagatgcgacgaccatgatccccacttgcatgcaaagagcacaaacaccattggcatttattttatggtgtagaatcaagtttgttgtgtatctatctgttttggtcgctgtcaataggtaggttagctcctctatctaccccaacatggatactcaccctgcatcccagtttcaaactgaccatggaatttatctgatttagcctcagtctggactgatgatgccgataacaaccagcaaaccattgttcctgttctgatgaagtagagaccagacaacaataatgtggttagtactgttttattttcttgatggttctcatatgttgagagatc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186253.1 RefSeq:Os02g0799100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 2]]<br />
[[Category:Chromosome 2]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0799100&diff=174705Os02g07991002014-05-30T15:38:57Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
Os02g0799100 is the rice(Oryza sativa) homologue of the maize Sgo1 gene. It encodes an homolog of shugoshin protein ZmSGO1 in maize (Zea mays), named OsSGO1. The gene OsSGO1 is essential for rice meiosis and plays an important role in protecting centromeric cohesion during meiosis. The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophaseⅠand anaphase II, respectively, which finally leads to sterile pollen formation.And the OsSGO1 localizes to centromere from the result of immunostaining experiments[1]. In addition to the meiosisspecific maintenance of centromeric cohesion, OsSGO1 is required for the timely assembly and maintenance of SCs during early prophase I. Furthermore, the centromeric localization of OsSGO1 depends on OsAM1[2]. OsAM1 is the homolog of Arabidopsis SWI1 and maize AM1 in rice and is required for the leptotene–zygotene transition (Che et al., 2011).<br />
===Mutation===<br />
An OsSGO1-RNAi vector is transformed into rice calli by Agrobacterium-mediated DNA transfer. OsSGO1-RNAi lines isobtained by screening the plants regenerated from the transformed calli by PCR[1]. One single Tos17-insertion mutant line of the OsSGO1 gene, Ossgo1-1, was identified by screening the public insertion line collections. Sequence analysis of its PCR products confirmed that Tos17 was inserted into exon 15, only 5 bp upstream from the stop codon (Figure S1) [2].<br />
<br />
===Expression===<br />
OsSGO1 is expressed most highly in the roots, secondly in the panicles, and at a relatively low level in leaves (Figure S3) [2]. <br />
The knockdown of OsSGO1 may cause precocious disassociation and random segregation of sister chromatids at telophase Ⅰand anaphase II, respectively, which finally leads to sterile pollen formation[1]. The homozygous Ossgo1-1 mutant grew normally in the vegetative stage but was sterile during the flowering phase, and its pollen was completely non-viable when evaluated by 1% I2-KI solution staining (Figure S4). The transcription level of OsSGO1 was slightly decreased in the Ossgo1-1 mutant (Figure S3). Additionally, by performing RT-PCR, we found that the Ossgo1-1 cDNA sequence is altered downstream of the Tos17-insertion position by the addition of 71 nucleotides, and the whole cDNA lacks a stop codon (Figure S5). Additionally, we identified an allelic mutant of Ossgo1-1 with a deletion of 15 bp (nucleotides 1773–1787 in the gene) from the mutants induced by 60Co�c-ray radiation and named as Ossgo1-2 (Figure S1), which results in five amino acids missing in OsSGO1. The homozygous Ossgo1-2 mutant was also normal in the vegetative stage but completely sterile (Figure S4). Neither of the mutants set seeds when pollinated with pollen from the wild-type plants [2].<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
===Knowledge Extension===<br />
Please input evolution information here.<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*Cloning the full-lengthOsSGO1cDNA<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Construction of theOsSGO1RNA interference cassette and rice transformation<br />
*Antibody production and protein gel blot analysis<br />
*Meiotic chromosome preparation and FISH<br />
*Real-time PCR for transcript expression assay<br />
*Tos17insertion site mapping<br />
*Computational and database analysis<br />
*Immunofluorescence<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os02g0799100|<br />
Description = Hypothetical protein|<br />
Version = NM_001186253.1 GI:297721638 GeneID:9266998|<br />
Length = 3610 bp|<br />
Definition = Oryza sativa Japonica Group Os02g0799100, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|<br />
AP = Chromosome 2:34917690..34921299|<br />
CDS = 34920472..34920601,34920706..34920743,34920892..34921040,34921133..34921148|<br />
GCID = <gbrowseImage1><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008395:34917690..34921299<br />
source=RiceChromosome02<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggcggccgctgcaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggagaacgccaagttgcgtcatctgcttgctgagcgaaacaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattag</cdnaseq>|<br />
AA = <aaseq>MAAAAGAAARGGGVIPAGKGGSLRSPGKPVVLADITNTGRPNPT GSVHAIADVLKENAKLRHLLAERNKVIEVSRVELQKIRLALQAMQQKNLQLVQANSQM FAVCLLIH</aaseq>|<br />
DNA = <dnaseqindica>699..828#557..594#260..408#152..167#tctccgaaacctcatcggattcctctccgcgcggctaccggagcgccgcctctctctccccgcgcgcgcgctgcggctccgagggtcctcgccggcttcacctccggcggtggcgtgcgcaaccacaggccccgcggccgctgggccagccatggcggccgctgcaggtaaaaatcgtatcccctagatttcgagctacccgtggcattccatggtggggttctctcgggctcagcttccgcacctcctcctaaaccaggggcagcggcgcgcggtggcggtgtgatcccggccggtaagggtggcagccttcggtcgccggggaaacccgtcgtgctcgccgacatcaccaacaccgggaggcccaaccctactggatccgtccacgccatcgctgacgtcctcaaggtgatttcagttctagctctattttttttttcttcgggggatttcggttctaactcaaacaagcagacaaccctagcagcgccaagttgaatgctagtaattccgatttccatccgattaaaccatttaattcctcccttgctttcaggagaacgccaagttgcgtcatctgcttgctgagcgaaagtatgcattgcctctaccatccattttgttgtcggaggataaaacctgcggtttctcaagtagcacagttttttttaaattattttttgctttcttatttgcagcaaagtcattgaagtcagcagagtagagttgcagaaaatccgcctcgcactgcaagccatgcagcagaagaacttgcaactcgtgcaggctaattcgcagatgtttgcggtttgtctacttatccattagctccctacctcaccattcttgtgtcaatgtttgtttatacttgtgcaatgctggttcaccaggcctgtaggttgagcacatagtttgagttatagctatgcataatggcaaatgagaagtgtttgtcttacttcattgctgattgttttgtggtagttacagactgtttgatatgtctatgttttcttcttccttgcaggaaataaatcaaggaaaagatagagtaagctgcctctggttctttgttgtttgaattttcaaatgcagtatgatttctgatttggggattaatctgtggatatgacatgcagatcaagttattgcaacatgaacttgcatgcacaatagccgtgctcaaagtaaagggttctgaactcgaggtaattctaaagcttgactgtatgaacctctgtttgttacatataacatgcttttctcatcgtctactattgcagaagatgagtaagacttctaacaatcaacaaaatagagcaaagatattggtatgcagtcaaattcttaagcaaatgattcaccatgtttagctgcattatttctagttctgaattctgaaatcgttctgttcgtgcaacataatcaggagaaaaaaaccaggtcttccaaatgcgcaccaactaaggctcatcaaatggctgcaggttctattagagaacatttggttgaaattcaatgtaatgctcactcttctcactatttctttcttgaactagatactatacctggcaatcgtttcatctatcctactttatggttataatttaccccctttatatgaagcaattgaagttttatgttttttcctctgccataagttaggacactagtaaaattctaatcttcatttgttgccaatttcttctcagcagctgtgccatcttatactagctgtcatgagcctccacaggataaaacaaacaagaggtattttcatctctttactgatgtttgagtgggtgactggttgaccgggttatagtagcctatttcatgcatcactacttattcagcatgtttgcaaacaggtgcacaaataggcggaagtcagaatcatgtgaagttacaatggataccaacacagtgcaacatagctgcagacctcatgtggaatataatgggtcatcgcatgatgatgatccaaggtaatcaatgcttaatgcttataacagaatgcgttcattgttgcatcattatctgatttaagcttgttcaaaactcttgggcacatgtggtcagaaaaactcgacggagaaggtctgccagattgaaccctggatcttttgaggtcgcagagatctgtgataaattgcatgaggatgctactgttccttcggctcctagttctaatgttccaaagctgcaggaaccaaatgctggaaaagatatggtagggttttactatttctttctgtttttctgtttcaaaaaaaatttcacaatgtggttatgattttgtgctagatttgtggtggcaagatgaagtcattgcaaaaagaacttccatgtgatgcaatagcgcaagtagtagaggctccagaactcaaggtaattgagcagagtggttcgcatcaaatttttgctagtcttacatatattaatttattttttagtaaaatctggatcctgattgtatgtactagaaaaaacgaagtatgcacacacaaaaggaagtgtatctggaggtgggcaggacagttcttatgtaaataatcctcacatttatccatgaagaagtcttaattcttattatgttcctacttctttcgtccaatgaaattaggagatacaagaagcaggttccagcgttgctggaggtgaggcgcataaatttgatattgaggatccagagccaccaaggtatggcacatcattttagcagggtttaagatgcatggtacatcacacaattcacctaaacaatatgctctgtccaatcagaaaatcaatgcgtattgatgcaaacaaacggaagctggaatcatttgagagtcgattggcctcgaacaaagaggactgcatcaatgccatatgcgactcaacttcaagcgtgccaattcagcatgaacaaaagaggtaactctctcctatattccaacgatgcactttcctctgcatggaacatgtcaatcatggctgcccttaatactgcagaaaattgtcaaggagaaaatcctcaagactggaccctggaccttgggaggtcacaaatggcacttttgaaattgtccaggaagatacagttgccccgtctgctccttccagttcaaatgctttgatcgagcagaccaaaaatgatatgcaaaacgaccgcagttgctcgactaaaccttctgacgagcaggtgataggtagaagatcttcagttgggaggccctcaagacgggcagcagaaaagatagtctcctacaaggaggtgcccttgaatattaagatgcgacgaccatgatccccacttgcatgcaaagagcacaaacaccattggcatttattttatggtgtagaatcaagtttgttgtgtatctatctgttttggtcgctgtcaataggtaggttagctcctctatctaccccaacatggatactcaccctgcatcccagtttcaaactgaccatggaatttatctgatttagcctcagtctggactgatgatgccgataacaaccagcaaaccattgttcctgttctgatgaagtagagaccagacaacaataatgtggttagtactgttttattttcttgatggttctcatatgttgagagatc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001186253.1 RefSeq:Os02g0799100]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 2]]<br />
[[Category:Chromosome 2]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=174678Os01g02573002014-05-30T15:16:42Z<p>Lizhitao: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating<br />
root development yet.OsRAA1 Regulates Primary Root Development by Modulating Mitosis. OsRAA1 may function at the transition from metaphase to anaphase during cell division.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
Immunoassay of a cell line with GFP alone showed immunofluorescence in the whole cell during the cell cycle.In contrast, in the OsRAA1-GFP transgenic line, OsRAA1 GFP was enriched at spindles, including tubulins, from metaphase to anaphase during cell division<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*OsRAA1 Interaction Protein Screening<br />
*OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo<br />
*Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells<br />
*Degradation of OsRAA1 Depends on the Proteasome<br />
*Two-Hybrid cDNA Library Construction and Screening<br />
*Protein Deletion Mutation and Yeast Plasmid Construction<br />
*Pull-Down Assay<br />
*Immunofluorescence of Rice Root Tips<br />
*Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis<br />
*Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line<br />
*Transient Subcellular Localization<br />
*Determination of the Half-Life of OsRAA1<br />
*Protein Degradation Assay in Vitro<br />
*Morphological Examination of Transformed S. pombeCells<br />
<br />
==References==<br />
Please input cited references here.<br />
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=174676Os01g02573002014-05-30T15:13:59Z<p>Lizhitao: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating<br />
root development yet.OsRAA1 Regulates Primary Root Development by Modulating Mitosis. OsRAA1 may function at the transition from metaphase to anaphase during cell division.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*OsRAA1 Interaction Protein Screening<br />
*OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo<br />
*Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells<br />
*Degradation of OsRAA1 Depends on the Proteasome<br />
*Two-Hybrid cDNA Library Construction and Screening<br />
*Protein Deletion Mutation and Yeast Plasmid Construction<br />
*Pull-Down Assay<br />
*Immunofluorescence of Rice Root Tips<br />
*Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis<br />
*Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line<br />
*Transient Subcellular Localization<br />
*Determination of the Half-Life of OsRAA1<br />
*Protein Degradation Assay in Vitro<br />
*Morphological Examination of Transformed S. pombeCells<br />
<br />
==References==<br />
Please input cited references here.<br />
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=174674Os01g02573002014-05-30T15:10:14Z<p>Lizhitao: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating<br />
root development yet.OsRAA1 Regulates Primary Root Development by Modulating Mitosis.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*OsRAA1 Interaction Protein Screening<br />
*OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo<br />
*Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells<br />
*Degradation of OsRAA1 Depends on the Proteasome<br />
*Two-Hybrid cDNA Library Construction and Screening<br />
*Protein Deletion Mutation and Yeast Plasmid Construction<br />
*Pull-Down Assay<br />
*Immunofluorescence of Rice Root Tips<br />
*Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis<br />
*Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line<br />
*Transient Subcellular Localization<br />
*Determination of the Half-Life of OsRAA1<br />
*Protein Degradation Assay in Vitro<br />
*Morphological Examination of Transformed S. pombeCells<br />
<br />
==References==<br />
Please input cited references here.<br />
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=174671Os01g02573002014-05-30T15:03:58Z<p>Lizhitao: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating<br />
root development yet.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*OsRAA1 Interaction Protein Screening<br />
*OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo<br />
*Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells<br />
*Degradation of OsRAA1 Depends on the Proteasome<br />
*Two-Hybrid cDNA Library Construction and Screening<br />
*Protein Deletion Mutation and Yeast Plasmid Construction<br />
*Pull-Down Assay<br />
*Immunofluorescence of Rice Root Tips<br />
*Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis<br />
*Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line<br />
*Transient Subcellular Localization<br />
*Determination of the Half-Life of OsRAA1<br />
*Protein Degradation Assay in Vitro<br />
*Morphological Examination of Transformed S. pombeCells<br />
<br />
==References==<br />
Please input cited references here.<br />
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=174669Os01g02573002014-05-30T15:03:28Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating<br />
root development yet.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
*OsRAA1 Interaction Protein Screening<br />
*OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo<br />
*Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells<br />
*Degradation of OsRAA1 Depends on the Proteasome<br />
*Two-Hybrid cDNA Library Construction and Screening<br />
*Protein Deletion Mutation and Yeast Plasmid Construction<br />
*Pull-Down Assay<br />
*Immunofluorescence of Rice Root Tips<br />
*Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis<br />
*Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line<br />
*Transient Subcellular Localization<br />
*Determination of the Half-Life of OsRAA1<br />
*Protein Degradation Assay in Vitro<br />
*Morphological Examination of Transformed S. pombeCells<br />
<br />
==References==<br />
Please input cited references here.<br />
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity<br />
Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=174666Os01g02573002014-05-30T14:58:02Z<p>Lizhitao: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating<br />
root development yet.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity<br />
Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0257300&diff=174665Os01g02573002014-05-30T14:57:12Z<p>Lizhitao: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating<br />
root development yet.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
*Ye Han;Hong Cao;Jiafu Jiang;Yunyuan Xu;Jizhou Du;Xin Wang;Ming Yuan;Zhiyong Wang;Zhihong Xu and Kang Chong<br />
Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855<br />
*Lei Ge;Hui Chen;Jia-Fu Jiang;Yuan Zhao;Ming-Li Xu;Yun-Yuan Xu;Ke-hui Tan;Zhi-Hong Xu and Kang Chong<br />
Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity<br />
Plant Physiology, 2004, 135(3): 1502-1513<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os01g0257300|<br />
Description = Conserved hypothetical protein|<br />
Version = NM_001049166.1 GI:115435745 GeneID:4326229|<br />
Length = 785 bp|<br />
Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|<br />
AP = Chromosome 1:8585137..8585921|<br />
CDS = 8585497..8585826|<br />
GCID = <gbrowseImage1><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008394:8585137..8585921<br />
source=RiceChromosome01<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>|<br />
AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>|<br />
DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 1]]<br />
[[Category:Chromosome 1]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0512200&diff=174662Os07g05122002014-05-30T14:47:48Z<p>Lizhitao: </p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
<br />
An essential protein in the yeast or Arabidopsis autophagic pathway is Atg8. OsAtg8 conjugation pathway may be conserved in rice and may play important roles in rice autophagy.[1]<br />
<br />
Autophagy occurs at low basal levels in virtually all cells to perform homeostatic functions such as protein and organelle turnover. It is rapidly upregulated when cells need to generate intracellular nutrients and energy, for example, during starvation or high bioenergetic demands. Autophagy is also upregulated when cells are preparing to undergo structural remodeling such as during developmental transitions or to rid themselves of damaging cytoplasmic components, for example, during oxidative stress, infection, or protein aggregate accumulation. Nutritional status, hormonal factors, and other cues like temperature, oxygen concentrations, and cell density are important in the control of autophagy. [2]<br />
<br />
===Expression===<br />
<br />
<br />
OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]<br />
<br />
===Evolution===<br />
The formation of the autophagosome is carried out by a set of autophagy-related proteins (Atg), highly conserved from yeast to mammals. The Atg8s play an essential role in autophagosome biogenesis. This family of proteins comprises a single member in yeast and several mammalian homologues.[3]<br />
<br />
A recent genome-wide search revealed significant conservation among autophagy genes (Atgs) in yeast and Arabidopsis, indicating that the molecular basis of autophagy is well conserved in yeast and plants. In Arabidopsis, 25 Atg genes that are homologous to 12 of yeast Atg genes were found [4]. Among them, AtAtg7 and AtAtg9 have been shown to be involved in Arabidopsis autophagy [5], AtAtg8 and AtAtg4 are essential for Arabidopsis autophagy [6].<br />
<br />
==Labs working on this gene==<br />
Wei Su, Haijie Ma, Chao Liu, Jiaxu Wu<br />
Institute of Genetics, State Key Laboratory of Genetic<br />
Engineering, School of Life Sciences, Fudan University, 220<br />
Handan Road, Shanghai 200433, China<br />
*Plasmid construction and site-directed mutagenesis<br />
*Semi-quantitative RT-PCR analysis<br />
*Yeast transformation and western blotting<br />
*Yeast two-hybrid interaction analysis<br />
*Identification and isolation of OsAtg8 and OsAtg4<br />
<br />
==References==<br />
[1]Wei Su ,Haijie Ma ,etc.(2006)Identification and characterization of two rice autophagy associated genes, OsAtg8 and OsAtg4.Mol Biol Rep (2006) 33:273–278<br />
<br />
[2]Beth Levine and Guido Kroemer.(2008)Autophagy in the Pathogenesis of Disease.Cell 132, January 11, 2008<br />
<br />
[3]Slobodkin MR1, Elazar Z.(2013)The Atg8 family: multifunctional ubiquitin-like key regulators of autophagy.Essays Biochem. 2013;55:51-64.<br />
<br />
[4]Hanaoka H, Noda T, Shirano Y, Kato T, Hayashi H, Shibata D, Tabata S, Ohsumi Y (2002) Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene. Plant Physiol 129:1181–1193<br />
<br />
[5]Doelling JH, Walker JM, Friedman EM, Thompson AR, Vierstra RD (2002) The APG8/12-activating enzyme APG7 is required for proper nutrient recycling and senescence in Arabidopsis thaliana. J Biol Chem 277:33105–33114<br />
<br />
[6]Yoshimoto K, Hanaoka H, Sato S, Kato T, Tabata S, Noda T, Ohsumi Y (2004) Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for<br />
plant autophagy. Plant Cell 16:2967–2983<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os07g0512200|<br />
Description = Similar to Symbiosis-related like protein|<br />
Version = NM_001066302.1 GI:115472336 GeneID:4343365|<br />
Length = 2701 bp|<br />
Definition = Oryza sativa Japonica Group Os07g0512200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|<br />
AP = Chromosome 7:20285683..20288383|<br />
CDS = 20286147..20286241,20286327..20286445,20286846..20286898,20286988..20287043,20288034..20288070<br>|<br />
GCID = <gbrowseImage1><br />
name=NC_008400:20285683..20288383<br />
