RiceWiki - User contributions [en]

Os05g0333200

2014-05-13T12:42:26Z

Mingtian0707: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The ''d1'' mutant, which is deficient for the heterotrimeric G-protein α subunit (G α ) gene of rice, shows dwarfi sm and sets small round seeds<ref name="ref1" />. Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components<ref name="ref2" /><ref name="ref3" />. Heterotrimeric G proteins act as signal transducer between a receptor (G-protein-coupled receptors, GPCRs) and downstream effectors. G-protein signaling starts with a conformational change of the GPCR upon ligand perception.The GPCR is a guanine-nucleotide-exchange
factor (GEF) and its activation by the ligand promotes the exchange of GDP for GTP in the associated G α subunit. Subsequently, this complex dissociates into a G α -GTP monomer and a G β γ dimer to regulate downstream effectors. Mammals have multiples of each of the > 20 G α , 5 G β and 11 G γgenes<ref name="ref2" />.
[[File:Plant and cell morphology of d1-5.png|left|thumb|500px|''Plant and cell morphology of d1-5 (from reference <ref name="ref1" />).'']]

===Expression===
The G α protein was expressed in all the organs . Previously, the expression of the Arabidopsis G α(GPA1) was investigated by immunohistochemistry using anti-Arabidopsis G α antibody<ref name="ref4" /> and it was shown that G α is present throughout all development stages and in all organs examined such as roots, fl oral stems, rosette leaves, cauline leaves, fl owers and seed pods, with the exception of mature seeds. The accumulation of G α in Arabidopsis was higher in immature than in mature organs. The fact that the rice and Arabidopsis G α s were accumulated in the developing organs, fitted well the possibility that plant G α s are involved in the regulation of cell proliferation<ref name="ref1" />.
The expression pattern of rice G α suggests that this is also the case in rice. It was shown by immunochemical analysis that in Arabidopsis, G α accumulates highly in the root meristems, the shoot apical meristems and the floral meristems<ref name="ref4" />. The differences in expression in the meristem region between rice and Arabidopsis may refl ect speciesspecifi c expression patterns. The expression of the promoter of the Arabidopsis G α gene (GPA1) has also been investigated using histochemical analysis of transgenic plants expressing the GPA1::GUS reporter gene<ref name="ref5" />.

=== Evolution ===

Studies of proteins that interact with plant G α will also be important for understanding dwarfi sm in d1 . As previously mentioned, many proteins that interact with Arabidopsis G α were isolated, namely three GPCR-type proteins, GCR1,GTG1 and GTG2; one modulator, AtRGS1; four effectors, AtPrin1, AtPLD α 1, PD1 and THF1. It is not known whether rice homologues of these genes interact