source=RiceChromosome07<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008400:20285683..20288383<br />
source=RiceChromosome07<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggccaggacttccttcaagctcgagcacccactggaaaggaggcaagcagaatctgccaggatccgtgagaagtactcagacagaattccggtgatcgttgagaaggctgacaagaccgatgttccagaaattgacaaaaagaagtaccttgtccctgctgatcttactgttggccagtttgtctatgtggttcggaagaggattaagcttagcccagaaaaggccatctttgtctttgtgaagaacacattgccgccaactgcttctttgatgtctgcaatctacgaagagaacaaggatgaggacggcttcctctacatgacttacagtggcgagaacacattcggctctgcgtaa</cdnaseq>|<br />
AA = <aaseq>MARTSFKLEHPLERRQAESARIREKYSDRIPVIVEKADKTDVPE IDKKKYLVPADLTVGQFVYVVRKRIKLSPEKAIFVFVKNTLPPTASLMSAIYEENKDE DGFLYMTYSGENTFGSA</aaseq>|<br />
DNA = <dnaseqindica>2143..2237#1939..2057#1486..1538#1341..1396#314..350#aaaccctaccgcgacttccttccttccttccggttgcttccgccgatcgacttctcgccccccaaatcgattcgccccccgcctcgatctatcgattccgcggcagcgccccttcgatcggtgagcctctcgtctcgatcccccaacggagccggccgaattcgcgaggattcgggaggttttccctctgcgttcgtttctgcggatgatttgttttttttttcttttggtggatcggtttgatcgaggggagacgttgaccttgggggtttgtttctgatgatcgattgatgatttgattcgcaggttggagatggccaggacttccttcaagctcgagcacccactgggtttgttgcttcttctctctcgccccattacctctttgccctgtcaatttgttgcgattaggttgcaatctgtgattcgatcgatggtgtggtggtagattgattgcgagtttgtagatgggcgttttataatcggaactagctttgcgtttttgtgtggtatatgatgatctgattgtagattatatatgagtactacttttgtggagactgccttgtgtgtgggattgttttgtcgggcgttgtgtttgttgttggagtatgatttggcccacccaaggattgattttttcttttggttgcgtgtgttgcatattggtcttgagctgttttttagttgcagaagaggactctgtagtttacggtcgcttgtttccagaacaaaagtttaaactctgggatacttgttttattcccagttgcaaaagggtttttcatcatattcggactaacacaatgcttattgtatagatttttgtcggtagttctattactcgtaacacaatgcttattcttcggtagttccattactcgtggcagataacatcaaatgtccaattaagcaaacatatttgttcttgttgatctagtctgttttatgattgaattgtgttcaatgcgcattgttgtttcaataataaactgtttcatgtattgaacttgtttacttcagtcttcaatatatcatgattctcttgattagcagtaccctgtttactggtggttggaacatgctgtactttgtatttatttgattgagccttgaacatatttgctaatctaagaaaagctagcttgtacaagaggttgagatgatattttttcttctatttatctgctttacacttagcacagattacccctaattccattagtgtagcagaaccaactgtgaaaagaaaaaaaaaacattcccgactatgtttatgtcaaccacatgtaatttgcatatagcatcttatgatgtttgtattttgaatgatattgcagaaaggaggcaagcagaatctgccaggatccgtgagaagtactcagacagaattccggtaatatatctctgctgtttactttttcgtttgtgcatatctcctatatgcatctgtcttatcaaaaattctgcgatatgctatttcaggtgatcgttgagaaggctgacaagaccgatgttccagaaattgacaaaaagaagtaagctttcttttccacatctcctttattatgacgggagatgttctatctcatggttgcttatatcagctactaaagctttttttttatgtatgagagggcttccatttttcctctcctttttaacacctgctttagttggaggaagataaaataggagcaacttttctttcacattgggttctatctaactcaatcaggcctaatttcgctttagatgtcctgtattctctggaatttggcttgctatgttctatttgtttggttagtacttagtactctttatttatgttgcttattgacttagaatacccaggcatctgctattaattgaattgaaatcctgaaatattaaccttctcttggatacacacatctttgttttttttttctgatgtaggtaccttgtccctgctgatcttactgttggccagtttgtctatgtggttcggaagaggattaagcttagcccagaaaaggccatctttgtctttgtgaagaacacattgccgccaactggtaaattcattgttcttgatttgtcattgtcatatcacctacccttttggtttccttatattttgcgcatacattctattggcagcttctttgatgtctgcaatctacgaagagaacaaggatgaggacggcttcctctacatgacttacagtggcgagaacacattcggctctgcgtaattcatcaactgttgctgctgctgtaaataaacatggatggccaggtgtcatggtcaacctcctgtgtacatagcatgtccctgtgctggattgcctcaatggtctaatgcgtccttagctttttaagtggttcgtatgctatcgtttgaaagttggaacgacccatagaactgatattattcattctgggttgatgacgtttcttattctaccattatgcatttgcaacgtgttttaagtctgaagtgtgattgggcgtttcaatttcagttatctgttatcattgttaattgcaactgattcaggccaataagaaatcaaggccttcttaatcgtcatatctcgcatggttgcacgcatgattgttttttttttttggtagttgttgttgatgttggagactgcaccgtgttttcttctcgtctcattccatcagttattttcattttatcaatttggtgttt</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066302.1 RefSeq:Os07g0512200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 7]]<br />
[[Category:Chromosome 7]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=174654Os12g01016002014-05-30T14:38:21Z<p>Lizhitao: /* References */</p>
<hr />
<div><br />
==Annotated Information==<br />
narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was<br />
remarkably reduced to almost a half of wild-type. The number of SVs between LVs was quite irregular in each leaf blade, and the vein distribution on the left and right side of the midrib was different. Sawtooth hairs at the leaf margins were significantly reduced (Fig. 1d). Ligule, auricle, leaf sheath and stems were also<br />
narrower and thinner (Fig. 1e,f; Table S2). Despite the reduction in leaf width, the lengths of leaf blades and leaf sheaths, and plant height were similar to wild-type (Table S2). These results indicate that NAL2/3function is mainly associated with vein patterning during leaf development and lateral-axis expansion during shoot organogenesis<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
<br />
=== Knowledge Extension ===<br />
map-based cloning to identifyNAL2and NAL3on chromosomes 11 and 12, respectively. They encode an identical OsWOX3A/OsNS protein that is homologous to NS of<br />
maize and PRS of Arabidopsis, all of which belong to the same WOX3subfamily (Figs S5b, S6; Zhang et al., 2007). Both NS andPRSplay an important role in the recruitment of founder cells for margin development of lateral organ primordia in monocots and eudicots, respectively (Nardmann et al., 2004). However, the functions ofNS/PRShomologues in other plant species remain unknown. Our histological and molecular studies show that in rice, OsWOX3Ais involved in differentiation of lemma and palea in spikelets, and tiller and LR production, in addition to lateral-axis expansion in leaves.<br />
Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions. <br />
== Labs working on this gene ==<br />
*Histological analysis of leaves and spikelets<br />
*Genetic and physical mapping of nal2and nal3<br />
*Membrane protein extraction and immunoblot analysis<br />
*Rice transformation and complementation<br />
*Histochemical analysis of OsWOX3A expression<br />
*RNA extraction, reverse transcription and quantitative real-time PCR (qRT-PCR)<br />
*Subcellular localization of the OsWOX3-GFP fusion protein in protoplasts<br />
*Transcriptional activation in the yeast GAL4 system<br />
*Scanning electron microscopy<br />
*Defects in lateral-axis outgrowth, margin development and vascular patterning during leaf development<br />
*Defective lemma and palea morphogenesis during spikelet development innal2/3<br />
*Map-based cloning ofnal2andnal3loci<br />
*OsWOX3Ain lamina outgrowth and vascular patterning<br />
<br />
== References ==<br />
. Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek<br />
The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development<br />
New Phytologist, 2013, 198(4): 1071-1084<br />
.Angeles-Shim RB, Asano K, Takashi T, Shim J, Kuroha T, Ayano M, Ashikari M. 2012.A WUSCHEL-related homeobox 3B gene,depilous(dep), confersglabrousness of rice leaves and glumes.Rice5: 28. <br />
.Chen Y, Fan X, Song W, Zhang Y, Xu G. 2012.Over-expression ofOsPIN2 leads to increased tiller numbers, angle and shorter plant height through suppression ofOsLAZY1.Plant Biotechnology Journal10: 139–149<br />
. Dai M, Hu Y, Zhao Y, Liu H, Zhou DX. 2007.AWUSCHEL-LIKE HOMEOBOXgene represses aYABBYgene expression required for rice leaf development.Plant Physiology144: 380–390<br />
.Zhang X, Madi S, Borsuk L, Nettleton D, Elshire RJ, Buckner B, JanickBuckner D, Beck J, Timmermans M, Schnable PSet al.2007.Laser microdissection of narrow sheath mutant maize uncovers novel gene expression in the shoot apical meristem.PLoS Genetics3: 1040–1052.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=174645Os12g01016002014-05-30T14:09:40Z<p>Lizhitao: </p>
<hr />
<div><br />
==Annotated Information==<br />
narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was<br />
remarkably reduced to almost a half of wild-type. The number of SVs between LVs was quite irregular in each leaf blade, and the vein distribution on the left and right side of the midrib was different. Sawtooth hairs at the leaf margins were significantly reduced (Fig. 1d). Ligule, auricle, leaf sheath and stems were also<br />
narrower and thinner (Fig. 1e,f; Table S2). Despite the reduction in leaf width, the lengths of leaf blades and leaf sheaths, and plant height were similar to wild-type (Table S2). These results indicate that NAL2/3function is mainly associated with vein patterning during leaf development and lateral-axis expansion during shoot organogenesis<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
<br />
=== Knowledge Extension ===<br />
map-based cloning to identifyNAL2and NAL3on chromosomes 11 and 12, respectively. They encode an identical OsWOX3A/OsNS protein that is homologous to NS of<br />
maize and PRS of Arabidopsis, all of which belong to the same WOX3subfamily (Figs S5b, S6; Zhang et al., 2007). Both NS andPRSplay an important role in the recruitment of founder cells for margin development of lateral organ primordia in monocots and eudicots, respectively (Nardmann et al., 2004). However, the functions ofNS/PRShomologues in other plant species remain unknown. Our histological and molecular studies show that in rice, OsWOX3Ais involved in differentiation of lemma and palea in spikelets, and tiller and LR production, in addition to lateral-axis expansion in leaves.<br />
Recently,OsWOX3B/DEP, a homologue of OsWOX3A, has been reported to regulate the formation of bristle-type trichomes in the leaves and glumes (Angeles-Shim et al., 2012). Although they belong to the same subfamily of OsWOX proteins (Fig. S6), the biological function of OsWOX3B/DEP was considerably different from that of OsWOX3A, suggesting that riceWOX3genes within the same subfamily may have diversified to have separate biological functions. <br />
== Labs working on this gene ==<br />
*Histological analysis of leaves and spikelets<br />
*Genetic and physical mapping of nal2and nal3<br />
*Membrane protein extraction and immunoblot analysis<br />
*Rice transformation and complementation<br />
*Histochemical analysis of OsWOX3A expression<br />
*RNA extraction, reverse transcription and quantitative real-time PCR (qRT-PCR)<br />
*Subcellular localization of the OsWOX3-GFP fusion protein in protoplasts<br />
*Transcriptional activation in the yeast GAL4 system<br />
*Scanning electron microscopy<br />
*Defects in lateral-axis outgrowth, margin development and vascular patterning during leaf development<br />
*Defective lemma and palea morphogenesis during spikelet development innal2/3<br />
*Map-based cloning ofnal2andnal3loci<br />
*OsWOX3Ain lamina outgrowth and vascular patterning<br />
<br />
== References ==<br />
. Sung-Hwan Cho;Soo-Cheul Yoo;Haitao Zhang;Devendra Pandeya;Hee-Jong Koh;Ji-Young Hwang;Gyung-Tae Kim;Nam-Chon Paek<br />
The rice narrow leaf2 and narrow leaf3 loci encode WUSCHEL-related homeobox 3A (OsWOX3A) and function in leaf, spikelet, tiller and lateral root development<br />
New Phytologist, 2013, 198(4): 1071-1084</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=174642Os12g01016002014-05-30T13:21:08Z<p>Lizhitao: /* Annotated Information */</p>
<hr />
<div><br />
==Annotated Information==<br />
narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2/3double mutant was named for its phenotype: the production of narrow leaf blades throughout development. These loci were also termed curly leaf2 (cul2) andcul3, respectively, in the GRAMENE database (http://www.gramene.org/) because the leaf blades exhibited both narrow and curly phenotypes. The singlenal2ornal3mutants did not show any defect in leaf morphology. Compared with the parental wildtype cv ‘Kinmaze’, the widths of leaf blades innal2/3were consistently narrow from early seedling to fully mature stages (Fig. 1a,b; Table S2). In addition, the nal2/3 leaves curled upward(Fig. 1b). The number of large veins (LVs) in the leaf blades wasslightly reduced to c. 80% of wild-type (Fig. 1c; Table S2), and the number of small veins (SVs) between adjacent LVs was<br />
remarkably reduced to almost a half of wild-type. The number of SVs between LVs was quite irregular in each leaf blade, and the vein distribution on the left and right side of the midrib was different. Sawtooth hairs at the leaf margins were significantly reduced (Fig. 1d). Ligule, auricle, leaf sheath and stems were also<br />
narrower and thinner (Fig. 1e,f; Table S2). Despite the reduction in leaf width, the lengths of leaf blades and leaf sheaths, and plant height were similar to wild-type (Table S2). These results indicate that NAL2/3function is mainly associated with vein patterning during leaf development and lateral-axis expansion during shoot organogenesis<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=174639Os12g01016002014-05-30T13:14:28Z<p>Lizhitao: /* Annotated Information */</p>
<hr />
<div><br />
==Annotated Information==<br />
narrow leaf2 narrow leaf3 (nal2 nal3; hereafter nal2/3) double mutant produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=174576Os12g01016002014-05-30T09:41:20Z<p>Lizhitao: /* Structured Information */</p>
<hr />
<div><br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0597200&diff=173552Os03g05972002014-05-28T08:26:45Z<p>Lizhitao: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
The predicted ORF ofYSAencodes a 742-amino acid polypeptide with a calculated molecular mass of 82.5kD. Database searches using Pfam revealed that YSAencodes a member of the P subfamily of PPR-containing proteins. The gene product contains a tandem repeat of 15 PPR motifs with varying degrees of conservation. The second to 15th repeats are contiguous, and the sequence is not well conserved (Fig. 4B). The PPR motif is a degenerate 35-amino acid repeat often arranged in tandem arrays of two to 27 repeats per polypeptide. Thus YSA is a new member of the superfamily of PPR proteins.<br />
===Function===<br />
YSA is required for chloroplast development in early seedling leaves, and disruption of its function causes a seedling stage-specific albino phenotype, but the plant recovers and develops normal green leaves from the four-leaf stage onward.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage.(Su N, Hu ML, Wu DX, et al.2012) <br />
Functional studies of PPR proteins in higher plants remain very sparse. Accumulating data point to an involvement in posttranscriptional processes in organelles. Additional evidence for a role of PPR proteins in regulating organelle gene expression has also come from positional cloning of several cytoplasmic male sterility (CMS) restorer genes from petunia (Petunia hybrida; Bentolila et al., 2002) and radish (Raphanus sativus; Brown et al., 2003; Desloire et al., 2003; Koizuka et al., 2003). Genetic and biochemical data, and structural modeling of PPR tracts based on established tetratricopeptide repeat proteins together suggest that PPR proteins typically bind directly to specific organellar RNA sequences through a surface created by the stacked helical repeating units. However, still very little is known about the functions, substrates, and regulatory mechanisms for the vast majority of PPR proteins.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage. Further investigation showed that the change in leaf color in ysa mutant is associated with changes in chlorophyll content and chloroplast development. The albino phenotype of the young ysaseedlings is caused by a reduction in total chlorophyll content, rather than reduction of a particular pigment.<br />
<br />
<br />
===Expression===<br />
<br />
Tissue localization<br />
Molecular analysis of an F2 population from the cross Taiziyuzhu3ysaplaced the YSAlocus between the markers RM411 and RM8208 on chromosome 3 . The YSAlocus was further narrowed down to a 45-kb region, which includes 10 putative open reading frames(ORFs; Fig. 3, B–D). We sequenced all ORFs and found a 5-bp deletion in Os03g40020, causing a premature stop codon. that the 5-bp deletion in Os03g40020 is responsible for the albino phenotype of ysa mutant. light plays a major role in regulatingYSAexpression.YSA is highly expressed in young leaves and stems, but not in the roots (Fig. 1, A–D). Quantitative real-time reverse transcription (RT)-PCR analysis revealed that the expression of YSA peaked in the fourth leaf (Fig. 2E). Thus, the expression pattern of YSA is consistent with the seedling-stage-specific albino phenotype of ysa mutant and further supports the notion that YSA plays an important role in chloroplast development in the first few leaves of rice seedlings, but plays more minor roles in later stages.<br />
<br />
[[File:picture1.jpg]]<br />
<br />
<br />
Figure 1. Phenotypic analysis of the ysa mutant plants. A to C, Phenotypes of Pei'ai64S (left) and ysa mutant (right) seedlings at 1 (A), 2 (B), and 3 (C) weeks after sowing. D, The pigment contents in leaves of 1-week-old ysa mutants are much lower than that in Pei'ai64S. E, The pigment contents in leaves of 6-week-old ysa mutants are similar to that of Pei'ai64S plants. Chla, Chlorophyll a; Chlb, chlorophyll b; Chl, total chlorophyll; Car, carotenoid. Bars represent sds of three measurements. Student’s t test was performed on the raw data; asterisk indicates statistical significance at P < 0.01. <br />
<br />
Subcellular Localization of YSA Protein<br />
<br />
The YSA protein is predicted to localize to chloroplasts by ChloroP (Emanuelsson et al., 1999) and TargetP (Emanuelsson et al., 2000). To investigate the actual cellular localization of YSA, we constructed the green fluorescent signals of YSA-GFP fusion proteins colocalized with the autofluorescent signals of chlorophylls in the chloroplasts, consistent with the results obtained for GFP fused to the transit peptide of the small subunit of Arabidopsis ribulose bisphosphate carboxylase (Fig. 2, A and B). When GFP fused to the nuclear localization signal of the fibrillarin protein, GFP signals located specifically in the nucleus of Arabidopsis protoplasts (Fig. 2C). In addition, the protoplasts transformed with the empty GFP vector without a specific targeting sequence had green fluorescent signals in both the cytoplasm and the nucleus (Fig.2, D and E). To further confirm the subcellular localization of YSA protein, we transformed the plasmid containing the YSA-GFP fusion constructs into rice protoplasts. Confocal microscopy observations revealed that GFP-YSA was exclusively detected in the chloroplasts (Fig. 2F). These findings suggest that YSA protein is localized to the chloroplast.<br />
<br />
[[File:picture2.jpg]]<br />
<br />
<br />
Figure 2. Subcellular localization of YSA protein. Fluorescence signals were visualized using confocal laser-scanning microscopy. Green fluorescence shows GFP, red fluorescence indicates chloroplast autofluorescence, and yellow fluorescence indicates images with the two types of fluorescence merged. A, GFP signals of the YSA-GFP fusion protein. B, GFP signals from the transit peptide of ribulose bisphosphate carboxylase small subunit (control). C, GFP signals from the nuclear localization signal of fibrillarin (control). D, Empty GFP vector without a specific targeting sequence. E, Untransformed chloroplasts. F,Subcellular localization of YSA protein in rice protoplasts. Bars = 5mm. A to E are Arabidopsis protoplasts and F is rice protoplasts.<br />
<br />
===Evolution===<br />
<br />
Homology with Arabidopsis Similar to At3g53700: MEE40 (maternal effect embryo arrest 40) (HF=7e-1)<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China<br />
Cloning ofYSA[[File:picture3[[File:]]]];Complementation of theysaMutant;Chlorophyll and Carotenoid Content Measurement;Transmission Electron Microscopy;Subcellular Localization of GFP Proteins;Histochemical GUS Assay;RNA Preparation and RT-PCR Analysis.<br />
<br />
==References==<br />
<br />
[1] Bentolila S, Alfonso AA, Hanson MR (2002) A pentatricopeptide repeat-containing gene restores fertility to cytoplasmic male-sterile plants. Proc Natl Acad Sci USA 99: 10887–10892<br />
<br />
[2] Brown GG, Formanová N, Jin H, Wargachuk R, Dendy C, Patil P, Laforest M, Zhang J, Cheung WY, Landry BS (2003) The radish Rfo restorer gene of Ogura cytoplasmic male sterility encodes a protein with multiple pentatricopeptide repeats. Plant J 35: 262–272<br />
<br />
[3] Desloire S, Gherbi H, Laloui W, Marhadour S, Clouet V, Cattolico L, Falentin C, Giancola S, Renard M, Budar F, et al. (2003) Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family. EMBO Rep 4: 588–594<br />
<br />
[4] Koizuka N, Imai R, Fujimoto H, Hayakawa T, Kimura Y, Kohno-Murase J, Sakai T, Kawasaki S, Imamura J (2003) Genetic characterization of a pentatricopeptide repeat protein gene, orf687, that restores fertility in the cytoplasmic male-sterile Kosena radish. Plant J 34: 407–415<br />
<br />
[5] Emanuelsson O, Nielsen H, von Heijne G (1999) ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Sci 8: 978–984 <br />
<br />
[6] Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of proteins based on their N-terminal amino acid sequence. J Mol Biol 300: 1005–1016<br />
<br />
[7] Su N, Hu ML, Wu DX, et al.(2012) Disruption of a rice pentatricopeptide repeat protein causes a seedling-specific albino phenotype and its utilization to enhance seed purity in hybrid rice production［J］.Plant Physiology, 159（1）：227-238.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0597200|<br />
Description = Protein prenyltransferase domain containing protein|<br />
Version = NM_001057140.1 GI:115454008 GeneID:4333379|<br />
Length = 5627 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0597200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:22993430..22999056|<br />
CDS = 22996530..22998758|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatga</cdnaseq>|<br />
AA = <aaseq>MPRVCAAPRAPPPPCPCHVGVGPLRPRWRASRHGPLRAAGQEQL LTALREQPDPDAALRMLNAALARDDFAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRR EGHQVKLGVVHSFLDSYEGQQLFDDAVDLILNQLQPLFGIQADTVVYNHLLNVLVEGS KMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETT FTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQ EIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKN GQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVY TFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLK DMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCK DKKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDV VTYGTLINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLF REMAEVGEPPDALTYKIVFRGLCRGGGPIKEAFDFMLEMVDKGFIPEFSSFRMLAEGL LNLGMDDYFIRAIEIIMEKVDLRESDVSAIRGYLKIRKFYDALATFGRFLEINNPQWS YR</aaseq>|<br />
DNA = <dnaseqindica>299..2527#ctcctgttcccctctgcctgccttcacggagaacacgccgccgcacgcccgcaaagttgtcgctccgccgccgggtcctgcggccacttcctccctctccctgtgcatgcgctctcttccccacctgtactttactttagctgctcctctgcccagttgcccacgacctgacgacccggacatggcgcaggctgaggcggggacgacgacatcgccggcgggttgacgcagaaaggagcgaccacccgagggctccgctggattttcaggtagctgagctgagctgaactgaaccccaatgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatgaagcagaatacataactgggacaaattacttgaatagtattagggaaatctcaaagagtggatggaatttttgctggttgcttaggggaatgaaagtcttaaattgattataataggtgattgtgttcattcctcggtagggatgaagtcagagcatgaagaagctcatcttggtgcagaaacttagcttattggaacagaatctaggtgctaggtgctgtctgctgccagattagtacctagcgccttaacgaacagtggctgcagatcccatccgcttattttgatcaaatctgattcattttctattccctaataaaagcctgattcatcttcattgcatatggtcgaacctaaggctatcatgtacagttagatcccaacccttcgttctatgagatgttgtcccatagaagaaatatcttctgagtatatcctagtactctaaaatgttcactaatatgttcaacttaattagttttgtaacctcctaaaatagttctattagttttgtaaccttctaaaatatgaattagttttgatctggctgatcttcctttggttaggtactacaaattcttaattcagacacatatttggttttctgaaaatttcatctatatttggtcaggctggcatttgaagttcttattttagtcatatactttagttttttacaattttcatttgttaaagatgataatttatttgttagcacagagcatgtttagaaatctgaaatattaaaacatgcatgttctcatgaaaataaatgttagttttgtttaaattccaatccacatattttttaatcaatgtcagaaattaccatgcttcacttattgacctagtatatgtatagtatttgatggatcatgttgatttggatttgctctactaacttgttcctattccaacaaagatttatatgcatcttgtgttctaaaaatgctacatgtgtcaagttgaaggaaaattctagctatgtggtgtcctaattttggtagatggtacctagtaatagataacaattctgttttatagtgatgagtaaatttgactaaatcgagtctagaaagtgatataattttctggagaagtctttcttggtgatttgggaaagggccattacctatactgatatgaaatctggaactagaaagatctgaacatcaatgttctaaagttttttgtctgaatttcttgtgcagaatatgaaggaaggtggatctggaataggtatttacatgtcctgttcagattcctgcaatctgataaactactgcaatccaataaactcttgatctattgttttctggatttttttttgggtgtagagtattaggaaggtatttgctttgttacaggggttggttggatgttcagaaaaccaaaatctgaatacactaacacattagccagtgttttattttagtttatgttattctgaccacaacaccagcagcttcaattggtagtagaacacactctgatgcaattggtaggtgtacaacagataatttgccgtgaatgctacttaattcaaccattttttttccatacagtgctatacaatggcacacaaacatccttcagttggactcaaatttgtttcagctttgctattttacagtcacctgcagttttttctaatccatcagtcgattttgttggcagtagattctgcttcaagatctgtgcacgcagtggaggcacatttggttacaggctgcttcaccagacccgttaacccatgggccatggatgctcccctagtagcatatgttgttttttccaccaactgcctcttgtaaatcaagatgctcccctctccacatttgctgcagacttcctccccgtggatctgagacgaactccggcgaccggcggcgtctacgagccagcgttcaccaatttctcaggtatatgagtcgtcatctatgtgcatctgctactttttttttttggctgattggacgggttgagaaggaggtgtttggggggaagagagcagaataatcccattgcgaaacaagcgaggaaggcttgtcgatggtggcggcggtggccttgattatcgaagatgcatgcgtgagggaaactgtgtgccagggaggcaagcttggtggcacacatcgagtggtatatcttcaggttactgctagatcgaagatcctttggtgcttgatgtgtgctgttggtttggtagttttggtggtactgtggcaagtgaagacacgaaagaggagctagtagaggcttagagtctggagtcgtaatcgatgtgcaagagcatcaatgccatcagttcctctgggcagcacggctctgcacttttcatctgagaaacatatatattttgttgattctgattttgacgaattatccaaacatgcagtttttttgggttccgcgtgcaaagacgattttgatctcctggcagatttaagggtggtgattttgtttttgttttgcatgtagatgatgcattttgtaaatcattttaggttgccccttttttttttgtttttgcgagttcttactgaatttggataagttctggttgattggatcgacattctgtacatttgcaaggggattctatgggtttttgcttattgctaatcaaattattttgtgagttttggtttattggatggtgagaaagcaagattacatggattttgcttcattgctgattttgtcgaaatttatcaggcatgcggtttttggtttcttgaatacgaactacacggacagtactcctatattcttggtgattttgaagtgtatttgttattttggggaggtggaatggttaatattttgttcaaggggacacttctacagatgtatacattacttttgtcattttcagcataacaaagagatttggtagattcagaattcagatggcaactacacgtcgaatgatgtatgcgaagacatggggaattctgatgctgattccactgaagaaagctaaacataattttaatttatttaccaactcatttttctgtcaacacatttgctagatagttgctacccgataaacgacatcttgaaatctgagttatacttcagtctattttttttcc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057140.1 RefSeq:Os03g0597200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0597200&diff=173527Os03g05972002014-05-28T07:54:03Z<p>Lizhitao: </p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
The predicted ORF ofYSAencodes a 742-amino acid polypeptide with a calculated molecular mass of 82.5kD. Database searches using Pfam revealed that YSAencodes a member of the P subfamily of PPR-containing proteins. The gene product contains a tandem repeat of 15 PPR motifs with varying degrees of conservation. The second to 15th repeats are contiguous, and the sequence is not well conserved (Fig. 4B). The PPR motif is a degenerate 35-amino acid repeat often arranged in tandem arrays of two to 27 repeats per polypeptide. Thus YSA is a new member of the superfamily of PPR proteins.<br />
===Function===<br />
YSA is required for chloroplast development in early seedling leaves, and disruption of its function causes a seedling stage-specific albino phenotype, but the plant recovers and develops normal green leaves from the four-leaf stage onward.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage.(Su N, Hu ML, Wu DX, et al.2012) <br />
Functional studies of PPR proteins in higher plants remain very sparse. Accumulating data point to an involvement in posttranscriptional processes in organelles. Additional evidence for a role of PPR proteins in regulating organelle gene expression has also come from positional cloning of several cytoplasmic male sterility (CMS) restorer genes from petunia (Petunia hybrida; Bentolila et al., 2002) and radish (Raphanus sativus; Brown et al., 2003; Desloire et al., 2003; Koizuka et al., 2003). Genetic and biochemical data, and structural modeling of PPR tracts based on established tetratricopeptide repeat proteins together suggest that PPR proteins typically bind directly to specific organellar RNA sequences through a surface created by the stacked helical repeating units. However, still very little is known about the functions, substrates, and regulatory mechanisms for the vast majority of PPR proteins.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage. Further investigation showed that the change in leaf color in ysa mutant is associated with changes in chlorophyll content and chloroplast development. The albino phenotype of the young ysaseedlings is caused by a reduction in total chlorophyll content, rather than reduction of a particular pigment.<br />
<br />
<br />
===Expression===<br />
<br />
Tissue localization<br />
Molecular analysis of an F2 population from the cross Taiziyuzhu3ysaplaced the YSAlocus between the markers RM411 and RM8208 on chromosome 3 . The YSAlocus was further narrowed down to a 45-kb region, which includes 10 putative open reading frames(ORFs; Fig. 3, B–D). We sequenced all ORFs and found a 5-bp deletion in Os03g40020, causing a premature stop codon. that the 5-bp deletion in Os03g40020 is responsible for the albino phenotype of ysa mutant. light plays a major role in regulatingYSAexpression.YSA is highly expressed in young leaves and stems, but not in the roots (Fig. 1, A–D). Quantitative real-time reverse transcription (RT)-PCR analysis revealed that the expression of YSA peaked in the fourth leaf (Fig. 2E). Thus, the expression pattern of YSA is consistent with the seedling-stage-specific albino phenotype of ysa mutant and further supports the notion that YSA plays an important role in chloroplast development in the first few leaves of rice seedlings, but plays more minor roles in later stages.<br />
<br />
[[File:picture1.jpg]]<br />
<br />
<br />
Figure 1. Phenotypic analysis of the ysa mutant plants. A to C, Phenotypes of Pei'ai64S (left) and ysa mutant (right) seedlings at 1 (A), 2 (B), and 3 (C) weeks after sowing. D, The pigment contents in leaves of 1-week-old ysa mutants are much lower than that in Pei'ai64S. E, The pigment contents in leaves of 6-week-old ysa mutants are similar to that of Pei'ai64S plants. Chla, Chlorophyll a; Chlb, chlorophyll b; Chl, total chlorophyll; Car, carotenoid. Bars represent sds of three measurements. Student’s t test was performed on the raw data; asterisk indicates statistical significance at P < 0.01. <br />
<br />
Subcellular Localization of YSA Protein<br />
<br />
The YSA protein is predicted to localize to chloroplasts by ChloroP (Emanuelsson et al., 1999) and TargetP (Emanuelsson et al., 2000). To investigate the actual cellular localization of YSA, we constructed the green fluorescent signals of YSA-GFP fusion proteins colocalized with the autofluorescent signals of chlorophylls in the chloroplasts, consistent with the results obtained for GFP fused to the transit peptide of the small subunit of Arabidopsis ribulose bisphosphate carboxylase (Fig. 2, A and B). When GFP fused to the nuclear localization signal of the fibrillarin protein, GFP signals located specifically in the nucleus of Arabidopsis protoplasts (Fig. 2C). In addition, the protoplasts transformed with the empty GFP vector without a specific targeting sequence had green fluorescent signals in both the cytoplasm and the nucleus (Fig.2, D and E). To further confirm the subcellular localization of YSA protein, we transformed the plasmid containing the YSA-GFP fusion constructs into rice protoplasts. Confocal microscopy observations revealed that GFP-YSA was exclusively detected in the chloroplasts (Fig. 2F). These findings suggest that YSA protein is localized to the chloroplast.<br />
<br />
[[File:picture2.jpg]]<br />
Figure 2. Subcellular localization of YSA protein. Fluorescence signals were visualized using confocal laser-scanning microscopy. Green fluorescence shows GFP, red fluorescence indicates chloroplast autofluorescence, and yellow fluorescence indicates images with the two types of fluorescence merged. A, GFP signals of the YSA-GFP fusion protein. B, GFP signals from the transit peptide of ribulose bisphosphate carboxylase small subunit (control). C, GFP signals from the nuclear localization signal of fibrillarin (control). D, Empty GFP vector without a specific targeting sequence. E, Untransformed chloroplasts. F,Subcellular localization of YSA protein in rice protoplasts. Bars = 5mm. A to E are Arabidopsis protoplasts and F is rice protoplasts.<br />
===Evolution===<br />
<br />
Homology with Arabidopsis Similar to At3g53700: MEE40 (maternal effect embryo arrest 40) (HF=7e-1)<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China<br />
Cloning ofYSA[[File:picture3[[File:]]]];Complementation of theysaMutant;Chlorophyll and Carotenoid Content Measurement;Transmission Electron Microscopy;Subcellular Localization of GFP Proteins;Histochemical GUS Assay;RNA Preparation and RT-PCR Analysis.<br />
<br />
==References==<br />
<br />
[1] Bentolila S, Alfonso AA, Hanson MR (2002) A pentatricopeptide repeat-containing gene restores fertility to cytoplasmic male-sterile plants. Proc Natl Acad Sci USA 99: 10887–10892<br />
<br />
[2] Brown GG, Formanová N, Jin H, Wargachuk R, Dendy C, Patil P, Laforest M, Zhang J, Cheung WY, Landry BS (2003) The radish Rfo restorer gene of Ogura cytoplasmic male sterility encodes a protein with multiple pentatricopeptide repeats. Plant J 35: 262–272<br />
<br />
[3] Desloire S, Gherbi H, Laloui W, Marhadour S, Clouet V, Cattolico L, Falentin C, Giancola S, Renard M, Budar F, et al. (2003) Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family. EMBO Rep 4: 588–594<br />
<br />
[4] Koizuka N, Imai R, Fujimoto H, Hayakawa T, Kimura Y, Kohno-Murase J, Sakai T, Kawasaki S, Imamura J (2003) Genetic characterization of a pentatricopeptide repeat protein gene, orf687, that restores fertility in the cytoplasmic male-sterile Kosena radish. Plant J 34: 407–415<br />
<br />
[5] Emanuelsson O, Nielsen H, von Heijne G (1999) ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Sci 8: 978–984 <br />
<br />
[6] Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of proteins based on their N-terminal amino acid sequence. J Mol Biol 300: 1005–1016<br />
<br />
[7] Su N, Hu ML, Wu DX, et al.(2012) Disruption of a rice pentatricopeptide repeat protein causes a seedling-specific albino phenotype and its utilization to enhance seed purity in hybrid rice production［J］.Plant Physiology, 159（1）：227-238.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0597200|<br />
Description = Protein prenyltransferase domain containing protein|<br />
Version = NM_001057140.1 GI:115454008 GeneID:4333379|<br />
Length = 5627 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0597200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:22993430..22999056|<br />
CDS = 22996530..22998758|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatga</cdnaseq>|<br />
AA = <aaseq>MPRVCAAPRAPPPPCPCHVGVGPLRPRWRASRHGPLRAAGQEQL LTALREQPDPDAALRMLNAALARDDFAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRR EGHQVKLGVVHSFLDSYEGQQLFDDAVDLILNQLQPLFGIQADTVVYNHLLNVLVEGS KMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETT FTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQ EIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKN GQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVY TFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLK DMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCK DKKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDV VTYGTLINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLF REMAEVGEPPDALTYKIVFRGLCRGGGPIKEAFDFMLEMVDKGFIPEFSSFRMLAEGL LNLGMDDYFIRAIEIIMEKVDLRESDVSAIRGYLKIRKFYDALATFGRFLEINNPQWS YR</aaseq>|<br />
DNA = <dnaseqindica>299..2527#ctcctgttcccctctgcctgccttcacggagaacacgccgccgcacgcccgcaaagttgtcgctccgccgccgggtcctgcggccacttcctccctctccctgtgcatgcgctctcttccccacctgtactttactttagctgctcctctgcccagttgcccacgacctgacgacccggacatggcgcaggctgaggcggggacgacgacatcgccggcgggttgacgcagaaaggagcgaccacccgagggctccgctggattttcaggtagctgagctgagctgaactgaaccccaatgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatgaagcagaatacataactgggacaaattacttgaatagtattagggaaatctcaaagagtggatggaatttttgctggttgcttaggggaatgaaagtcttaaattgattataataggtgattgtgttcattcctcggtagggatgaagtcagagcatgaagaagctcatcttggtgcagaaacttagcttattggaacagaatctaggtgctaggtgctgtctgctgccagattagtacctagcgccttaacgaacagtggctgcagatcccatccgcttattttgatcaaatctgattcattttctattccctaataaaagcctgattcatcttcattgcatatggtcgaacctaaggctatcatgtacagttagatcccaacccttcgttctatgagatgttgtcccatagaagaaatatcttctgagtatatcctagtactctaaaatgttcactaatatgttcaacttaattagttttgtaacctcctaaaatagttctattagttttgtaaccttctaaaatatgaattagttttgatctggctgatcttcctttggttaggtactacaaattcttaattcagacacatatttggttttctgaaaatttcatctatatttggtcaggctggcatttgaagttcttattttagtcatatactttagttttttacaattttcatttgttaaagatgataatttatttgttagcacagagcatgtttagaaatctgaaatattaaaacatgcatgttctcatgaaaataaatgttagttttgtttaaattccaatccacatattttttaatcaatgtcagaaattaccatgcttcacttattgacctagtatatgtatagtatttgatggatcatgttgatttggatttgctctactaacttgttcctattccaacaaagatttatatgcatcttgtgttctaaaaatgctacatgtgtcaagttgaaggaaaattctagctatgtggtgtcctaattttggtagatggtacctagtaatagataacaattctgttttatagtgatgagtaaatttgactaaatcgagtctagaaagtgatataattttctggagaagtctttcttggtgatttgggaaagggccattacctatactgatatgaaatctggaactagaaagatctgaacatcaatgttctaaagttttttgtctgaatttcttgtgcagaatatgaaggaaggtggatctggaataggtatttacatgtcctgttcagattcctgcaatctgataaactactgcaatccaataaactcttgatctattgttttctggatttttttttgggtgtagagtattaggaaggtatttgctttgttacaggggttggttggatgttcagaaaaccaaaatctgaatacactaacacattagccagtgttttattttagtttatgttattctgaccacaacaccagcagcttcaattggtagtagaacacactctgatgcaattggtaggtgtacaacagataatttgccgtgaatgctacttaattcaaccattttttttccatacagtgctatacaatggcacacaaacatccttcagttggactcaaatttgtttcagctttgctattttacagtcacctgcagttttttctaatccatcagtcgattttgttggcagtagattctgcttcaagatctgtgcacgcagtggaggcacatttggttacaggctgcttcaccagacccgttaacccatgggccatggatgctcccctagtagcatatgttgttttttccaccaactgcctcttgtaaatcaagatgctcccctctccacatttgctgcagacttcctccccgtggatctgagacgaactccggcgaccggcggcgtctacgagccagcgttcaccaatttctcaggtatatgagtcgtcatctatgtgcatctgctactttttttttttggctgattggacgggttgagaaggaggtgtttggggggaagagagcagaataatcccattgcgaaacaagcgaggaaggcttgtcgatggtggcggcggtggccttgattatcgaagatgcatgcgtgagggaaactgtgtgccagggaggcaagcttggtggcacacatcgagtggtatatcttcaggttactgctagatcgaagatcctttggtgcttgatgtgtgctgttggtttggtagttttggtggtactgtggcaagtgaagacacgaaagaggagctagtagaggcttagagtctggagtcgtaatcgatgtgcaagagcatcaatgccatcagttcctctgggcagcacggctctgcacttttcatctgagaaacatatatattttgttgattctgattttgacgaattatccaaacatgcagtttttttgggttccgcgtgcaaagacgattttgatctcctggcagatttaagggtggtgattttgtttttgttttgcatgtagatgatgcattttgtaaatcattttaggttgccccttttttttttgtttttgcgagttcttactgaatttggataagttctggttgattggatcgacattctgtacatttgcaaggggattctatgggtttttgcttattgctaatcaaattattttgtgagttttggtttattggatggtgagaaagcaagattacatggattttgcttcattgctgattttgtcgaaatttatcaggcatgcggtttttggtttcttgaatacgaactacacggacagtactcctatattcttggtgattttgaagtgtatttgttattttggggaggtggaatggttaatattttgttcaaggggacacttctacagatgtatacattacttttgtcattttcagcataacaaagagatttggtagattcagaattcagatggcaactacacgtcgaatgatgtatgcgaagacatggggaattctgatgctgattccactgaagaaagctaaacataattttaatttatttaccaactcatttttctgtcaacacatttgctagatagttgctacccgataaacgacatcttgaaatctgagttatacttcagtctattttttttcc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057140.1 RefSeq:Os03g0597200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0597200&diff=173516Os03g05972002014-05-28T07:34:28Z<p>Lizhitao: </p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
The predicted ORF ofYSAencodes a 742-amino acid polypeptide with a calculated molecular mass of 82.5kD. Database searches using Pfam revealed that YSAencodes a member of the P subfamily of PPR-containing proteins. The gene product contains a tandem repeat of 15 PPR motifs with varying degrees of conservation. The second to 15th repeats are contiguous, and the sequence is not well conserved (Fig. 4B). The PPR motif is a degenerate 35-amino acid repeat often arranged in tandem arrays of two to 27 repeats per polypeptide. Thus YSA is a new member of the superfamily of PPR proteins.<br />
===Function===<br />
YSA is required for chloroplast development in early seedling leaves, and disruption of its function causes a seedling stage-specific albino phenotype, but the plant recovers and develops normal green leaves from the four-leaf stage onward.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage.(Su N, Hu ML, Wu DX, et al.2012) <br />
Functional studies of PPR proteins in higher plants remain very sparse. Accumulating data point to an involvement in posttranscriptional processes in organelles. Additional evidence for a role of PPR proteins in regulating organelle gene expression has also come from positional cloning of several cytoplasmic male sterility (CMS) restorer genes from petunia (Petunia hybrida; Bentolila et al., 2002) and radish (Raphanus sativus; Brown et al., 2003; Desloire et al., 2003; Koizuka et al., 2003). Genetic and biochemical data, and structural modeling of PPR tracts based on established tetratricopeptide repeat proteins together suggest that PPR proteins typically bind directly to specific organellar RNA sequences through a surface created by the stacked helical repeating units. However, still very little is known about the functions, substrates, and regulatory mechanisms for the vast majority of PPR proteins.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage. Further investigation showed that the change in leaf color in ysa mutant is associated with changes in chlorophyll content and chloroplast development.<br />
<br />
<br />
===Expression===<br />
<br />
Tissue localization<br />
YSA is highly expressed in young leaves and stems, but not in the roots (Fig. 1, A–D). Quantitative real-time reverse transcription (RT)-PCR analysis revealed that the expression of YSA peaked in the fourth leaf (Fig. 2E). Thus, the expression pattern of YSA is consistent with the seedling-stage-specific albino phenotype of ysa mutant and further supports the notion that YSA plays an important role in chloroplast development in the first few leaves of rice seedlings, but plays more minor roles in later stages.<br />
<br />
[[File:picture1.jpg]]<br />
<br />
<br />
Figure 1. Phenotypic analysis of the ysa mutant plants. A to C, Phenotypes of Pei'ai64S (left) and ysa mutant (right) seedlings at 1 (A), 2 (B), and 3 (C) weeks after sowing. D, The pigment contents in leaves of 1-week-old ysa mutants are much lower than that in Pei'ai64S. E, The pigment contents in leaves of 6-week-old ysa mutants are similar to that of Pei'ai64S plants. Chla, Chlorophyll a; Chlb, chlorophyll b; Chl, total chlorophyll; Car, carotenoid. Bars represent sds of three measurements. Student’s t test was performed on the raw data; asterisk indicates statistical significance at P < 0.01. <br />
<br />
Subcellular Localization of YSA Protein<br />
<br />
The YSA protein is predicted to localize to chloroplasts by ChloroP (Emanuelsson et al., 1999) and TargetP (Emanuelsson et al., 2000). To investigate the actual cellular localization of YSA, we constructed the green fluorescent signals of YSA-GFP fusion proteins colocalized with the autofluorescent signals of chlorophylls in the chloroplasts, consistent with the results obtained for GFP fused to the transit peptide of the small subunit of Arabidopsis ribulose bisphosphate carboxylase (Fig. 2, A and B). When GFP fused to the nuclear localization signal of the fibrillarin protein, GFP signals located specifically in the nucleus of Arabidopsis protoplasts (Fig. 2C). In addition, the protoplasts transformed with the empty GFP vector without a specific targeting sequence had green fluorescent signals in both the cytoplasm and the nucleus (Fig.2, D and E). To further confirm the subcellular localization of YSA protein, we transformed the plasmid containing the YSA-GFP fusion constructs into rice protoplasts. Confocal microscopy observations revealed that GFP-YSA was exclusively detected in the chloroplasts (Fig. 2F). These findings suggest that YSA protein is localized to the chloroplast.<br />
<br />
[[File:picture2.jpg]]<br />
<br />
===Evolution===<br />
<br />
Homology with Arabidopsis Similar to At3g53700: MEE40 (maternal effect embryo arrest 40) (HF=7e-1)<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China<br />
Cloning ofYSA[[File:picture3[[File:]]]];Complementation of theysaMutant;Chlorophyll and Carotenoid Content Measurement;Transmission Electron Microscopy;Subcellular Localization of GFP Proteins;Histochemical GUS Assay;RNA Preparation and RT-PCR Analysis.<br />
<br />
==References==<br />
<br />
[1] Bentolila S, Alfonso AA, Hanson MR (2002) A pentatricopeptide repeat-containing gene restores fertility to cytoplasmic male-sterile plants. Proc Natl Acad Sci USA 99: 10887–10892<br />
<br />
[2] Brown GG, Formanová N, Jin H, Wargachuk R, Dendy C, Patil P, Laforest M, Zhang J, Cheung WY, Landry BS (2003) The radish Rfo restorer gene of Ogura cytoplasmic male sterility encodes a protein with multiple pentatricopeptide repeats. Plant J 35: 262–272<br />
<br />
[3] Desloire S, Gherbi H, Laloui W, Marhadour S, Clouet V, Cattolico L, Falentin C, Giancola S, Renard M, Budar F, et al. (2003) Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family. EMBO Rep 4: 588–594<br />
<br />
[4] Koizuka N, Imai R, Fujimoto H, Hayakawa T, Kimura Y, Kohno-Murase J, Sakai T, Kawasaki S, Imamura J (2003) Genetic characterization of a pentatricopeptide repeat protein gene, orf687, that restores fertility in the cytoplasmic male-sterile Kosena radish. Plant J 34: 407–415<br />
<br />
[5] Emanuelsson O, Nielsen H, von Heijne G (1999) ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Sci 8: 978–984 <br />
<br />
[6] Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of proteins based on their N-terminal amino acid sequence. J Mol Biol 300: 1005–1016<br />
<br />
[7] Su N, Hu ML, Wu DX, et al.(2012) Disruption of a rice pentatricopeptide repeat protein causes a seedling-specific albino phenotype and its utilization to enhance seed purity in hybrid rice production［J］.Plant Physiology, 159（1）：227-238.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0597200|<br />
Description = Protein prenyltransferase domain containing protein|<br />
Version = NM_001057140.1 GI:115454008 GeneID:4333379|<br />
Length = 5627 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0597200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:22993430..22999056|<br />
CDS = 22996530..22998758|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatga</cdnaseq>|<br />
AA = <aaseq>MPRVCAAPRAPPPPCPCHVGVGPLRPRWRASRHGPLRAAGQEQL LTALREQPDPDAALRMLNAALARDDFAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRR EGHQVKLGVVHSFLDSYEGQQLFDDAVDLILNQLQPLFGIQADTVVYNHLLNVLVEGS KMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETT FTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQ EIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKN GQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVY TFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLK DMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCK DKKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDV VTYGTLINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLF REMAEVGEPPDALTYKIVFRGLCRGGGPIKEAFDFMLEMVDKGFIPEFSSFRMLAEGL LNLGMDDYFIRAIEIIMEKVDLRESDVSAIRGYLKIRKFYDALATFGRFLEINNPQWS YR</aaseq>|<br />
DNA = <dnaseqindica>299..2527#ctcctgttcccctctgcctgccttcacggagaacacgccgccgcacgcccgcaaagttgtcgctccgccgccgggtcctgcggccacttcctccctctccctgtgcatgcgctctcttccccacctgtactttactttagctgctcctctgcccagttgcccacgacctgacgacccggacatggcgcaggctgaggcggggacgacgacatcgccggcgggttgacgcagaaaggagcgaccacccgagggctccgctggattttcaggtagctgagctgagctgaactgaaccccaatgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatgaagcagaatacataactgggacaaattacttgaatagtattagggaaatctcaaagagtggatggaatttttgctggttgcttaggggaatgaaagtcttaaattgattataataggtgattgtgttcattcctcggtagggatgaagtcagagcatgaagaagctcatcttggtgcagaaacttagcttattggaacagaatctaggtgctaggtgctgtctgctgccagattagtacctagcgccttaacgaacagtggctgcagatcccatccgcttattttgatcaaatctgattcattttctattccctaataaaagcctgattcatcttcattgcatatggtcgaacctaaggctatcatgtacagttagatcccaacccttcgttctatgagatgttgtcccatagaagaaatatcttctgagtatatcctagtactctaaaatgttcactaatatgttcaacttaattagttttgtaacctcctaaaatagttctattagttttgtaaccttctaaaatatgaattagttttgatctggctgatcttcctttggttaggtactacaaattcttaattcagacacatatttggttttctgaaaatttcatctatatttggtcaggctggcatttgaagttcttattttagtcatatactttagttttttacaattttcatttgttaaagatgataatttatttgttagcacagagcatgtttagaaatctgaaatattaaaacatgcatgttctcatgaaaataaatgttagttttgtttaaattccaatccacatattttttaatcaatgtcagaaattaccatgcttcacttattgacctagtatatgtatagtatttgatggatcatgttgatttggatttgctctactaacttgttcctattccaacaaagatttatatgcatcttgtgttctaaaaatgctacatgtgtcaagttgaaggaaaattctagctatgtggtgtcctaattttggtagatggtacctagtaatagataacaattctgttttatagtgatgagtaaatttgactaaatcgagtctagaaagtgatataattttctggagaagtctttcttggtgatttgggaaagggccattacctatactgatatgaaatctggaactagaaagatctgaacatcaatgttctaaagttttttgtctgaatttcttgtgcagaatatgaaggaaggtggatctggaataggtatttacatgtcctgttcagattcctgcaatctgataaactactgcaatccaataaactcttgatctattgttttctggatttttttttgggtgtagagtattaggaaggtatttgctttgttacaggggttggttggatgttcagaaaaccaaaatctgaatacactaacacattagccagtgttttattttagtttatgttattctgaccacaacaccagcagcttcaattggtagtagaacacactctgatgcaattggtaggtgtacaacagataatttgccgtgaatgctacttaattcaaccattttttttccatacagtgctatacaatggcacacaaacatccttcagttggactcaaatttgtttcagctttgctattttacagtcacctgcagttttttctaatccatcagtcgattttgttggcagtagattctgcttcaagatctgtgcacgcagtggaggcacatttggttacaggctgcttcaccagacccgttaacccatgggccatggatgctcccctagtagcatatgttgttttttccaccaactgcctcttgtaaatcaagatgctcccctctccacatttgctgcagacttcctccccgtggatctgagacgaactccggcgaccggcggcgtctacgagccagcgttcaccaatttctcaggtatatgagtcgtcatctatgtgcatctgctactttttttttttggctgattggacgggttgagaaggaggtgtttggggggaagagagcagaataatcccattgcgaaacaagcgaggaaggcttgtcgatggtggcggcggtggccttgattatcgaagatgcatgcgtgagggaaactgtgtgccagggaggcaagcttggtggcacacatcgagtggtatatcttcaggttactgctagatcgaagatcctttggtgcttgatgtgtgctgttggtttggtagttttggtggtactgtggcaagtgaagacacgaaagaggagctagtagaggcttagagtctggagtcgtaatcgatgtgcaagagcatcaatgccatcagttcctctgggcagcacggctctgcacttttcatctgagaaacatatatattttgttgattctgattttgacgaattatccaaacatgcagtttttttgggttccgcgtgcaaagacgattttgatctcctggcagatttaagggtggtgattttgtttttgttttgcatgtagatgatgcattttgtaaatcattttaggttgccccttttttttttgtttttgcgagttcttactgaatttggataagttctggttgattggatcgacattctgtacatttgcaaggggattctatgggtttttgcttattgctaatcaaattattttgtgagttttggtttattggatggtgagaaagcaagattacatggattttgcttcattgctgattttgtcgaaatttatcaggcatgcggtttttggtttcttgaatacgaactacacggacagtactcctatattcttggtgattttgaagtgtatttgttattttggggaggtggaatggttaatattttgttcaaggggacacttctacagatgtatacattacttttgtcattttcagcataacaaagagatttggtagattcagaattcagatggcaactacacgtcgaatgatgtatgcgaagacatggggaattctgatgctgattccactgaagaaagctaaacataattttaatttatttaccaactcatttttctgtcaacacatttgctagatagttgctacccgataaacgacatcttgaaatctgagttatacttcagtctattttttttcc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057140.1 RefSeq:Os03g0597200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0597200&diff=173508Os03g05972002014-05-28T07:17:48Z<p>Lizhitao: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
The predicted ORF ofYSAencodes a 742-amino acid polypeptide with a calculated molecular mass of 82.5kD. Database searches using Pfam revealed that YSAencodes a member of the P subfamily of PPR-containing proteins. The gene product contains a tandem repeat of 15 PPR motifs with varying degrees of conservation. The second to 15th repeats are contiguous, and the sequence is not well conserved (Fig. 4B). The PPR motif is a degenerate 35-amino acid repeat often arranged in tandem arrays of two to 27 repeats per polypeptide. Thus YSA is a new member of the superfamily of PPR proteins.<br />
===Function===<br />
YSA is required for chloroplast development in early seedling leaves, and disruption of its function causes a seedling stage-specific albino phenotype, but the plant recovers and develops normal green leaves from the four-leaf stage onward.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage.(Su N, Hu ML, Wu DX, et al.2012) <br />
Functional studies of PPR proteins in higher plants remain very sparse. Accumulating data point to an involvement in posttranscriptional processes in organelles. Additional evidence for a role of PPR proteins in regulating organelle gene expression has also come from positional cloning of several cytoplasmic male sterility (CMS) restorer genes from petunia (Petunia hybrida; Bentolila et al., 2002) and radish (Raphanus sativus; Brown et al., 2003; Desloire et al., 2003; Koizuka et al., 2003). Genetic and biochemical data, and structural modeling of PPR tracts based on established tetratricopeptide repeat proteins together suggest that PPR proteins typically bind directly to specific organellar RNA sequences through a surface created by the stacked helical repeating units. However, still very little is known about the functions, substrates, and regulatory mechanisms for the vast majority of PPR proteins.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage. Further investigation showed that the change in leaf color in ysa mutant is associated with changes in chlorophyll content and chloroplast development.<br />
<br />
<br />
===Expression===<br />
<br />
Tissue localization<br />
YSA is highly expressed in young leaves and stems, but not in the roots (Fig. 1, A–D). Quantitative real-time reverse transcription (RT)-PCR analysis revealed that the expression of YSA peaked in the fourth leaf (Fig. 2E). Thus, the expression pattern of YSA is consistent with the seedling-stage-specific albino phenotype of ysa mutant and further supports the notion that YSA plays an important role in chloroplast development in the first few leaves of rice seedlings, but plays more minor roles in later stages.<br />
<br />
[[File:picture1.jpg]]<br />
<br />
<br />
Figure 1. Phenotypic analysis of the ysa mutant plants. A to C, Phenotypes of Pei'ai64S (left) and ysa mutant (right) seedlings at 1 (A), 2 (B), and 3 (C) weeks after sowing. D, The pigment contents in leaves of 1-week-old ysa mutants are much lower than that in Pei'ai64S. E, The pigment contents in leaves of 6-week-old ysa mutants are similar to that of Pei'ai64S plants. Chla, Chlorophyll a; Chlb, chlorophyll b; Chl, total chlorophyll; Car, carotenoid. Bars represent sds of three measurements. Student’s t test was performed on the raw data; asterisk indicates statistical significance at P < 0.01. <br />
<br />
Subcellular Localization of YSA Protein<br />
<br />
The YSA protein is predicted to localize to chloroplasts by ChloroP (Emanuelsson et al., 1999) and TargetP (Emanuelsson et al., 2000). To investigate the actual cellular localization of YSA, we constructed the green fluorescent signals of YSA-GFP fusion proteins colocalized with the autofluorescent signals of chlorophylls in the chloroplasts, consistent with the results obtained for GFP fused to the transit peptide of the small subunit of Arabidopsis ribulose bisphosphate carboxylase (Fig. 2, A and B). When GFP fused to the nuclear localization signal of the fibrillarin protein, GFP signals located specifically in the nucleus of Arabidopsis protoplasts (Fig. 2C). In addition, the protoplasts transformed with the empty GFP vector without a specific targeting sequence had green fluorescent signals in both the cytoplasm and the nucleus (Fig.2, D and E). To further confirm the subcellular localization of YSA protein, we transformed the plasmid containing the YSA-GFP fusion constructs into rice protoplasts. Confocal microscopy observations revealed that GFP-YSA was exclusively detected in the chloroplasts (Fig. 2F). These findings suggest that YSA protein is localized to the chloroplast.<br />
<br />
[[File:picture2.jpg]]<br />
<br />
===Evolution===<br />
<br />
Homology with Arabidopsis Similar to At3g53700: MEE40 (maternal effect embryo arrest 40) (HF=7e-1)<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China<br />
Cloning ofYSA[[File:]];Complementation of theysaMutant;Chlorophyll and Carotenoid Content Measurement;Transmission Electron Microscopy;Subcellular Localization of GFP Proteins;Histochemical GUS Assay;RNA Preparation and RT-PCR Analysis.<br />
<br />
==References==<br />
<br />
[1] Bentolila S, Alfonso AA, Hanson MR (2002) A pentatricopeptide repeat-containing gene restores fertility to cytoplasmic male-sterile plants. Proc Natl Acad Sci USA 99: 10887–10892<br />
<br />
[2] Brown GG, Formanová N, Jin H, Wargachuk R, Dendy C, Patil P, Laforest M, Zhang J, Cheung WY, Landry BS (2003) The radish Rfo restorer gene of Ogura cytoplasmic male sterility encodes a protein with multiple pentatricopeptide repeats. Plant J 35: 262–272<br />
<br />
[3] Desloire S, Gherbi H, Laloui W, Marhadour S, Clouet V, Cattolico L, Falentin C, Giancola S, Renard M, Budar F, et al. (2003) Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family. EMBO Rep 4: 588–594<br />
<br />
[4] Koizuka N, Imai R, Fujimoto H, Hayakawa T, Kimura Y, Kohno-Murase J, Sakai T, Kawasaki S, Imamura J (2003) Genetic characterization of a pentatricopeptide repeat protein gene, orf687, that restores fertility in the cytoplasmic male-sterile Kosena radish. Plant J 34: 407–415<br />
<br />
[5] Emanuelsson O, Nielsen H, von Heijne G (1999) ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Sci 8: 978–984 <br />
<br />
[6] Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of proteins based on their N-terminal amino acid sequence. J Mol Biol 300: 1005–1016<br />
<br />
[7] Su N, Hu ML, Wu DX, et al.(2012) Disruption of a rice pentatricopeptide repeat protein causes a seedling-specific albino phenotype and its utilization to enhance seed purity in hybrid rice production［J］.Plant Physiology, 159（1）：227-238.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0597200|<br />
Description = Protein prenyltransferase domain containing protein|<br />
Version = NM_001057140.1 GI:115454008 GeneID:4333379|<br />
Length = 5627 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0597200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:22993430..22999056|<br />
CDS = 22996530..22998758|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatga</cdnaseq>|<br />
AA = <aaseq>MPRVCAAPRAPPPPCPCHVGVGPLRPRWRASRHGPLRAAGQEQL LTALREQPDPDAALRMLNAALARDDFAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRR EGHQVKLGVVHSFLDSYEGQQLFDDAVDLILNQLQPLFGIQADTVVYNHLLNVLVEGS KMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETT FTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQ EIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKN GQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVY TFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLK DMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCK DKKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDV VTYGTLINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLF REMAEVGEPPDALTYKIVFRGLCRGGGPIKEAFDFMLEMVDKGFIPEFSSFRMLAEGL LNLGMDDYFIRAIEIIMEKVDLRESDVSAIRGYLKIRKFYDALATFGRFLEINNPQWS YR</aaseq>|<br />
DNA = <dnaseqindica>299..2527#ctcctgttcccctctgcctgccttcacggagaacacgccgccgcacgcccgcaaagttgtcgctccgccgccgggtcctgcggccacttcctccctctccctgtgcatgcgctctcttccccacctgtactttactttagctgctcctctgcccagttgcccacgacctgacgacccggacatggcgcaggctgaggcggggacgacgacatcgccggcgggttgacgcagaaaggagcgaccacccgagggctccgctggattttcaggtagctgagctgagctgaactgaaccccaatgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatgaagcagaatacataactgggacaaattacttgaatagtattagggaaatctcaaagagtggatggaatttttgctggttgcttaggggaatgaaagtcttaaattgattataataggtgattgtgttcattcctcggtagggatgaagtcagagcatgaagaagctcatcttggtgcagaaacttagcttattggaacagaatctaggtgctaggtgctgtctgctgccagattagtacctagcgccttaacgaacagtggctgcagatcccatccgcttattttgatcaaatctgattcattttctattccctaataaaagcctgattcatcttcattgcatatggtcgaacctaaggctatcatgtacagttagatcccaacccttcgttctatgagatgttgtcccatagaagaaatatcttctgagtatatcctagtactctaaaatgttcactaatatgttcaacttaattagttttgtaacctcctaaaatagttctattagttttgtaaccttctaaaatatgaattagttttgatctggctgatcttcctttggttaggtactacaaattcttaattcagacacatatttggttttctgaaaatttcatctatatttggtcaggctggcatttgaagttcttattttagtcatatactttagttttttacaattttcatttgttaaagatgataatttatttgttagcacagagcatgtttagaaatctgaaatattaaaacatgcatgttctcatgaaaataaatgttagttttgtttaaattccaatccacatattttttaatcaatgtcagaaattaccatgcttcacttattgacctagtatatgtatagtatttgatggatcatgttgatttggatttgctctactaacttgttcctattccaacaaagatttatatgcatcttgtgttctaaaaatgctacatgtgtcaagttgaaggaaaattctagctatgtggtgtcctaattttggtagatggtacctagtaatagataacaattctgttttatagtgatgagtaaatttgactaaatcgagtctagaaagtgatataattttctggagaagtctttcttggtgatttgggaaagggccattacctatactgatatgaaatctggaactagaaagatctgaacatcaatgttctaaagttttttgtctgaatttcttgtgcagaatatgaaggaaggtggatctggaataggtatttacatgtcctgttcagattcctgcaatctgataaactactgcaatccaataaactcttgatctattgttttctggatttttttttgggtgtagagtattaggaaggtatttgctttgttacaggggttggttggatgttcagaaaaccaaaatctgaatacactaacacattagccagtgttttattttagtttatgttattctgaccacaacaccagcagcttcaattggtagtagaacacactctgatgcaattggtaggtgtacaacagataatttgccgtgaatgctacttaattcaaccattttttttccatacagtgctatacaatggcacacaaacatccttcagttggactcaaatttgtttcagctttgctattttacagtcacctgcagttttttctaatccatcagtcgattttgttggcagtagattctgcttcaagatctgtgcacgcagtggaggcacatttggttacaggctgcttcaccagacccgttaacccatgggccatggatgctcccctagtagcatatgttgttttttccaccaactgcctcttgtaaatcaagatgctcccctctccacatttgctgcagacttcctccccgtggatctgagacgaactccggcgaccggcggcgtctacgagccagcgttcaccaatttctcaggtatatgagtcgtcatctatgtgcatctgctactttttttttttggctgattggacgggttgagaaggaggtgtttggggggaagagagcagaataatcccattgcgaaacaagcgaggaaggcttgtcgatggtggcggcggtggccttgattatcgaagatgcatgcgtgagggaaactgtgtgccagggaggcaagcttggtggcacacatcgagtggtatatcttcaggttactgctagatcgaagatcctttggtgcttgatgtgtgctgttggtttggtagttttggtggtactgtggcaagtgaagacacgaaagaggagctagtagaggcttagagtctggagtcgtaatcgatgtgcaagagcatcaatgccatcagttcctctgggcagcacggctctgcacttttcatctgagaaacatatatattttgttgattctgattttgacgaattatccaaacatgcagtttttttgggttccgcgtgcaaagacgattttgatctcctggcagatttaagggtggtgattttgtttttgttttgcatgtagatgatgcattttgtaaatcattttaggttgccccttttttttttgtttttgcgagttcttactgaatttggataagttctggttgattggatcgacattctgtacatttgcaaggggattctatgggtttttgcttattgctaatcaaattattttgtgagttttggtttattggatggtgagaaagcaagattacatggattttgcttcattgctgattttgtcgaaatttatcaggcatgcggtttttggtttcttgaatacgaactacacggacagtactcctatattcttggtgattttgaagtgtatttgttattttggggaggtggaatggttaatattttgttcaaggggacacttctacagatgtatacattacttttgtcattttcagcataacaaagagatttggtagattcagaattcagatggcaactacacgtcgaatgatgtatgcgaagacatggggaattctgatgctgattccactgaagaaagctaaacataattttaatttatttaccaactcatttttctgtcaacacatttgctagatagttgctacccgataaacgacatcttgaaatctgagttatacttcagtctattttttttcc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057140.1 RefSeq:Os03g0597200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173438Os12g01016002014-05-28T04:51:34Z<p>Lizhitao: /* Structured Information */</p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os12g0101600|<br />
LOCUS = NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds. |<br />
ACCESSION = NM_001073722 |<br />
VERSION = NM_001073722.2 GI:297613475 |<br />
KEYWORDS = RefSeq. |<br />
SOURCE = Oryza sativa Japonica Group (Japanese rice) |<br />
ORGANISM = Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza. |<br />
Gene Identification<br />
Gene Product Name: homeobox domain containing protein, expressed<br />
Locus Name: LOC_Os12g01120.1<br />
Gene Attributes<br />
Chromosome: Chr12<br />
CDS Coordinates (5'-3'): 64393 - 65004<br />
Nucleotide length: 612<br />
Predicted protein length: 204<br />
Predicted molecular weight: 22352.1<br />
Predicted pI: 8.7607<br />
LOCUS NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds.<br />
ACCESSION NM_001073722<br />
VERSION NM_001073722.2 GI:297613475<br />
KEYWORDS RefSeq.<br />
SOURCE Oryza sativa Japonica Group (Japanese rice)<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
REFERENCE 1<br />
AUTHORS Tanaka,T., Antonio,B.A., Kikuchi,S., Matsumoto,T., Nagamura,Y.,<br />
Numa,H., Sakai,H., Wu,J., Itoh,T., Sasaki,T., Aono,R., Fujii,Y.,<br />
Habara,T., Harada,E., Kanno,M., Kawahara,Y., Kawashima,H.,<br />
Kubooka,H., Matsuya,A., Nakaoka,H., Saichi,N., Sanbonmatsu,R.,<br />
Sato,Y., Shinso,Y., Suzuki,M., Takeda,J., Tanino,M., Todokoro,F.,<br />
Yamaguchi,K., Yamamoto,N., Yamasaki,C., Imanishi,T., Okido,T.,<br />
Tada,M., Ikeo,K., Tateno,Y., Gojobori,T., Lin,Y.C., Wei,F.J.,<br />
Hsing,Y.I., Zhao,Q., Han,B., Kramer,M.R., McCombie,R.W.,<br />
Lonsdale,D., O'Donovan,C.C., Whitfield,E.J., Apweiler,R.,<br />
Koyanagi,K.O., Khurana,J.P., Raghuvanshi,S., Singh,N.K.,<br />
Tyagi,A.K., Haberer,G., Fujisawa,M., Hosokawa,S., Ito,Y., Ikawa,H.,<br />
Shibata,M., Yamamoto,M., Bruskiewich,R.M., Hoen,D.R., Bureau,T.E.,<br />
Namiki,N., Ohyanagi,H., Sakai,Y., Nobushima,S., Sakata,K.,<br />
Barrero,R.A., Sato,Y., Souvorov,A., Smith-White,B., Tatusova,T.,<br />
An,S., An,G., OOta,S., Fuks,G., Fuks,G., Messing,J., Christie,K.R.,<br />
Lieberherr,D., Kim,H., Zuccolo,A., Wing,R.A., Nobuta,K.,<br />
Green,P.J., Lu,C., Meyers,B.C., Chaparro,C., Piegu,B., Panaud,O.<br />
and Echeverria,M.<br />
CONSRTM Rice Annotation Project<br />
TITLE The Rice Annotation Project Database (RAP-DB): 2008 update<br />
JOURNAL Nucleic Acids Res. 36 (DATABASE ISSUE), D1028-D1033 (2008)<br />
PUBMED 18089549<br />
REFERENCE 2<br />
AUTHORS Itoh,T., Tanaka,T., Barrero,R.A., Yamasaki,C., Fujii,Y.,<br />
Hilton,P.B., Antonio,B.A., Aono,H., Apweiler,R., Bruskiewich,R.,<br />
Bureau,T., Burr,F., Costa de Oliveira,A., Fuks,G., Habara,T.,<br />
Haberer,G., Han,B., Harada,E., Hiraki,A.T., Hirochika,H., Hoen,D.,<br />
Hokari,H., Hosokawa,S., Hsing,Y.I., Ikawa,H., Ikeo,K., Imanishi,T.,<br />
Ito,Y., Jaiswal,P., Kanno,M., Kawahara,Y., Kawamura,T.,<br />
Kawashima,H., Khurana,J.P., Kikuchi,S., Komatsu,S., Koyanagi,K.O.,<br />
Kubooka,H., Lieberherr,D., Lin,Y.C., Lonsdale,D., Matsumoto,T.,<br />
Matsuya,A., McCombie,W.R., Messing,J., Miyao,A., Mulder,N.,<br />
Nagamura,Y., Nam,J., Namiki,N., Numa,H., Nurimoto,S., O'Donovan,C.,<br />
Ohyanagi,H., Okido,T., Oota,S., Osato,N., Palmer,L.E., Quetier,F.,<br />
Raghuvanshi,S., Saichi,N., Sakai,H., Sakai,Y., Sakata,K.,<br />
Sakurai,T., Sato,F., Sato,Y., Schoof,H., Seki,M., Shibata,M.,<br />
Shimizu,Y., Shinozaki,K., Shinso,Y., Singh,N.K., Smith-White,B.,<br />
Takeda,J., Tanino,M., Tatusova,T., Thongjuea,S., Todokoro,F.,<br />
Tsugane,M., Tyagi,A.K., Vanavichit,A., Wang,A., Wing,R.A.,<br />
Yamaguchi,K., Yamamoto,M., Yamamoto,N., Yu,Y., Zhang,H., Zhao,Q.,<br />
Higo,K., Burr,B., Gojobori,T. and Sasaki,T.<br />
CONSRTM Rice Annotation Project<br />
TITLE Curated genome annotation of Oryza sativa ssp. japonica and<br />
comparative genome analysis with Arabidopsis thaliana<br />
JOURNAL Genome Res. 17 (2), 175-183 (2007)<br />
PUBMED 17210932<br />
REFERENCE 3<br />
AUTHORS Ohyanagi,H., Tanaka,T., Sakai,H., Shigemoto,Y., Yamaguchi,K.,<br />
Habara,T., Fujii,Y., Antonio,B.A., Nagamura,Y., Imanishi,T.,<br />
Ikeo,K., Itoh,T., Gojobori,T. and Sasaki,T.<br />
TITLE The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa<br />
ssp. japonica genome information<br />
JOURNAL Nucleic Acids Res. 34 (DATABASE ISSUE), D741-D744 (2006)<br />
PUBMED 16381971<br />
REFERENCE 4<br />
AUTHORS Matsumoto,T., Wu,J., Kanamori,H., Katayose,Y., Fujisawa,M.,<br />
Namiki,N., Mizuno,H., Yamamoto,K., Antonio,B.A., Baba,T.,<br />
Sakata,K., Nagamura,Y., Aoki,H., Arikawa,K., Arita,K., Bito,T.,<br />
Chiden,Y., Fujitsuka,N., Fukunaka,R., Hamada,M., Harada,C.,<br />
Hayashi,A., Hijishita,S., Honda,M., Hosokawa,S., Ichikawa,Y.,<br />
Idonuma,A., Iijima,M., Ikeda,M., Ikeno,M., Ito,K., Ito,S., Ito,T.,<br />
Ito,Y., Ito,Y., Iwabuchi,A., Kamiya,K., Karasawa,W., Kurita,K.,<br />
Katagiri,S., Kikuta,A., Kobayashi,H., Kobayashi,N., Machita,K.,<br />
Maehara,T., Masukawa,M., Mizubayashi,T., Mukai,Y., Nagasaki,H.,<br />
Nagata,Y., Naito,S., Nakashima,M., Nakama,Y., Nakamichi,Y.,<br />
Nakamura,M., Meguro,A., Negishi,M., Ohta,I., Ohta,T., Okamoto,M.,<br />
Ono,N., Saji,S., Sakaguchi,M., Sakai,K., Shibata,M., Shimokawa,T.,<br />
Song,J., Takazaki,Y., Terasawa,K., Tsugane,M., Tsuji,K., Ueda,S.,<br />
Waki,K., Yamagata,H., Yamamoto,M., Yamamoto,S., Yamane,H.,<br />
Yoshiki,S., Yoshihara,R., Yukawa,K., Zhong,H., Yano,M., Yuan,Q.,<br />
Ouyang,S., Liu,J., Jones,K.M., Gansberger,K., Moffat,K., Hill,J.,<br />
Bera,J., Fadrosh,D., Jin,S., Johri,S., Kim,M., Overton,L.,<br />
Reardon,M., Tsitrin,T., Vuong,H., Weaver,B., Ciecko,A., Tallon,L.,<br />
Jackson,J., Pai,G., Aken,S.V., Utterback,T., Reidmuller,S.,<br />
Feldblyum,T., Hsiao,J., Zismann,V., Iobst,S., de Vazeille,A.R.,<br />
Buell,C.R., Ying,K., Li,Y., Lu,T., Huang,Y., Zhao,Q., Feng,Q.,<br />
Zhang,L., Zhu,J., Weng,Q., Mu,J., Lu,Y., Fan,D., Liu,Y., Guan,J.,<br />
Zhang,Y., Yu,S., Liu,X., Zhang,Y., Hong,G., Han,B., Choisne,N.,<br />
Demange,N., Orjeda,G., Samain,S., Cattolico,L., Pelletier,E.,<br />
Couloux,A., Segurens,B., Wincker,P., D'Hont,A., Scarpelli,C.,<br />
Weissenbach,J., Salanoubat,M., Quetier,F., Yu,Y., Kim,H.R.,<br />
Rambo,T., Currie,J., Collura,K., Luo,M., Yang,T., Ammiraju,J.S.S.,<br />
Engler,F., Soderlund,C., Wing,R.A., Palmer,L.E., de la Bastide,M.,<br />
Spiegel,L., Nascimento,L., Zutavern,T., O'Shaughnessy,A., Dike,S.,<br />
Dedhia,N., Preston,R., Balija,V., McCombie,W.R., Chow,T., Chen,H.,<br />
Chung,M., Chen,C., Shaw,J., Wu,H., Hsiao,K., Chao,Y., Chu,M.,<br />
Cheng,C., Hour,A., Lee,P., Lin,S., Lin,Y., Liou,J., Liu,S.,<br />
Hsing,Y., Raghuvanshi,S., Mohanty,A., Bharti,A.K., Gaur,A.,<br />
Gupta,V., Kumar,D., Ravi,V., Vij,S., Kapur,A., Khurana,P.,<br />
Khurana,P., Khurana,J.P., Tyagi,A.K., Gaikwad,K., Singh,A.,<br />
Dalal,V., Srivastava,S., Dixit,A., Pal,A.K., Ghazi,I.A., Yadav,M.,<br />
Pandit,A., Bhargava,A., Sureshbabu,K., Batra,K., Sharma,T.R.,<br />
Mohapatra,T., Singh,N.K., Messing,J., Nelson,A.B., Fuks,G.,<br />
Kavchok,S., Keizer,G., Linton,E., Llaca,V., Song,R., Tanyolac,B.,<br />
Young,S., Ho-Il,K., Hahn,J.H., Sangsakoo,G., Vanavichit,A., de<br />
Mattos,Luiz.A.T., Zimmer,P.D., Malone,G., Dellagostin,O., de<br />
Oliveira,A.C., Bevan,M., Bancroft,I., Minx,P., Cordum,H.,<br />
Wilson,R., Cheng,Z., Jin,W., Jiang,J., Leong,S.A., Iwama,H.,<br />
Gojobori,T., Itoh,T., Niimura,Y., Fujii,Y., Habara,T., Sakai,H.,<br />
Sato,Y., Wilson,G., Kumar,K., McCouch,S., Juretic,N., Hoen,D.,<br />
Wright,S., Bruskiewich,R., Bureau,T., Miyao,A., Hirochika,H.,<br />
Nishikawa,T., Kadowaki,K., Sugiura,M., Burr,B. and Sasaki,T.<br />
CONSRTM International Rice Genome Sequencing Project<br />
TITLE The map-based sequence of the rice genome<br />
JOURNAL Nature 436 (7052), 793-800 (2005)<br />
PUBMED 16100779<br />
REFERENCE 5<br />
CONSRTM IRGSP(International Rice Genome Sequencing Project)<br />
TITLE Oryza sativa nipponbare(GA3) genomic DNA, chromosome 12<br />
JOURNAL Unpublished<br />
REFERENCE 6<br />
CONSRTM The Rice Annotation Project (RAP)<br />
TITLE The Second Rice Annotation Project Meeting (RAP2)<br />
JOURNAL Unpublished<br />
REFERENCE 7 (bases 1 to 1508)<br />
AUTHORS Sasaki,T.<br />
TITLE Direct Submission<br />
JOURNAL Submitted (25-OCT-2004) Contact:Takuji Sasaki National Institute of<br />
Agrobiological Sciences, Rice Genome Research Program; Kannondai<br />
2-1-2, Tsukuba, Ibaraki 305-8602, Japan URL<br />
:http://rgp.dna.affrc.go.jp/<br />
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final<br />
NCBI review. This record is derived from an annotated genomic<br />
sequence (NC_008405).<br />
On Jun 7, 2010 this sequence version replaced gi:115489405.<br />
The IRGSP pseudomolecules (Build 4.0).<br />
The orientation of the sequence is the short arm to the long arm of<br />
the chromosome.<br />
Genoscope, Evry cedex, France, URL:http://www.genoscope.cns.fr/,<br />
Tel:(33)0 1 60 87 25 00 Fax:(33)0 1 60 87 25 14<br />
<br />
The position of gaps in this pseudomolecule with unknown size is<br />
assigned 100 Ns based on the guideline set by DDBJ/EMBL/GenBank.<br />
<br />
This sequence entry was annotated by the Rice Annotation Project.<br />
http://rapdb.lab.nig.ac.jp/<br />
FEATURES Location/Qualifiers<br />
source 1..1508<br />
/organism="Oryza sativa Japonica Group"<br />
/mol_type="mRNA"<br />
/cultivar="Nipponbare"<br />
/db_xref="taxon:39947"<br />
/chromosome="12"<br />
gene 1..1508<br />
/gene="Os12g0597000"<br />
/db_xref="GeneID:4352701"<br />
CDS 373..1050<br />
/gene="Os12g0597000"<br />
/note="Similar to Calcineurin B-like protein 2 (SOS3-like<br />
calcium binding protein 1);<br />
contains InterPro domain(s): IPR002048, IPR001125;<br />
has GO asignment(s): GO:0005509;<br />
supported by AK111887"<br />
/codon_start=1<br />
/product="hypothetical protein"<br />
/protein_id="NP_001067190.1"<br />
/db_xref="GI:115489406"<br />
/db_xref="GeneID:4352701"<br />
/translation="MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVS<br />
EVEALYELFKKISSAVIDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILG<br />
FDEFARALSVFHPSAPLDEKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSD<br />
EIIESIIDKTFEEADTKHDGRIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVF<br />
HSQVDDT"<br />
ORIGIN <br />
1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat<br />
61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg<br />
121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc<br />
181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc<br />
241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg<br />
301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg<br />
361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc<br />
421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg<br />
481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata<br />
541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc<br />
601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa<br />
661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt<br />
721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc<br />
781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg<br />
841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca<br />
901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct<br />
961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt<br />
1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc<br />
1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga<br />
1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat<br />
1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat<br />
1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct<br />
1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag<br />
1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg<br />
1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag<br />
1501 agtttgca<br />
Genomic Sequence<br />
>LOC_Os12g01120<br />
ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG<br />
GAGATGTACAGGAGCGGCGTGCGAACGCCCAACGCGGCAGAGATCCAGCAAATCACGGCG<br />
CACCTCGCCTACTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCAC<br />
AAGGCCCGCGAGCGCCAGCGCCTCCGCCGCCGCCTCTGCGCGCGGCACCAGCAGCAACCC<br />
TCACCGCCCTCCTCCACGGTGCCTCCGGCTCCCACTGCTGCTGCTGCCGGTGCCGTCGTG<br />
CAGGTGCACCCCGCGGTGATGCAGCTACACCACCACCACCACCACCATCACCCATACGCT<br />
GCGGCCGCCGCTGCCCAAAGTCATCACCTGCAGCAGCAGCAGCAGCAGCAAGCTGAGTGG<br />
CCGGCGGCGGTGGACTACTGCAGCACTGCATCGGCGTCAGCGTCGGCAACTGCTGCTGAC<br />
ATGGCGATCCCGCCGTGCTGCCGGCCGCTGAAAACGTTGGAGCTGTTCCCGACCAAGAGC<br />
ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC<br />
TCCACCAATTAA<br />
<br />
CDS<br />
>LOC_Os12g01120.1<br />
ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG<br />
GAGATGTACAGGAGCGGCGTGCGAACGCCCAACGCGGCAGAGATCCAGCAAATCACGGCG<br />
CACCTCGCCTACTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCAC<br />
AAGGCCCGCGAGCGCCAGCGCCTCCGCCGCCGCCTCTGCGCGCGGCACCAGCAGCAACCC<br />
TCACCGCCCTCCTCCACGGTGCCTCCGGCTCCCACTGCTGCTGCTGCCGGTGCCGTCGTG<br />
CAGGTGCACCCCGCGGTGATGCAGCTACACCACCACCACCACCACCATCACCCATACGCT<br />
GCGGCCGCCGCTGCCCAAAGTCATCACCTGCAGCAGCAGCAGCAGCAGCAAGCTGAGTGG<br />
CCGGCGGCGGTGGACTACTGCAGCACTGCATCGGCGTCAGCGTCGGCAACTGCTGCTGAC<br />
ATGGCGATCCCGCCGTGCTGCCGGCCGCTGAAAACGTTGGAGCTGTTCCCGACCAAGAGC<br />
ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC<br />
TCCACCAATTAA<br />
<br />
Protein<br />
>LOC_Os12g01120.1<br />
MPQTPSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNH<br />
KARERQRLRRRLCARHQQQPSPPSSTVPPAPTAAAAGAVVQVHPAVMQLHHHHHHHHPYA<br />
AAAAAQSHHLQQQQQQQAEWPAAVDYCSTASASASATAADMAIPPCCRPLKTLELFPTKS<br />
TSGGLKEDCCSSSKSSSCSTSTN*</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173436Os12g01016002014-05-28T04:32:33Z<p>Lizhitao: /* Structured Information */</p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os12g0101600|<br />
LOCUS = NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds. |<br />
ACCESSION = NM_001073722 |<br />
VERSION = NM_001073722.2 GI:297613475 |<br />
KEYWORDS = RefSeq. |<br />
SOURCE = Oryza sativa Japonica Group (Japanese rice) |<br />
ORGANISM = Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza. |<br />
Gene Identification<br />
Gene Product Name: homeobox domain containing protein, expressed<br />
Locus Name: LOC_Os12g01120.1<br />
Gene Attributes<br />
Chromosome: Chr12<br />
CDS Coordinates (5'-3'): 64393 - 65004<br />
Nucleotide length: 612<br />
Predicted protein length: 204<br />
Predicted molecular weight: 22352.1<br />
Predicted pI: 8.7607<br />
<br />
Genomic Sequence<br />
>LOC_Os12g01120<br />
ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG<br />
GAGATGTACAGGAGCGGCGTGCGAACGCCCAACGCGGCAGAGATCCAGCAAATCACGGCG<br />
CACCTCGCCTACTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCAC<br />
AAGGCCCGCGAGCGCCAGCGCCTCCGCCGCCGCCTCTGCGCGCGGCACCAGCAGCAACCC<br />
TCACCGCCCTCCTCCACGGTGCCTCCGGCTCCCACTGCTGCTGCTGCCGGTGCCGTCGTG<br />
CAGGTGCACCCCGCGGTGATGCAGCTACACCACCACCACCACCACCATCACCCATACGCT<br />
GCGGCCGCCGCTGCCCAAAGTCATCACCTGCAGCAGCAGCAGCAGCAGCAAGCTGAGTGG<br />
CCGGCGGCGGTGGACTACTGCAGCACTGCATCGGCGTCAGCGTCGGCAACTGCTGCTGAC<br />
ATGGCGATCCCGCCGTGCTGCCGGCCGCTGAAAACGTTGGAGCTGTTCCCGACCAAGAGC<br />
ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC<br />
TCCACCAATTAA<br />
<br />
CDS<br />
>LOC_Os12g01120.1<br />
ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG<br />
GAGATGTACAGGAGCGGCGTGCGAACGCCCAACGCGGCAGAGATCCAGCAAATCACGGCG<br />
CACCTCGCCTACTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCAC<br />
AAGGCCCGCGAGCGCCAGCGCCTCCGCCGCCGCCTCTGCGCGCGGCACCAGCAGCAACCC<br />
TCACCGCCCTCCTCCACGGTGCCTCCGGCTCCCACTGCTGCTGCTGCCGGTGCCGTCGTG<br />
CAGGTGCACCCCGCGGTGATGCAGCTACACCACCACCACCACCACCATCACCCATACGCT<br />
GCGGCCGCCGCTGCCCAAAGTCATCACCTGCAGCAGCAGCAGCAGCAGCAAGCTGAGTGG<br />
CCGGCGGCGGTGGACTACTGCAGCACTGCATCGGCGTCAGCGTCGGCAACTGCTGCTGAC<br />
ATGGCGATCCCGCCGTGCTGCCGGCCGCTGAAAACGTTGGAGCTGTTCCCGACCAAGAGC<br />
ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC<br />
TCCACCAATTAA<br />
<br />
Protein<br />
>LOC_Os12g01120.1<br />
MPQTPSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNH<br />
KARERQRLRRRLCARHQQQPSPPSSTVPPAPTAAAAGAVVQVHPAVMQLHHHHHHHHPYA<br />
AAAAAQSHHLQQQQQQQAEWPAAVDYCSTASASASATAADMAIPPCCRPLKTLELFPTKS<br />
TSGGLKEDCCSSSKSSSCSTSTN*</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173434Os12g01016002014-05-28T04:30:41Z<p>Lizhitao: /* Structured Information */</p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os12g0101600|<br />
LOCUS = NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds. |<br />
ACCESSION = NM_001073722 |<br />
VERSION = NM_001073722.2 GI:297613475 |<br />
KEYWORDS = RefSeq. |<br />
SOURCE = Oryza sativa Japonica Group (Japanese rice) |<br />
ORGANISM = Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza. |<br />
Gene Identification<br />
Gene Product Name: homeobox domain containing protein, expressed<br />
Locus Name: LOC_Os12g01120.1<br />
Gene Attributes<br />
Chromosome: Chr12<br />
CDS Coordinates (5'-3'): 64393 - 65004<br />
Nucleotide length: 612<br />
Predicted protein length: 204<br />
Predicted molecular weight: 22352.1<br />
Predicted pI: 8.7607<br />
Genomic Sequence<br />
<br />
>LOC_Os12g01120<br />
ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG<br />
GAGATGTACAGGAGCGGCGTGCGAACGCCCAACGCGGCAGAGATCCAGCAAATCACGGCG<br />
CACCTCGCCTACTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCAC<br />
AAGGCCCGCGAGCGCCAGCGCCTCCGCCGCCGCCTCTGCGCGCGGCACCAGCAGCAACCC<br />
TCACCGCCCTCCTCCACGGTGCCTCCGGCTCCCACTGCTGCTGCTGCCGGTGCCGTCGTG<br />
CAGGTGCACCCCGCGGTGATGCAGCTACACCACCACCACCACCACCATCACCCATACGCT<br />
GCGGCCGCCGCTGCCCAAAGTCATCACCTGCAGCAGCAGCAGCAGCAGCAAGCTGAGTGG<br />
CCGGCGGCGGTGGACTACTGCAGCACTGCATCGGCGTCAGCGTCGGCAACTGCTGCTGAC<br />
ATGGCGATCCCGCCGTGCTGCCGGCCGCTGAAAACGTTGGAGCTGTTCCCGACCAAGAGC<br />
ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC<br />
TCCACCAATTAA<br />
CDS<br />
<br />
>LOC_Os12g01120.1<br />
ATGCCTCAGACCCCTTCGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATCCTGGAG<br />
GAGATGTACAGGAGCGGCGTGCGAACGCCCAACGCGGCAGAGATCCAGCAAATCACGGCG<br />
CACCTCGCCTACTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCAC<br />
AAGGCCCGCGAGCGCCAGCGCCTCCGCCGCCGCCTCTGCGCGCGGCACCAGCAGCAACCC<br />
TCACCGCCCTCCTCCACGGTGCCTCCGGCTCCCACTGCTGCTGCTGCCGGTGCCGTCGTG<br />
CAGGTGCACCCCGCGGTGATGCAGCTACACCACCACCACCACCACCATCACCCATACGCT<br />
GCGGCCGCCGCTGCCCAAAGTCATCACCTGCAGCAGCAGCAGCAGCAGCAAGCTGAGTGG<br />
CCGGCGGCGGTGGACTACTGCAGCACTGCATCGGCGTCAGCGTCGGCAACTGCTGCTGAC<br />
ATGGCGATCCCGCCGTGCTGCCGGCCGCTGAAAACGTTGGAGCTGTTCCCGACCAAGAGC<br />
ACCAGCGGCGGCCTCAAGGAAGATTGCTGCAGCAGCTCCAAGTCCTCCTCTTGCTCCACC<br />
TCCACCAATTAA<br />
Protein<br />
<br />
>LOC_Os12g01120.1<br />
MPQTPSTRWCPTPEQLMILEEMYRSGVRTPNAAEIQQITAHLAYYGRIEGKNVFYWFQNH<br />
KARERQRLRRRLCARHQQQPSPPSSTVPPAPTAAAAGAVVQVHPAVMQLHHHHHHHHPYA<br />
AAAAAQSHHLQQQQQQQAEWPAAVDYCSTASASASATAADMAIPPCCRPLKTLELFPTKS<br />
TSGGLKEDCCSSSKSSSCSTSTN*</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173432Os12g01016002014-05-28T04:21:00Z<p>Lizhitao: /* Structured Information */</p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os12g0101600|<br />
LOCUS = NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds. |<br />
ACCESSION = NM_001073722 |<br />
VERSION = NM_001073722.2 GI:297613475 |<br />
KEYWORDS = RefSeq. |<br />
SOURCE = Oryza sativa Japonica Group (Japanese rice) |<br />
ORGANISM = Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza. |<br />
<br />
ORIGIN = 1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat<br />
61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg<br />
121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc<br />
181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc<br />
241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg<br />
301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg<br />
361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc<br />
421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg<br />
481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata<br />
541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc<br />
601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa<br />
661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt<br />
721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc<br />
781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg<br />
841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca<br />
901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct<br />
961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt<br />
1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc<br />
1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga<br />
1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat<br />
1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat<br />
1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct<br />
1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag<br />
1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg<br />
1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag<br />
1501 agtttgca|</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173431Os12g01016002014-05-28T04:18:54Z<p>Lizhitao: /* Structured Information */</p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
==Structured Information==<br />
{{JaponicaGene|<br />
LOCUS = NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds.|<br />
ACCESSION = NM_001073722|<br />
VERSION = NM_001073722.2 GI:297613475|<br />
KEYWORDS = RefSeq.|<br />
SOURCE = Oryza sativa Japonica Group (Japanese rice)|<br />
ORGANISM = Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.|<br />
<br />
ORIGIN = 1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat<br />
61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg<br />
121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc<br />
181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc<br />
241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg<br />
301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg<br />
361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc<br />
421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg<br />
481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata<br />
541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc<br />
601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa<br />
661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt<br />
721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc<br />
781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg<br />
841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca<br />
901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct<br />
961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt<br />
1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc<br />
1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga<br />
1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat<br />
1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat<br />
1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct<br />
1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag<br />
1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg<br />
1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag<br />
1501 agtttgca|</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173430Os12g01016002014-05-28T04:18:11Z<p>Lizhitao: /* Structured Information */</p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
==Structured Information==<br />
LOCUS = NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION = Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds.|<br />
ACCESSION = NM_001073722|<br />
VERSION = NM_001073722.2 GI:297613475|<br />
KEYWORDS = RefSeq.|<br />
SOURCE = Oryza sativa Japonica Group (Japanese rice)|<br />
ORGANISM = Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.|<br />
<br />
ORIGIN = 1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat<br />
61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg<br />
121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc<br />
181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc<br />
241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg<br />
301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg<br />
361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc<br />
421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg<br />
481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata<br />
541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc<br />
601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa<br />
661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt<br />
721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc<br />
781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg<br />
841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca<br />
901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct<br />
961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt<br />
1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc<br />
1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga<br />
1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat<br />
1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat<br />
1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct<br />
1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag<br />
1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg<br />
1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag<br />
1501 agtttgca|</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173411Os12g01016002014-05-28T03:24:53Z<p>Lizhitao: </p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
==Structured Information==<br />
LOCUS NM_001073722 1508 bp mRNA linear PLN 08-JUN-2010<br />
DEFINITION Oryza sativa Japonica Group Os12g0597000 (Os12g0597000) mRNA,<br />
complete cds.<br />
ACCESSION NM_001073722<br />
VERSION NM_001073722.2 GI:297613475<br />
KEYWORDS RefSeq.<br />
SOURCE Oryza sativa Japonica Group (Japanese rice)<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
REFERENCE 1<br />
AUTHORS Tanaka,T., Antonio,B.A., Kikuchi,S., Matsumoto,T., Nagamura,Y.,<br />
Numa,H., Sakai,H., Wu,J., Itoh,T., Sasaki,T., Aono,R., Fujii,Y.,<br />
Habara,T., Harada,E., Kanno,M., Kawahara,Y., Kawashima,H.,<br />
Kubooka,H., Matsuya,A., Nakaoka,H., Saichi,N., Sanbonmatsu,R.,<br />
Sato,Y., Shinso,Y., Suzuki,M., Takeda,J., Tanino,M., Todokoro,F.,<br />
Yamaguchi,K., Yamamoto,N., Yamasaki,C., Imanishi,T., Okido,T.,<br />
Tada,M., Ikeo,K., Tateno,Y., Gojobori,T., Lin,Y.C., Wei,F.J.,<br />
Hsing,Y.I., Zhao,Q., Han,B., Kramer,M.R., McCombie,R.W.,<br />
Lonsdale,D., O'Donovan,C.C., Whitfield,E.J., Apweiler,R.,<br />
Koyanagi,K.O., Khurana,J.P., Raghuvanshi,S., Singh,N.K.,<br />
Tyagi,A.K., Haberer,G., Fujisawa,M., Hosokawa,S., Ito,Y., Ikawa,H.,<br />
Shibata,M., Yamamoto,M., Bruskiewich,R.M., Hoen,D.R., Bureau,T.E.,<br />
Namiki,N., Ohyanagi,H., Sakai,Y., Nobushima,S., Sakata,K.,<br />
Barrero,R.A., Sato,Y., Souvorov,A., Smith-White,B., Tatusova,T.,<br />
An,S., An,G., OOta,S., Fuks,G., Fuks,G., Messing,J., Christie,K.R.,<br />
Lieberherr,D., Kim,H., Zuccolo,A., Wing,R.A., Nobuta,K.,<br />
Green,P.J., Lu,C., Meyers,B.C., Chaparro,C., Piegu,B., Panaud,O.<br />
and Echeverria,M.<br />
CONSRTM Rice Annotation Project<br />
TITLE The Rice Annotation Project Database (RAP-DB): 2008 update<br />
JOURNAL Nucleic Acids Res. 36 (DATABASE ISSUE), D1028-D1033 (2008)<br />
PUBMED 18089549<br />
REFERENCE 2<br />
AUTHORS Itoh,T., Tanaka,T., Barrero,R.A., Yamasaki,C., Fujii,Y.,<br />
Hilton,P.B., Antonio,B.A., Aono,H., Apweiler,R., Bruskiewich,R.,<br />
Bureau,T., Burr,F., Costa de Oliveira,A., Fuks,G., Habara,T.,<br />
Haberer,G., Han,B., Harada,E., Hiraki,A.T., Hirochika,H., Hoen,D.,<br />
Hokari,H., Hosokawa,S., Hsing,Y.I., Ikawa,H., Ikeo,K., Imanishi,T.,<br />
Ito,Y., Jaiswal,P., Kanno,M., Kawahara,Y., Kawamura,T.,<br />
Kawashima,H., Khurana,J.P., Kikuchi,S., Komatsu,S., Koyanagi,K.O.,<br />
Kubooka,H., Lieberherr,D., Lin,Y.C., Lonsdale,D., Matsumoto,T.,<br />
Matsuya,A., McCombie,W.R., Messing,J., Miyao,A., Mulder,N.,<br />
Nagamura,Y., Nam,J., Namiki,N., Numa,H., Nurimoto,S., O'Donovan,C.,<br />
Ohyanagi,H., Okido,T., Oota,S., Osato,N., Palmer,L.E., Quetier,F.,<br />
Raghuvanshi,S., Saichi,N., Sakai,H., Sakai,Y., Sakata,K.,<br />
Sakurai,T., Sato,F., Sato,Y., Schoof,H., Seki,M., Shibata,M.,<br />
Shimizu,Y., Shinozaki,K., Shinso,Y., Singh,N.K., Smith-White,B.,<br />
Takeda,J., Tanino,M., Tatusova,T., Thongjuea,S., Todokoro,F.,<br />
Tsugane,M., Tyagi,A.K., Vanavichit,A., Wang,A., Wing,R.A.,<br />
Yamaguchi,K., Yamamoto,M., Yamamoto,N., Yu,Y., Zhang,H., Zhao,Q.,<br />
Higo,K., Burr,B., Gojobori,T. and Sasaki,T.<br />
CONSRTM Rice Annotation Project<br />
TITLE Curated genome annotation of Oryza sativa ssp. japonica and<br />
comparative genome analysis with Arabidopsis thaliana<br />
JOURNAL Genome Res. 17 (2), 175-183 (2007)<br />
PUBMED 17210932<br />
REFERENCE 3<br />
AUTHORS Ohyanagi,H., Tanaka,T., Sakai,H., Shigemoto,Y., Yamaguchi,K.,<br />
Habara,T., Fujii,Y., Antonio,B.A., Nagamura,Y., Imanishi,T.,<br />
Ikeo,K., Itoh,T., Gojobori,T. and Sasaki,T.<br />
TITLE The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa<br />
ssp. japonica genome information<br />
JOURNAL Nucleic Acids Res. 34 (DATABASE ISSUE), D741-D744 (2006)<br />
PUBMED 16381971<br />
REFERENCE 4<br />
AUTHORS Matsumoto,T., Wu,J., Kanamori,H., Katayose,Y., Fujisawa,M.,<br />
Namiki,N., Mizuno,H., Yamamoto,K., Antonio,B.A., Baba,T.,<br />
Sakata,K., Nagamura,Y., Aoki,H., Arikawa,K., Arita,K., Bito,T.,<br />
Chiden,Y., Fujitsuka,N., Fukunaka,R., Hamada,M., Harada,C.,<br />
Hayashi,A., Hijishita,S., Honda,M., Hosokawa,S., Ichikawa,Y.,<br />
Idonuma,A., Iijima,M., Ikeda,M., Ikeno,M., Ito,K., Ito,S., Ito,T.,<br />
Ito,Y., Ito,Y., Iwabuchi,A., Kamiya,K., Karasawa,W., Kurita,K.,<br />
Katagiri,S., Kikuta,A., Kobayashi,H., Kobayashi,N., Machita,K.,<br />
Maehara,T., Masukawa,M., Mizubayashi,T., Mukai,Y., Nagasaki,H.,<br />
Nagata,Y., Naito,S., Nakashima,M., Nakama,Y., Nakamichi,Y.,<br />
Nakamura,M., Meguro,A., Negishi,M., Ohta,I., Ohta,T., Okamoto,M.,<br />
Ono,N., Saji,S., Sakaguchi,M., Sakai,K., Shibata,M., Shimokawa,T.,<br />
Song,J., Takazaki,Y., Terasawa,K., Tsugane,M., Tsuji,K., Ueda,S.,<br />
Waki,K., Yamagata,H., Yamamoto,M., Yamamoto,S., Yamane,H.,<br />
Yoshiki,S., Yoshihara,R., Yukawa,K., Zhong,H., Yano,M., Yuan,Q.,<br />
Ouyang,S., Liu,J., Jones,K.M., Gansberger,K., Moffat,K., Hill,J.,<br />
Bera,J., Fadrosh,D., Jin,S., Johri,S., Kim,M., Overton,L.,<br />
Reardon,M., Tsitrin,T., Vuong,H., Weaver,B., Ciecko,A., Tallon,L.,<br />
Jackson,J., Pai,G., Aken,S.V., Utterback,T., Reidmuller,S.,<br />
Feldblyum,T., Hsiao,J., Zismann,V., Iobst,S., de Vazeille,A.R.,<br />
Buell,C.R., Ying,K., Li,Y., Lu,T., Huang,Y., Zhao,Q., Feng,Q.,<br />
Zhang,L., Zhu,J., Weng,Q., Mu,J., Lu,Y., Fan,D., Liu,Y., Guan,J.,<br />
Zhang,Y., Yu,S., Liu,X., Zhang,Y., Hong,G., Han,B., Choisne,N.,<br />
Demange,N., Orjeda,G., Samain,S., Cattolico,L., Pelletier,E.,<br />
Couloux,A., Segurens,B., Wincker,P., D'Hont,A., Scarpelli,C.,<br />
Weissenbach,J., Salanoubat,M., Quetier,F., Yu,Y., Kim,H.R.,<br />
Rambo,T., Currie,J., Collura,K., Luo,M., Yang,T., Ammiraju,J.S.S.,<br />
Engler,F., Soderlund,C., Wing,R.A., Palmer,L.E., de la Bastide,M.,<br />
Spiegel,L., Nascimento,L., Zutavern,T., O'Shaughnessy,A., Dike,S.,<br />
Dedhia,N., Preston,R., Balija,V., McCombie,W.R., Chow,T., Chen,H.,<br />
Chung,M., Chen,C., Shaw,J., Wu,H., Hsiao,K., Chao,Y., Chu,M.,<br />
Cheng,C., Hour,A., Lee,P., Lin,S., Lin,Y., Liou,J., Liu,S.,<br />
Hsing,Y., Raghuvanshi,S., Mohanty,A., Bharti,A.K., Gaur,A.,<br />
Gupta,V., Kumar,D., Ravi,V., Vij,S., Kapur,A., Khurana,P.,<br />
Khurana,P., Khurana,J.P., Tyagi,A.K., Gaikwad,K., Singh,A.,<br />
Dalal,V., Srivastava,S., Dixit,A., Pal,A.K., Ghazi,I.A., Yadav,M.,<br />
Pandit,A., Bhargava,A., Sureshbabu,K., Batra,K., Sharma,T.R.,<br />
Mohapatra,T., Singh,N.K., Messing,J., Nelson,A.B., Fuks,G.,<br />
Kavchok,S., Keizer,G., Linton,E., Llaca,V., Song,R., Tanyolac,B.,<br />
Young,S., Ho-Il,K., Hahn,J.H., Sangsakoo,G., Vanavichit,A., de<br />
Mattos,Luiz.A.T., Zimmer,P.D., Malone,G., Dellagostin,O., de<br />
Oliveira,A.C., Bevan,M., Bancroft,I., Minx,P., Cordum,H.,<br />
Wilson,R., Cheng,Z., Jin,W., Jiang,J., Leong,S.A., Iwama,H.,<br />
Gojobori,T., Itoh,T., Niimura,Y., Fujii,Y., Habara,T., Sakai,H.,<br />
Sato,Y., Wilson,G., Kumar,K., McCouch,S., Juretic,N., Hoen,D.,<br />
Wright,S., Bruskiewich,R., Bureau,T., Miyao,A., Hirochika,H.,<br />
Nishikawa,T., Kadowaki,K., Sugiura,M., Burr,B. and Sasaki,T.<br />
CONSRTM International Rice Genome Sequencing Project<br />
TITLE The map-based sequence of the rice genome<br />
JOURNAL Nature 436 (7052), 793-800 (2005)<br />
PUBMED 16100779<br />
REFERENCE 5<br />
CONSRTM IRGSP(International Rice Genome Sequencing Project)<br />
TITLE Oryza sativa nipponbare(GA3) genomic DNA, chromosome 12<br />
JOURNAL Unpublished<br />
REFERENCE 6<br />
CONSRTM The Rice Annotation Project (RAP)<br />
TITLE The Second Rice Annotation Project Meeting (RAP2)<br />
JOURNAL Unpublished<br />
REFERENCE 7 (bases 1 to 1508)<br />
AUTHORS Sasaki,T.<br />
TITLE Direct Submission<br />
JOURNAL Submitted (25-OCT-2004) Contact:Takuji Sasaki National Institute of<br />
Agrobiological Sciences, Rice Genome Research Program; Kannondai<br />
2-1-2, Tsukuba, Ibaraki 305-8602, Japan URL<br />
:http://rgp.dna.affrc.go.jp/<br />
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final<br />
NCBI review. This record is derived from an annotated genomic<br />
sequence (NC_008405).<br />
On Jun 7, 2010 this sequence version replaced gi:115489405.<br />
The IRGSP pseudomolecules (Build 4.0).<br />
The orientation of the sequence is the short arm to the long arm of<br />
the chromosome.<br />
Genoscope, Evry cedex, France, URL:http://www.genoscope.cns.fr/,<br />
Tel:(33)0 1 60 87 25 00 Fax:(33)0 1 60 87 25 14<br />
<br />
The position of gaps in this pseudomolecule with unknown size is<br />
assigned 100 Ns based on the guideline set by DDBJ/EMBL/GenBank.<br />
<br />
This sequence entry was annotated by the Rice Annotation Project.<br />
http://rapdb.lab.nig.ac.jp/<br />
FEATURES Location/Qualifiers<br />
source 1..1508<br />
/organism="Oryza sativa Japonica Group"<br />
/mol_type="mRNA"<br />
/cultivar="Nipponbare"<br />
/db_xref="taxon:39947"<br />
/chromosome="12"<br />
gene 1..1508<br />
/gene="Os12g0597000"<br />
/db_xref="GeneID:4352701"<br />
CDS 373..1050<br />
/gene="Os12g0597000"<br />
/note="Similar to Calcineurin B-like protein 2 (SOS3-like<br />
calcium binding protein 1);<br />
contains InterPro domain(s): IPR002048, IPR001125;<br />
has GO asignment(s): GO:0005509;<br />
supported by AK111887"<br />
/codon_start=1<br />
/product="hypothetical protein"<br />
/protein_id="NP_001067190.1"<br />
/db_xref="GI:115489406"<br />
/db_xref="GeneID:4352701"<br />
/translation="MVQCLDGVRQLLAVVFKCCDLELKQPRGLEDPQVLARETVFSVS<br />
EVEALYELFKKISSAVIDDGLINKEEFQLALFKTSKKESLFADRVFDLFDTKHNGILG<br />
FDEFARALSVFHPSAPLDEKIDFSFQLYDLKQQGYIERQEVKQMVVATLAESGMNLSD<br />
EIIESIIDKTFEEADTKHDGRIDKEEWRNLVLRHPSLLKNMTLQYLKDITTTFPSFVF<br />
HSQVDDT"<br />
ORIGIN <br />
1 agacgcacgc gcacacgcat acgcatcgca gccagttcat cctcgattcc tcccccgaat<br />
61 ttccttcgcg atctcacccc gcgtgcccta gctagctatc gaatcccgtc acctcggcgg<br />
121 cggcggcgag atcggagctc cgggttaacc tcatccaccg cgaggcgtgg aacctctctc<br />
181 tctctcgctc tcaccacctg aggatcgaag atcgaaaccc ctggcaccgg ctcgggccgc<br />
241 ggaatgggcg gccgcggtga gtagctaggt ctgcggcggc ggagttgttg ttgttggtgg<br />
301 tggtggtggt ggaggaggag ttggcggcgg agggggcggg ggcgttggtg gtggtggtgg<br />
361 tgggagagta tcatggtgca gtgtctcgac ggggtgaggc agctgctggc ggtcgtgttc<br />
421 aagtgctgcg acctcgagct gaagcagccg cgggggctcg aggatcccca ggtcctcgcg<br />
481 agggagaccg tcttcagcgt gagcgaggtc gaggcgctgt acgagctctt caagaagata<br />
541 agcagtgctg tgattgatga cgggctgatt aacaaggagg agtttcagtt ggcgctgttc<br />
601 aagaccagca agaaggagag cctgttcgcc gaccgtgtat ttgatttgtt tgacacaaaa<br />
661 cacaatggaa ttttaggatt tgatgaattt gctcgtgcac tctcagtatt tcatccaagt<br />
721 gctccacttg atgagaagat tgacttttca ttccagttat atgatctcaa gcaacaaggc<br />
781 tatattgaga gacaagaggt taagcagatg gttgttgcta cacttgctga gtctggaatg<br />
841 aatctttctg atgaaattat agagagcata atcgataaga catttgagga ggcagacaca<br />
901 aagcatgatg gaagaattga taaagaagag tggcgcaatc tggttcttcg tcatccctct<br />
961 ttgctgaaga acatgactct ccagtacctc aaggacatca ccactacatt tccaagcttt<br />
1021 gtcttccatt cccaggtcga tgacacctga attcttggat ttgtttgaac tcaaaccatc<br />
1081 agaagaatgc tcatgccggt tcattaagaa ttttgatatt gggttgttgg attgggcaga<br />
1141 gactccagag ctctgtagga tgttgcatgt tcgatttgag aagttctcaa atctttaaat<br />
1201 tgatgtaact ttgtttcttt cgtttggaag tttagtgtgg ctggagactt tcggggagat<br />
1261 gttaaatttc tgtctgaatc cgtagatcct ttattctctt cccctctttt ctgtttttct<br />
1321 ggctagcaat cagaatatct tttctgtttt tttggctagc aatcagaata tcggatatag<br />
1381 ttttgtgaat ctttcatttt gcgtacaaaa taggaacctt caaaaaaatt gatcgtgctg<br />
1441 gaaaatgttc tgttggagtt tgcaaattgc aatgatcatg aaatgctctc cttttttgag<br />
1501 agtttgca</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173409Os12g01016002014-05-28T03:16:51Z<p>Lizhitao: </p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
==Annotated Information==<br />
===Function===<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Please input function information here.<br />
<br />
===Expression===<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) athere <br />
<br />
===Mutation===<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173384Os12g01016002014-05-28T02:13:14Z<p>Lizhitao: </p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1<br />
Function<br />
Map-based cloning revealed thatNAL2andNAL3are paralogs that encode an identical OsWOX3A (OsNS) transcriptional activator, homologous to NARROW SHEATH1 (NS1) and NS2 in maize and PRESSED FLOWER in Arabidopsis.OsWOX3Ais expressed in the vascular tissues of various organs, wherenal2/3mutant phenotypes were displayed. Expression levels of several leaf development-associated genes were altered innal2/3, and auxin transportrelated genes were significantly changed, leading topinmutant-like phenotypes such as more tillers and fewer lateral roots.OsWOX3Ais involved in organ development in rice, lateral-axis outgrowth and vascular patterning in leaves, lemma and palea morphogenesis in spikelets, and development of tillers and lateral roots.<br />
Mutations<br />
narrow leaf2 narrow leaf3(nal2 nal3; hereafternal2/3) double mutant, which produces narrow-curly leaves, more tillers, fewer lateral roots, opened spikelets and narrow-thin grains.Thenal2 nal3(nal2/3) double recessive mutant ofOryza sativaL.japonica rice was previously obtained from Kyushu University,Japan, and has been maintained by the Rural Development Administration, Korea. Thenal2/3mutant was backcrossed twice with a Japanesejaponicarice cv ‘Kinmaze’ and progressed for several generations. Kinmaze was used as the parental wild-type plant in this study. The growth chamber conditions were 12-h light (500lmol m2 s1)at30°C and 12-h dark at 20°C.<br />
Expression<br />
The ricenarrow leaf2andnarrow leaf3loci encode WUSCHELrelated homeobox 3A (OsWOX3A) and function in leaf, spikelet,tiller and lateral root development.nal2/3 mutation negatively affects both vegetative and reproductive organ development with a severe loss of grain yield.</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os12g0101600&diff=173374Os12g01016002014-05-28T01:49:30Z<p>Lizhitao: Created page with "Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1"</p>
<hr />
<div>Please cite: 李志涛 (2014) Gene: "Os12g0101600" in RiceWiki, available at http://ricewiki.big.ac.cn/index.php?title=Os12g0101600&action=edit&redlink=1</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0597200&diff=173363Os03g05972002014-05-28T01:26:54Z<p>Lizhitao: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
The predicted ORF ofYSAencodes a 742-amino acid polypeptide with a calculated molecular mass of 82.5kD. Database searches using Pfam revealed that YSAencodes a member of the P subfamily of PPR-containing proteins. The gene product contains a tandem repeat of 15 PPR motifs with varying degrees of conservation. The second to 15th repeats are contiguous, and the sequence is not well conserved (Fig. 4B). The PPR motif is a degenerate 35-amino acid repeat often arranged in tandem arrays of two to 27 repeats per polypeptide. Thus YSA is a new member of the superfamily of PPR proteins.<br />
===Function===<br />
YSA is required for chloroplast development in early seedling leaves, and disruption of its function causes a seedling stage-specific albino phenotype, but the plant recovers and develops normal green leaves from the four-leaf stage onward.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage.(Su N, Hu ML, Wu DX, et al.2012) <br />
Functional studies of PPR proteins in higher plants remain very sparse. Accumulating data point to an involvement in posttranscriptional processes in organelles. Additional evidence for a role of PPR proteins in regulating organelle gene expression has also come from positional cloning of several cytoplasmic male sterility (CMS) restorer genes from petunia (Petunia hybrida; Bentolila et al., 2002) and radish (Raphanus sativus; Brown et al., 2003; Desloire et al., 2003; Koizuka et al., 2003). Genetic and biochemical data, and structural modeling of PPR tracts based on established tetratricopeptide repeat proteins together suggest that PPR proteins typically bind directly to specific organellar RNA sequences through a surface created by the stacked helical repeating units. However, still very little is known about the functions, substrates, and regulatory mechanisms for the vast majority of PPR proteins.The ysa mutant develops albino leaves before the three-leaf stage, but the mutant gradually turns green and recovers to normal green at the six-leaf stage. Further investigation showed that the change in leaf color in ysa mutant is associated with changes in chlorophyll content and chloroplast development.<br />
<br />
<br />
===Expression===<br />
<br />
Tissue localization<br />
YSA is highly expressed in young leaves and stems, but not in the roots (Fig. 1, A–D). Quantitative real-time reverse transcription (RT)-PCR analysis revealed that the expression of YSA peaked in the fourth leaf (Fig. 2E). Thus, the expression pattern of YSA is consistent with the seedling-stage-specific albino phenotype of ysa mutant and further supports the notion that YSA plays an important role in chloroplast development in the first few leaves of rice seedlings, but plays more minor roles in later stages.<br />
<br />
[[File:picture1.jpg]]<br />
<br />
<br />
Figure 1. Phenotypic analysis of the ysa mutant plants. A to C, Phenotypes of Pei'ai64S (left) and ysa mutant (right) seedlings at 1 (A), 2 (B), and 3 (C) weeks after sowing. D, The pigment contents in leaves of 1-week-old ysa mutants are much lower than that in Pei'ai64S. E, The pigment contents in leaves of 6-week-old ysa mutants are similar to that of Pei'ai64S plants. Chla, Chlorophyll a; Chlb, chlorophyll b; Chl, total chlorophyll; Car, carotenoid. Bars represent sds of three measurements. Student’s t test was performed on the raw data; asterisk indicates statistical significance at P < 0.01. <br />
<br />
Subcellular Localization of YSA Protein<br />
<br />
The YSA protein is predicted to localize to chloroplasts by ChloroP (Emanuelsson et al., 1999) and TargetP (Emanuelsson et al., 2000). To investigate the actual cellular localization of YSA, we constructed the green fluorescent signals of YSA-GFP fusion proteins colocalized with the autofluorescent signals of chlorophylls in the chloroplasts, consistent with the results obtained for GFP fused to the transit peptide of the small subunit of Arabidopsis ribulose bisphosphate carboxylase (Fig. 2, A and B). When GFP fused to the nuclear localization signal of the fibrillarin protein, GFP signals located specifically in the nucleus of Arabidopsis protoplasts (Fig. 2C). In addition, the protoplasts transformed with the empty GFP vector without a specific targeting sequence had green fluorescent signals in both the cytoplasm and the nucleus (Fig.2, D and E). To further confirm the subcellular localization of YSA protein, we transformed the plasmid containing the YSA-GFP fusion constructs into rice protoplasts. Confocal microscopy observations revealed that GFP-YSA was exclusively detected in the chloroplasts (Fig. 2F). These findings suggest that YSA protein is localized to the chloroplast.<br />
<br />
[[File:picture2.jpg]]<br />
<br />
===Evolution===<br />
<br />
Homology with Arabidopsis Similar to At3g53700: MEE40 (maternal effect embryo arrest 40) (HF=7e-1)<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
<br />
Institute of Crop Science, National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing 10081, China<br />
<br />
==References==<br />
<br />
[1] Bentolila S, Alfonso AA, Hanson MR (2002) A pentatricopeptide repeat-containing gene restores fertility to cytoplasmic male-sterile plants. Proc Natl Acad Sci USA 99: 10887–10892<br />
<br />
[2] Brown GG, Formanová N, Jin H, Wargachuk R, Dendy C, Patil P, Laforest M, Zhang J, Cheung WY, Landry BS (2003) The radish Rfo restorer gene of Ogura cytoplasmic male sterility encodes a protein with multiple pentatricopeptide repeats. Plant J 35: 262–272<br />
<br />
[3] Desloire S, Gherbi H, Laloui W, Marhadour S, Clouet V, Cattolico L, Falentin C, Giancola S, Renard M, Budar F, et al. (2003) Identification of the fertility restoration locus, Rfo, in radish, as a member of the pentatricopeptide-repeat protein family. EMBO Rep 4: 588–594<br />
<br />
[4] Koizuka N, Imai R, Fujimoto H, Hayakawa T, Kimura Y, Kohno-Murase J, Sakai T, Kawasaki S, Imamura J (2003) Genetic characterization of a pentatricopeptide repeat protein gene, orf687, that restores fertility in the cytoplasmic male-sterile Kosena radish. Plant J 34: 407–415<br />
<br />
[5] Emanuelsson O, Nielsen H, von Heijne G (1999) ChloroP, a neural network-based method for predicting chloroplast transit peptides and their cleavage sites. Protein Sci 8: 978–984 <br />
<br />
[6] Emanuelsson O, Nielsen H, Brunak S, von Heijne G (2000) Predicting subcellular localization of proteins based on their N-terminal amino acid sequence. J Mol Biol 300: 1005–1016<br />
<br />
[7] Su N, Hu ML, Wu DX, et al.(2012) Disruption of a rice pentatricopeptide repeat protein causes a seedling-specific albino phenotype and its utilization to enhance seed purity in hybrid rice production［J］.Plant Physiology, 159（1）：227-238.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0597200|<br />
Description = Protein prenyltransferase domain containing protein|<br />
Version = NM_001057140.1 GI:115454008 GeneID:4333379|<br />
Length = 5627 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0597200, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:22993430..22999056|<br />
CDS = 22996530..22998758|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:22993430..22999056<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatga</cdnaseq>|<br />
AA = <aaseq>MPRVCAAPRAPPPPCPCHVGVGPLRPRWRASRHGPLRAAGQEQL LTALREQPDPDAALRMLNAALARDDFAPGPEVYEEIIRKLGAVGALDLMKVLVAEMRR EGHQVKLGVVHSFLDSYEGQQLFDDAVDLILNQLQPLFGIQADTVVYNHLLNVLVEGS KMKLLESVYSEMGARGIKPDVVTFNTLMKALCRAHQVRTAVLMLEEMSSRGVAPDETT FTTLMQGFVEEGSIEAALRVKARMLEMGCSATKVTVNVLINGYCKLGRVEDALGYIQQ EIADGFEPDQITYNTFVNGLCQNDHVGHALKVMDVMVQEGHDPDVFTYNIVVNCLCKN GQLEEAKGILNQMVDRGCLPDITTFNTLIAALCTGNRLEEALDLARQVTVKGVSPDVY TFNILINALCKVGDPHLALRLFEEMKNSGCTPDEVTYNTLIDNLCSLGKLGKALDLLK DMESTGCPRSTITYNTIIDGLCKKMRIEEAEEVFDQMDLQGISRNAITFNTLIDGLCK DKKIDDAFELINQMISEGLQPNNITYNSILTHYCKQGDIKKAADILETMTANGFEVDV VTYGTLINGLCKAGRTQVALKVLRGMRIKGMRPTPKAYNPVLQSLFRRNNIRDALSLF REMAEVGEPPDALTYKIVFRGLCRGGGPIKEAFDFMLEMVDKGFIPEFSSFRMLAEGL LNLGMDDYFIRAIEIIMEKVDLRESDVSAIRGYLKIRKFYDALATFGRFLEINNPQWS YR</aaseq>|<br />
DNA = <dnaseqindica>299..2527#ctcctgttcccctctgcctgccttcacggagaacacgccgccgcacgcccgcaaagttgtcgctccgccgccgggtcctgcggccacttcctccctctccctgtgcatgcgctctcttccccacctgtactttactttagctgctcctctgcccagttgcccacgacctgacgacccggacatggcgcaggctgaggcggggacgacgacatcgccggcgggttgacgcagaaaggagcgaccacccgagggctccgctggattttcaggtagctgagctgagctgaactgaaccccaatgccccgcgtttgcgccgcccctcgggcgccgccgccgccgtgcccgtgccatgtcggagtagggccgcttcggccgaggtggcgcgcctcccggcacggccctctccgggcggctggccaggagcagctcctcaccgccctgcgcgagcagccggaccccgacgcggcgctccggatgctcaacgcggcgctggcgcgggacgacttcgcgcccggccccgaggtctacgaggagatcatccgcaagctcggcgcggtcggggccctcgacctcatgaaggtgctcgtcgcggagatgcggcgggaggggcaccaggtgaaattgggcgtagtccactccttcttggacagctacgaggggcagcagctgttcgacgatgccgtcgacctgattctgaatcaactccaaccattgtttggcattcaggcagacaccgtggtgtacaatcaccttctcaatgttcttgtggaggggagcaaaatgaaactccttgaatcagtgtactcggagatgggtgctaggggaatcaagcctgatgttgtcacattcaacacactgatgaaggcgttgtgccgagcacatcaggtcaggactgcagttctcatgctcgaggaaatgtctagcagaggcgtggcgcctgacgagacgacgtttaccaccctgatgcaaggatttgtcgaggaggggagcatcgaggctgcactgagggtcaaagccaggatgttggaaatggggtgctcggcgacgaaggtgacggttaatgttttgattaatgggtactgcaagctagggagggtggaggatgctcttgggtatatacagcaggagattgccgatgggtttgagcctgaccagatcacatataacacttttgttaatggtctctgccaaaatgatcatgtcggccatgccctcaaagtcatggatgtgatggttcaggagggccatgatcctgatgttttcacctacaatatcgttgtgaattgcctttgtaaaaatggacagcttgaagaggcaaaaggaattctgaatcagatggtggatcggggttgtttgcctgacattaccacattcaacactctcattgctgccttatgcacggggaatcgacttgaggaagccttggaccttgcacgtcaggttacagtgaagggagtctctccagatgtttatactttcaatattctgattaacgcgctctgcaaagtaggcgatcctcatcttgcacttcgattgtttgaagagatgaagaacagtggatgcaccccggatgaagtaacatacaatactttgattgacaatctttgctcacttgggaagcttggtaaagcattggatttgttaaaagatatggagtccactggttgtcctcgaagtacaattacatataacactataattgacgggttatgcaagaaaatgagaatagaagaagcagaagaagtttttgatcaaatggatctgcaaggcatttcgaggaatgcaatcacattcaatactctcatcgatggtttgtgcaaggacaaaaagattgatgatgcttttgagcttattaatcaaatgataagtgaagggttgcaacctaacaatatcacttacaattctattctaactcattattgcaagcaaggtgacataaaaaaggctgcggatattttagaaactatgactgcaaatggatttgaagtggatgttgttacgtacggtactctgattaacggtctatgcaaggctggtaggacacaggttgctttgaaggtactcagaggtatgcggataaaagggatgaggcctactccaaaagcttacaatcctgtgctccagtctctcttcagacggaataatatcagagatgccctgagtcttttcagggagatggcagaggttggtgagcctcctgatgctttgacatataagattgtttttcgtgggctctgtcgtggtggagggcctattaaagaagcttttgatttcatgttggagatggttgataaggggttcataccagagttctcatccttccgtatgctagctgaaggtctattaaacctgggtatggatgattacttcattagagccattgaaataatcatggaaaaggtcgacctcagagagtctgatgtttctgcaataaggggatatctcaagatccgcaaattttatgatgcattagcaacctttggccgtttcctggagatcaacaaccctcaatggagttaccgatgaagcagaatacataactgggacaaattacttgaatagtattagggaaatctcaaagagtggatggaatttttgctggttgcttaggggaatgaaagtcttaaattgattataataggtgattgtgttcattcctcggtagggatgaagtcagagcatgaagaagctcatcttggtgcagaaacttagcttattggaacagaatctaggtgctaggtgctgtctgctgccagattagtacctagcgccttaacgaacagtggctgcagatcccatccgcttattttgatcaaatctgattcattttctattccctaataaaagcctgattcatcttcattgcatatggtcgaacctaaggctatcatgtacagttagatcccaacccttcgttctatgagatgttgtcccatagaagaaatatcttctgagtatatcctagtactctaaaatgttcactaatatgttcaacttaattagttttgtaacctcctaaaatagttctattagttttgtaaccttctaaaatatgaattagttttgatctggctgatcttcctttggttaggtactacaaattcttaattcagacacatatttggttttctgaaaatttcatctatatttggtcaggctggcatttgaagttcttattttagtcatatactttagttttttacaattttcatttgttaaagatgataatttatttgttagcacagagcatgtttagaaatctgaaatattaaaacatgcatgttctcatgaaaataaatgttagttttgtttaaattccaatccacatattttttaatcaatgtcagaaattaccatgcttcacttattgacctagtatatgtatagtatttgatggatcatgttgatttggatttgctctactaacttgttcctattccaacaaagatttatatgcatcttgtgttctaaaaatgctacatgtgtcaagttgaaggaaaattctagctatgtggtgtcctaattttggtagatggtacctagtaatagataacaattctgttttatagtgatgagtaaatttgactaaatcgagtctagaaagtgatataattttctggagaagtctttcttggtgatttgggaaagggccattacctatactgatatgaaatctggaactagaaagatctgaacatcaatgttctaaagttttttgtctgaatttcttgtgcagaatatgaaggaaggtggatctggaataggtatttacatgtcctgttcagattcctgcaatctgataaactactgcaatccaataaactcttgatctattgttttctggatttttttttgggtgtagagtattaggaaggtatttgctttgttacaggggttggttggatgttcagaaaaccaaaatctgaatacactaacacattagccagtgttttattttagtttatgttattctgaccacaacaccagcagcttcaattggtagtagaacacactctgatgcaattggtaggtgtacaacagataatttgccgtgaatgctacttaattcaaccattttttttccatacagtgctatacaatggcacacaaacatccttcagttggactcaaatttgtttcagctttgctattttacagtcacctgcagttttttctaatccatcagtcgattttgttggcagtagattctgcttcaagatctgtgcacgcagtggaggcacatttggttacaggctgcttcaccagacccgttaacccatgggccatggatgctcccctagtagcatatgttgttttttccaccaactgcctcttgtaaatcaagatgctcccctctccacatttgctgcagacttcctccccgtggatctgagacgaactccggcgaccggcggcgtctacgagccagcgttcaccaatttctcaggtatatgagtcgtcatctatgtgcatctgctactttttttttttggctgattggacgggttgagaaggaggtgtttggggggaagagagcagaataatcccattgcgaaacaagcgaggaaggcttgtcgatggtggcggcggtggccttgattatcgaagatgcatgcgtgagggaaactgtgtgccagggaggcaagcttggtggcacacatcgagtggtatatcttcaggttactgctagatcgaagatcctttggtgcttgatgtgtgctgttggtttggtagttttggtggtactgtggcaagtgaagacacgaaagaggagctagtagaggcttagagtctggagtcgtaatcgatgtgcaagagcatcaatgccatcagttcctctgggcagcacggctctgcacttttcatctgagaaacatatatattttgttgattctgattttgacgaattatccaaacatgcagtttttttgggttccgcgtgcaaagacgattttgatctcctggcagatttaagggtggtgattttgtttttgttttgcatgtagatgatgcattttgtaaatcattttaggttgccccttttttttttgtttttgcgagttcttactgaatttggataagttctggttgattggatcgacattctgtacatttgcaaggggattctatgggtttttgcttattgctaatcaaattattttgtgagttttggtttattggatggtgagaaagcaagattacatggattttgcttcattgctgattttgtcgaaatttatcaggcatgcggtttttggtttcttgaatacgaactacacggacagtactcctatattcttggtgattttgaagtgtatttgttattttggggaggtggaatggttaatattttgttcaaggggacacttctacagatgtatacattacttttgtcattttcagcataacaaagagatttggtagattcagaattcagatggcaactacacgtcgaatgatgtatgcgaagacatggggaattctgatgctgattccactgaagaaagctaaacataattttaatttatttaccaactcatttttctgtcaacacatttgctagatagttgctacccgataaacgacatcttgaaatctgagttatacttcagtctattttttttcc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001057140.1 RefSeq:Os03g0597200]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os08g0531600&diff=173307Os08g05316002014-05-27T15:11:49Z<p>Lizhitao: </p>
<hr />
<div>Os08g0531600(OsSPL16) is a very important gene that encoding a positive regulator of cell prolifertion which can pormote cell division and grain filling.<br />
<br />
==Annotated Information==<br />
qGW8 within a genetic window on the long arm of chromosome 8 defined by the markers RM80 and RM447.The progeny testing of homozygous recombinant plants allowed this region to be narrowed to an ~7.5-kb stretch flanked by RM502 and PSM711.Quantitative trait locus GW8 is synonymous with OsSPL16, which encodes a protein that is a positive regulator of cell proliferation.Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. Conversely, a loss-of-function mutation in Basmati rice is associated with the formation of a more slender grain and better quality of appearance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs. We also show that a marker-assisted strategy targeted at elite alleles of GS3 and OsSPL16 underlying grain size and shape can be effectively used to simultaneously improve grain quality and yield.<br />
===Function===<br />
[[File:Parental grains.jpg|frame|'''Figure1''' Parental grains. Scale bar, 3 mm.]]<br />
<br />
'''''OsSPL16''''' control of grain size, shape, and quality<ref name="ref1" />.<br />
'''''OsSPL16''''' encodes a protein that is a positive regulator of cell proliferation. OsSPL16contributes to organ size through its effect on the cell cycle machinery.Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. The candidate gene ''''''OsSPL16'''''' encodes squamosa promoter-binding protein-like 16, which belongs to the SBP domain family of transcription factors and shares homology with the product of '''''tga1''''',a domestication syndrome gene associated with the formation of grains in maize<ref name="ref1" />. Grain width and length were also altered in NIL-'''''qw8''''' plaints expressing the Basmati385 '''''OsSPL16''''' cDNA under the control of the native HJX74 promoter.The SPL genes have an important role in the control of flowering.The SPL genes have been shown to be regulated by microRNA miR156 (refs. 14–16,19–22), and OsSPL16contains an OsmiR156 target sequence. OsSPL16functions as a negative regulator of panicle branching.<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Mutation===<br />
Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice.A loss-of-function mutation in Basmati rice is assciated with the formation of a more slender grain and better quality of apperance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs<ref name="ref1" />.<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Expression===<br />
[[File: Expression of OsSPL16in NIL-GW8and NIL-gw8.jpg|frame|'''Figure2''' Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).]]<br />
The expression profiles of OsSPL16in various organs of HJX74 were examined by quantitative RT-PCR analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)<ref name="ref1 " /><br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National <br />
Centre for Plant Gene Research, Beijing, China. <br />
The State Key Laboratory for Conservation and Utilization of Subtropical Agro-bioresources, South China Agricultural <br />
University, Guangzhou, China. <br />
The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China.<br />
working<br />
Development of the SSSL population.Fine mapping of qGW8.Transgene constructs.Expression analysis.Histological analysis.Transactivation activity assay.Analysis of transgenic plants expressing OsSPL16.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1"><br />
Wang S, Wu K, Yuan Q, et al. Control of grain size, shape and quality by OsSPL16 in rice[J]. Nature genetics, 2012, 44(8): 950-954.<br />
</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os08g0531600|<br />
Description = Similar to Squamosa-promoter binding-like protein 3|<br />
Version = NM_001068869.1 GI:115477476 GeneID:4346133|<br />
Length = 5032 bp|<br />
Definition = Oryza sativa Japonica Group Os08g0531600, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|<br />
AP = Chromosome 8:26589172..26594203|<br />
CDS = 26589228..26589718,26592621..26592751,26593194..26593939|<br />
GCID = <gbrowseImage1><br />
name=NC_008401:26589172..26594203<br />
source=RiceChromosome08<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008401:26589172..26594203<br />
source=RiceChromosome08<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtag</cdnaseq>|<br />
AA = <aaseq>MEWDLKMPPAASWELADELENSGGGGVPAAVSSSSAAVGGGVNA GGGGRQECSVDLKLGGLGEFGGGGAQPRVAVAGEPAKGKGPAAAATGAAAAASSAPAK RPRGAAAAGQQQCPSCAVDGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQ QCSRFHLLQEFDEAKRSCRKRLDGHNRRRRKPQPDPMNSASYLASQQGARFSPFATPR PEASWTGMIKTEESPYYTHHQIPLGISSRQQHFVGSTSDGGRRFPFLQEGEISFGTGA GAGGVPMDQAAAAAAASVCQPLLKTVAPPPPPHGGGGSGGGKMFSDGGLTQVLDSDCA LSLLSAPANSTAIDVGGGRVVVQPTEHIPMAQPLISGLQFGGGGGSSAWFAARPHHQA ATGAAATAVVVSTAGFSCPVVESEQLNTVLSSNDNEMNYNGMFHVGGEGSSDGTSSSL PFSWQ</aaseq>|<br />
DNA = <dnaseqindica>57..547#3450..3580#4023..4768#acagctcaagcttacgcgggagctaagctgagctacagcgagcggcggcggcggccatggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtaaccccccccccccccccccaaccattgtctccttccttcccgccaaattcactgcaaaacaaaaaaaaaatcgtagcccaaaacaccccaagacgtcatggcaattcgcatcaagaactgcatatatcaatttctccacttcttttcagcgtcactgtctctgatcattctctttgctgaacaaaagaaaaagaagataagcaagagtttttctcttttttttgctccttttttttttggctttgcacaatctcttcttgcttccagttgcaactgaccattgtgcagtacatgcatctgcatctactgattctaatttctacgctacttcggatcaaaattaattcagtactgcaaagcacaatttcattgatccatttcatccagcctcggactttgttcatcatcatctatctgtctcttacttcctttccattgggagcatactatccggctgtctcgtttcagggacgcacagctttgcctttaatggcatgccttttcagccttccctcatgctatcctttagctcggcaactcgtattaccccaaattattacctctttgctcgcctttagatttattactatcatcttttcttttcttttttatatctcttcttcaccagtagctgcactgtttttgcactgctcaagagcaaagcagctgctgtagttgttcagtgtttgttgcttactgagaaaaaaaagtgatagagacagaaaaaaaagtgagggagagaaaaaaaaaaaaacagaactgacgcctgaatctcatcagccagagatcacattaggcaatttaccaccagactgttatgatattattttcagtgtcctcctgtctgaatatgaccgtctgcttcctctaacaagaacaataaatcagcacctagttcagtactaactaattttctcatgaataaataaataaatatagtcactgtaattagtgacactactagcacggtagcacctggtttagtggttaacaatacttggttcttgcacttctccctgtcgatgttttttcgcgtgggggctagctatcgattgattgattcctcaactatggcatcgaaactggaagaacatatgcatactgggacacacaccctgcttgctttctgaatttctgatttctcctcaaggcagctggcctaccacatatatctgactgagctgtgctgcttcttgccatgagagctaagctaccttagcttagctactactaccacttactacgccgtctgttttggaagggaaaggcagatgtggatgcccaaacctagaaagatggttgtaccactgaaagagagagtttgtggatgtgatctgcactaaagcacccctgtacagggaaaggaccatgtagccctactacaagttcaccatttacacctctgttcctaaggttgggccacacatatatgaagcttttaatgtctcggtttgttggaaagggttttgcattgccattacaagccagcacagtggatacagatagccagggtgctctctattggagaagaaaaaaaatggagccctgaacaccctgattggatctcactattgcatgaaagaatgatgagatttcttgtcttataatttttaaagattttttttctaaagtcagtcttagttacattcatttgttatattccagtttcagacttattggtactaggttctgtgagatctttttttttttttacatcgtttgagtatcatagggtgattcagtaccaccttgacccctgtttttatcagagctctaaacttctaacaccacttctaacttttgagctagtcttctaaccttgctgttttctgaacaaagatgtatactcaagattggtcatagatggagatattctgtgaacagaactaacataatagcaccaaattagtcagacatactctttacaaaattactttggagtttgttgtccactccttgaactagtacaatattgtcctactgaatgccttcctgcctttcaacttgaaagttccctattttatctgttagttcttttataaaatgtaactgcacattgtcagaaggatttgcatcttatttcactttgcgccagttttaagtaatacatggtatattggcataagaccagactctaccattttttatcttgcagagacatagcaaacaactaagtactttttattgtggtgtgctcctttacacagtagcacaacttgtaggatgcttatgtgattgtctcatcaattattctctttatctttaaaaagagaatgatacaaaaaatctctttatctgagaatacacattacccagtggggacagtctttcaatgatttgattacttcgtcagtgtttgcaaactgggaagatcattatgctgctgcatgcagactttataaattaagtgatcttcagagtcagaacaagatgttagctttctatacctatggatccacatccactgtattgtggtccatgtacaagtggggttaaaatatttttctgccgttgacagaacttcagttcaataaatttatctaagatgaagtatccaagcacggaaagagctaattaactgatgaaattcctgtggtcccttgtgttggtatatgagtattctaagagagaatatggagacagtatattaaattattctgagaatacttatcctgacgtttctttagtgagaactgtggtgcatcgttacaaaacttcagatcatgtttcaggagtattttatcatgtaagaattttaaaaagacgtacatcctaggtacagtcatttcttaaggtttcatggtactgaatgattaaattacttcttctggattgggtttcaagcatcatttggctaatttcaatgcagttaaatgatcataagcttttctttcttcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggtattttcttgtttattattaccactctatgatatcgcagttcatataagattaactgggatatagtcattcagacttcctaactattgttagactaggaaaaaaactatgaaacatgctaatagcatagataagtcatggtaaaaaaaaagtaaaagaaaatgaaactgtggttaaaaaaaaacgcaaatattagggaatgacctaatatcaaataattagaaggagtgaggcttcgaacccaggtcgtctagcccatcaccttttgaagctagccagaaaacccctgggcgtttctcagaactgtggttcagctatgactctgttctttcaatcctgacatcttgtaacatgtaatgcattctagtatacatctaatgcattgaaccatatcttatgtactaatttgtgctgatatatcaaacatcgcatcaaaattcaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtagttttttcagtaactgtatgttgctgccttagtttcagtagagttggttcttcatttcttttcagtgatcaaattattgtttctgttcttttctgccatggtaagttccttttttttttcttcttcttgccttcatttgagttaattacagcattgatttgtgtgaacaaaattcatcataaatcagttcctcgcgagatcattggtctcaacatgatggtgccaagtgagaactgcagtattgtgcagttttcagttttgagtc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001068869.1 RefSeq:Os08g0531600]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 8]]<br />
[[Category:Chromosome 8]]<br />
Gene Attributes<br />
Chromosome: Chr8<br />
CDS Coordinates (5'-3'): 26501167 - 26506218<br />
Nucleotide length: 1368<br />
Predicted protein length: 456<br />
Predicted molecular weight: 46578.9<br />
Predicted pI: 7.502<br />
<br />
Gene Structure<br />
Gene Attributes<br />
Chromosome: Chr8<br />
CDS Coordinates (5'-3'): 26501167 - 26506218<br />
Nucleotide length: 1368<br />
Predicted protein length: 456<br />
Predicted molecular weight: 46578.9<br />
Predicted pI: 7.502<br />
<br />
Gene Structure</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os08g0531600&diff=173289Os08g05316002014-05-27T14:31:38Z<p>Lizhitao: </p>
<hr />
<div>Os08g0531600(OsSPL16) is a very important gene that encoding a positive regulator of cell prolifertion which can pormote cell division and grain filling.<br />
<br />
==Annotated Information==<br />
===Function===<br />
[[File:Parental grains.jpg|frame|'''Figure1''' Parental grains. Scale bar, 3 mm.]]<br />
<br />
'''''OsSPL16''''' control of grain size, shape, and quality<ref name="ref1" />.<br />
'''''OsSPL16''''' encodes a protein that is a positive regulator of cell proliferation. Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. The candidate gene ''''''OsSPL16'''''' encodes squamosa promoter-binding protein-like 16, which belongs to the SBP domain family of transcription factors and shares homology with the product of '''''tga1''''',a domestication syndrome gene associated with the formation of grains in maize<ref name="ref1" />. Grain width and length were also altered in NIL-'''''qw8''''' plaints expressing the Basmati385 '''''OsSPL16''''' cDNA under the control of the native HJX74 promoter.<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Mutation===<br />
<br />
A loss-of-function mutation in Basmati rice is assciated with the formation of a more slender grain and better quality of apperance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs<ref name="ref1" />.<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Expression===<br />
[[File: Expression of OsSPL16in NIL-GW8and NIL-gw8.jpg|frame|'''Figure2''' Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).]]<br />
The expression profiles of OsSPL16in various organs of HJX74 were examined by quantitative RT-PCR analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)<ref name="ref1 " /><br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1"><br />
Wang S, Wu K, Yuan Q, et al. Control of grain size, shape and quality by OsSPL16 in rice[J]. Nature genetics, 2012, 44(8): 950-954.<br />
</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os08g0531600|<br />
Description = Similar to Squamosa-promoter binding-like protein 3|<br />
Version = NM_001068869.1 GI:115477476 GeneID:4346133|<br />
Length = 5032 bp|<br />
Definition = Oryza sativa Japonica Group Os08g0531600, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|<br />
AP = Chromosome 8:26589172..26594203|<br />
CDS = 26589228..26589718,26592621..26592751,26593194..26593939|<br />
GCID = <gbrowseImage1><br />
name=NC_008401:26589172..26594203<br />
source=RiceChromosome08<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008401:26589172..26594203<br />
source=RiceChromosome08<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtag</cdnaseq>|<br />
AA = <aaseq>MEWDLKMPPAASWELADELENSGGGGVPAAVSSSSAAVGGGVNA GGGGRQECSVDLKLGGLGEFGGGGAQPRVAVAGEPAKGKGPAAAATGAAAAASSAPAK RPRGAAAAGQQQCPSCAVDGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQ QCSRFHLLQEFDEAKRSCRKRLDGHNRRRRKPQPDPMNSASYLASQQGARFSPFATPR PEASWTGMIKTEESPYYTHHQIPLGISSRQQHFVGSTSDGGRRFPFLQEGEISFGTGA GAGGVPMDQAAAAAAASVCQPLLKTVAPPPPPHGGGGSGGGKMFSDGGLTQVLDSDCA LSLLSAPANSTAIDVGGGRVVVQPTEHIPMAQPLISGLQFGGGGGSSAWFAARPHHQA ATGAAATAVVVSTAGFSCPVVESEQLNTVLSSNDNEMNYNGMFHVGGEGSSDGTSSSL PFSWQ</aaseq>|<br />
DNA = <dnaseqindica>57..547#3450..3580#4023..4768#acagctcaagcttacgcgggagctaagctgagctacagcgagcggcggcggcggccatggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtaaccccccccccccccccccaaccattgtctccttccttcccgccaaattcactgcaaaacaaaaaaaaaatcgtagcccaaaacaccccaagacgtcatggcaattcgcatcaagaactgcatatatcaatttctccacttcttttcagcgtcactgtctctgatcattctctttgctgaacaaaagaaaaagaagataagcaagagtttttctcttttttttgctccttttttttttggctttgcacaatctcttcttgcttccagttgcaactgaccattgtgcagtacatgcatctgcatctactgattctaatttctacgctacttcggatcaaaattaattcagtactgcaaagcacaatttcattgatccatttcatccagcctcggactttgttcatcatcatctatctgtctcttacttcctttccattgggagcatactatccggctgtctcgtttcagggacgcacagctttgcctttaatggcatgccttttcagccttccctcatgctatcctttagctcggcaactcgtattaccccaaattattacctctttgctcgcctttagatttattactatcatcttttcttttcttttttatatctcttcttcaccagtagctgcactgtttttgcactgctcaagagcaaagcagctgctgtagttgttcagtgtttgttgcttactgagaaaaaaaagtgatagagacagaaaaaaaagtgagggagagaaaaaaaaaaaaacagaactgacgcctgaatctcatcagccagagatcacattaggcaatttaccaccagactgttatgatattattttcagtgtcctcctgtctgaatatgaccgtctgcttcctctaacaagaacaataaatcagcacctagttcagtactaactaattttctcatgaataaataaataaatatagtcactgtaattagtgacactactagcacggtagcacctggtttagtggttaacaatacttggttcttgcacttctccctgtcgatgttttttcgcgtgggggctagctatcgattgattgattcctcaactatggcatcgaaactggaagaacatatgcatactgggacacacaccctgcttgctttctgaatttctgatttctcctcaaggcagctggcctaccacatatatctgactgagctgtgctgcttcttgccatgagagctaagctaccttagcttagctactactaccacttactacgccgtctgttttggaagggaaaggcagatgtggatgcccaaacctagaaagatggttgtaccactgaaagagagagtttgtggatgtgatctgcactaaagcacccctgtacagggaaaggaccatgtagccctactacaagttcaccatttacacctctgttcctaaggttgggccacacatatatgaagcttttaatgtctcggtttgttggaaagggttttgcattgccattacaagccagcacagtggatacagatagccagggtgctctctattggagaagaaaaaaaatggagccctgaacaccctgattggatctcactattgcatgaaagaatgatgagatttcttgtcttataatttttaaagattttttttctaaagtcagtcttagttacattcatttgttatattccagtttcagacttattggtactaggttctgtgagatctttttttttttttacatcgtttgagtatcatagggtgattcagtaccaccttgacccctgtttttatcagagctctaaacttctaacaccacttctaacttttgagctagtcttctaaccttgctgttttctgaacaaagatgtatactcaagattggtcatagatggagatattctgtgaacagaactaacataatagcaccaaattagtcagacatactctttacaaaattactttggagtttgttgtccactccttgaactagtacaatattgtcctactgaatgccttcctgcctttcaacttgaaagttccctattttatctgttagttcttttataaaatgtaactgcacattgtcagaaggatttgcatcttatttcactttgcgccagttttaagtaatacatggtatattggcataagaccagactctaccattttttatcttgcagagacatagcaaacaactaagtactttttattgtggtgtgctcctttacacagtagcacaacttgtaggatgcttatgtgattgtctcatcaattattctctttatctttaaaaagagaatgatacaaaaaatctctttatctgagaatacacattacccagtggggacagtctttcaatgatttgattacttcgtcagtgtttgcaaactgggaagatcattatgctgctgcatgcagactttataaattaagtgatcttcagagtcagaacaagatgttagctttctatacctatggatccacatccactgtattgtggtccatgtacaagtggggttaaaatatttttctgccgttgacagaacttcagttcaataaatttatctaagatgaagtatccaagcacggaaagagctaattaactgatgaaattcctgtggtcccttgtgttggtatatgagtattctaagagagaatatggagacagtatattaaattattctgagaatacttatcctgacgtttctttagtgagaactgtggtgcatcgttacaaaacttcagatcatgtttcaggagtattttatcatgtaagaattttaaaaagacgtacatcctaggtacagtcatttcttaaggtttcatggtactgaatgattaaattacttcttctggattgggtttcaagcatcatttggctaatttcaatgcagttaaatgatcataagcttttctttcttcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggtattttcttgtttattattaccactctatgatatcgcagttcatataagattaactgggatatagtcattcagacttcctaactattgttagactaggaaaaaaactatgaaacatgctaatagcatagataagtcatggtaaaaaaaaagtaaaagaaaatgaaactgtggttaaaaaaaaacgcaaatattagggaatgacctaatatcaaataattagaaggagtgaggcttcgaacccaggtcgtctagcccatcaccttttgaagctagccagaaaacccctgggcgtttctcagaactgtggttcagctatgactctgttctttcaatcctgacatcttgtaacatgtaatgcattctagtatacatctaatgcattgaaccatatcttatgtactaatttgtgctgatatatcaaacatcgcatcaaaattcaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtagttttttcagtaactgtatgttgctgccttagtttcagtagagttggttcttcatttcttttcagtgatcaaattattgtttctgttcttttctgccatggtaagttccttttttttttcttcttcttgccttcatttgagttaattacagcattgatttgtgtgaacaaaattcatcataaatcagttcctcgcgagatcattggtctcaacatgatggtgccaagtgagaactgcagtattgtgcagttttcagttttgagtc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001068869.1 RefSeq:Os08g0531600]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 8]]<br />
[[Category:Chromosome 8]]<br />
Gene Attributes<br />
Chromosome: Chr8<br />
CDS Coordinates (5'-3'): 26501167 - 26506218<br />
Nucleotide length: 1368<br />
Predicted protein length: 456<br />
Predicted molecular weight: 46578.9<br />
Predicted pI: 7.502<br />
<br />
Gene Structure<br />
Gene Attributes<br />
Chromosome: Chr8<br />
CDS Coordinates (5'-3'): 26501167 - 26506218<br />
Nucleotide length: 1368<br />
Predicted protein length: 456<br />
Predicted molecular weight: 46578.9<br />
Predicted pI: 7.502<br />
<br />
Gene Structure</div>Lizhitaohttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os08g0531600&diff=173288Os08g05316002014-05-27T14:29:05Z<p>Lizhitao: /* References */</p>
<hr />
<div>Os08g0531600(OsSPL16) is a very important gene that encoding a positive regulator of cell prolifertion which can pormote cell division and grain filling.<br />
<br />
==Annotated Information==<br />
===Function===<br />
[[File:Parental grains.jpg|frame|'''Figure1''' Parental grains. Scale bar, 3 mm.]]<br />
<br />
'''''OsSPL16''''' control of grain size, shape, and quality<ref name="ref1" />.<br />
'''''OsSPL16''''' encodes a protein that is a positive regulator of cell proliferation. Higher expression of this gene promotes cell division and grain filling, with positive consequences for grain width and yield in rice. The candidate gene ''''''OsSPL16'''''' encodes squamosa promoter-binding protein-like 16, which belongs to the SBP domain family of transcription factors and shares homology with the product of '''''tga1''''',a domestication syndrome gene associated with the formation of grains in maize<ref name="ref1" />. Grain width and length were also altered in NIL-'''''qw8''''' plaints expressing the Basmati385 '''''OsSPL16''''' cDNA under the control of the native HJX74 promoter.<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Mutation===<br />
<br />
A loss-of-function mutation in Basmati rice is assciated with the formation of a more slender grain and better quality of apperance. The correlation between grain size and allelic variation at the GW8 locus suggests that mutations within the promoter region were likely selected in rice breeding programs<ref name="ref1" />.<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Expression===<br />
[[File: Expression of OsSPL16in NIL-GW8and NIL-gw8.jpg|frame|'''Figure2''' Expression of OsSPL16in NIL-GW8and NIL-gw8.R, root; C, culm; L, leaf blade; SAM, shoot apex meristem; BM, branch meristem; YP1–Y22, young panicles, where the number indicates the length of the panicle in centimeters. Expression levels are shown as relative number of copies per 1,000 copies of rice actin3. Data are given as mean ±s.e.m. (n= 4).]]<br />
The expression profiles of OsSPL16in various organs of HJX74 were examined by quantitative RT-PCR analysis. OsSPL16 was preferentially expressed in developing panicles, and the highest levels of OsSPL16expression were found in panicles of 7 cm in length, whereas there was less transcript accumulation in the root, culm, leaf sheath, shoot meristem and young panicle(of <1 cm in length)<ref name="ref1 " /><br />
<br />
<br />
<br />
<br />
<br />
<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
<references><br />
* <ref name="ref1"><br />
Wang S, Wu K, Yuan Q, et al. Control of grain size, shape and quality by OsSPL16 in rice[J]. Nature genetics, 2012, 44(8): 950-954.<br />
</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os08g0531600|<br />
Description = Similar to Squamosa-promoter binding-like protein 3|<br />
Version = NM_001068869.1 GI:115477476 GeneID:4346133|<br />
Length = 5032 bp|<br />
Definition = Oryza sativa Japonica Group Os08g0531600, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 8|Chromosome 8]]|<br />
AP = Chromosome 8:26589172..26594203|<br />
CDS = 26589228..26589718,26592621..26592751,26593194..26593939|<br />
GCID = <gbrowseImage1><br />
name=NC_008401:26589172..26594203<br />
source=RiceChromosome08<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008401:26589172..26594203<br />
source=RiceChromosome08<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtag</cdnaseq>|<br />
AA = <aaseq>MEWDLKMPPAASWELADELENSGGGGVPAAVSSSSAAVGGGVNA GGGGRQECSVDLKLGGLGEFGGGGAQPRVAVAGEPAKGKGPAAAATGAAAAASSAPAK RPRGAAAAGQQQCPSCAVDGCKEDLSKCRDYHRRHKVCEAHSKTPLVVVSGREMRFCQ QCSRFHLLQEFDEAKRSCRKRLDGHNRRRRKPQPDPMNSASYLASQQGARFSPFATPR PEASWTGMIKTEESPYYTHHQIPLGISSRQQHFVGSTSDGGRRFPFLQEGEISFGTGA GAGGVPMDQAAAAAAASVCQPLLKTVAPPPPPHGGGGSGGGKMFSDGGLTQVLDSDCA LSLLSAPANSTAIDVGGGRVVVQPTEHIPMAQPLISGLQFGGGGGSSAWFAARPHHQA ATGAAATAVVVSTAGFSCPVVESEQLNTVLSSNDNEMNYNGMFHVGGEGSSDGTSSSL PFSWQ</aaseq>|<br />
DNA = <dnaseqindica>57..547#3450..3580#4023..4768#acagctcaagcttacgcgggagctaagctgagctacagcgagcggcggcggcggccatggagtgggatctcaagatgccgccggcggcgagctgggagctagccgacgagctggagaacagcggcggcgggggtgtaccggcggcggtatcgtcgtcatcggctgcggttggtggcggcgtcaatgcggggggtggtggcaggcaggagtgctcggtcgacctcaagctcggcgggttgggggagttcggcggcggcggcgcgcagccgcgggtcgccgtggcgggcgagccggccaaggggaaggggccagcggccgccgccacgggagcagcagcagcagcgtcgtcggcgccggcgaagcggccgcgcggtgcggcggcggcggggcagcagcagtgcccgtcgtgcgcggtggacgggtgcaaggaggacctgagcaagtgccgcgactaccatcgccggcacaaggtgtgcgaggcccactccaagacccccctcgtcgtcgtctccggccgcgagatgcgcttctgccagcagtgcagcaggtaaccccccccccccccccccaaccattgtctccttccttcccgccaaattcactgcaaaacaaaaaaaaaatcgtagcccaaaacaccccaagacgtcatggcaattcgcatcaagaactgcatatatcaatttctccacttcttttcagcgtcactgtctctgatcattctctttgctgaacaaaagaaaaagaagataagcaagagtttttctcttttttttgctccttttttttttggctttgcacaatctcttcttgcttccagttgcaactgaccattgtgcagtacatgcatctgcatctactgattctaatttctacgctacttcggatcaaaattaattcagtactgcaaagcacaatttcattgatccatttcatccagcctcggactttgttcatcatcatctatctgtctcttacttcctttccattgggagcatactatccggctgtctcgtttcagggacgcacagctttgcctttaatggcatgccttttcagccttccctcatgctatcctttagctcggcaactcgtattaccccaaattattacctctttgctcgcctttagatttattactatcatcttttcttttcttttttatatctcttcttcaccagtagctgcactgtttttgcactgctcaagagcaaagcagctgctgtagttgttcagtgtttgttgcttactgagaaaaaaaagtgatagagacagaaaaaaaagtgagggagagaaaaaaaaaaaaacagaactgacgcctgaatctcatcagccagagatcacattaggcaatttaccaccagactgttatgatattattttcagtgtcctcctgtctgaatatgaccgtctgcttcctctaacaagaacaataaatcagcacctagttcagtactaactaattttctcatgaataaataaataaatatagtcactgtaattagtgacactactagcacggtagcacctggtttagtggttaacaatacttggttcttgcacttctccctgtcgatgttttttcgcgtgggggctagctatcgattgattgattcctcaactatggcatcgaaactggaagaacatatgcatactgggacacacaccctgcttgctttctgaatttctgatttctcctcaaggcagctggcctaccacatatatctgactgagctgtgctgcttcttgccatgagagctaagctaccttagcttagctactactaccacttactacgccgtctgttttggaagggaaaggcagatgtggatgcccaaacctagaaagatggttgtaccactgaaagagagagtttgtggatgtgatctgcactaaagcacccctgtacagggaaaggaccatgtagccctactacaagttcaccatttacacctctgttcctaaggttgggccacacatatatgaagcttttaatgtctcggtttgttggaaagggttttgcattgccattacaagccagcacagtggatacagatagccagggtgctctctattggagaagaaaaaaaatggagccctgaacaccctgattggatctcactattgcatgaaagaatgatgagatttcttgtcttataatttttaaagattttttttctaaagtcagtcttagttacattcatttgttatattccagtttcagacttattggtactaggttctgtgagatctttttttttttttacatcgtttgagtatcatagggtgattcagtaccaccttgacccctgtttttatcagagctctaaacttctaacaccacttctaacttttgagctagtcttctaaccttgctgttttctgaacaaagatgtatactcaagattggtcatagatggagatattctgtgaacagaactaacataatagcaccaaattagtcagacatactctttacaaaattactttggagtttgttgtccactccttgaactagtacaatattgtcctactgaatgccttcctgcctttcaacttgaaagttccctattttatctgttagttcttttataaaatgtaactgcacattgtcagaaggatttgcatcttatttcactttgcgccagttttaagtaatacatggtatattggcataagaccagactctaccattttttatcttgcagagacatagcaaacaactaagtactttttattgtggtgtgctcctttacacagtagcacaacttgtaggatgcttatgtgattgtctcatcaattattctctttatctttaaaaagagaatgatacaaaaaatctctttatctgagaatacacattacccagtggggacagtctttcaatgatttgattacttcgtcagtgtttgcaaactgggaagatcattatgctgctgcatgcagactttataaattaagtgatcttcagagtcagaacaagatgttagctttctatacctatggatccacatccactgtattgtggtccatgtacaagtggggttaaaatatttttctgccgttgacagaacttcagttcaataaatttatctaagatgaagtatccaagcacggaaagagctaattaactgatgaaattcctgtggtcccttgtgttggtatatgagtattctaagagagaatatggagacagtatattaaattattctgagaatacttatcctgacgtttctttagtgagaactgtggtgcatcgttacaaaacttcagatcatgtttcaggagtattttatcatgtaagaattttaaaaagacgtacatcctaggtacagtcatttcttaaggtttcatggtactgaatgattaaattacttcttctggattgggtttcaagcatcatttggctaatttcaatgcagttaaatgatcataagcttttctttcttcaggtttcacttgcttcaggagtttgatgaggccaagcgcagctgtagaaagcgactagatgggcacaaccgtcgccgcaggaagccacagccagatcccatgaactctgcaagttatcttgcaagccaacaaggtattttcttgtttattattaccactctatgatatcgcagttcatataagattaactgggatatagtcattcagacttcctaactattgttagactaggaaaaaaactatgaaacatgctaatagcatagataagtcatggtaaaaaaaaagtaaaagaaaatgaaactgtggttaaaaaaaaacgcaaatattagggaatgacctaatatcaaataattagaaggagtgaggcttcgaacccaggtcgtctagcccatcaccttttgaagctagccagaaaacccctgggcgtttctcagaactgtggttcagctatgactctgttctttcaatcctgacatcttgtaacatgtaatgcattctagtatacatctaatgcattgaaccatatcttatgtactaatttgtgctgatatatcaaacatcgcatcaaaattcaggggcaagattctcaccgttcgcgacgccgagaccggaggcaagctggacagggatgatcaaaaccgaggagagcccatactacacgcaccaccaaatccctcttggcatcagcagcaggcagcagcatttcgttggctccacctctgacggcggccgccgcttccctttcctccaggaaggcgagatcagcttcggcaccggcgccggcgccggcggcgtgccaatggatcaggcagcagctgctgctgctgcttcagtgtgccagccacttctgaagacggtagctcctcctcctcctcctcatggcggcggcggcagcggcggcggcaagatgttctccgatggtgggttgacacaagtgctcgactccgattgtgctctctctcttctgtcagctccggcgaactccacggccatcgacgtcggcggtggccgggtggtcgtccagccgaccgagcacatccccatggcgcagcctctcatctctggccttcagttcggcggcggcggcggcagctcagcctggttcgcggcgcggccgcatcatcaggcggccaccggcgccgccgccaccgccgtcgtcgtctcgacggccggtttctcctgcccggtggtggagagcgagcagctgaacacagtcctgagctccaatgacaatgagatgaactacaatgggatgtttcacgtcggcggcgaaggctcatcggatggcacgtcgtcgtctctgccgttctcatggcagtagttttttcagtaactgtatgttgctgccttagtttcagtagagttggttcttcatttcttttcagtgatcaaattattgtttctgttcttttctgccatggtaagttccttttttttttcttcttcttgccttcatttgagttaattacagcattgatttgtgtgaacaaaattcatcataaatcagttcctcgcgagatcattggtctcaacatgatggtgccaagtgagaactgcagtattgtgcagttttcagttttgagtc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001068869.1 RefSeq:Os08g0531600]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 8]]<br />
[[Category:Chromosome 8]]<br />
Gene Attributes<br />
Chromosome: Chr8<br />
CDS Coordinates (5'-3'): 26501167 - 26506218<br />
Nucleotide length: 1368<br />
Predicted protein length: 456<br />
Predicted molecular weight: 46578.9<br />
Predicted pI: 7.502<br />
<br />
Gene Structure</div>Lizhitao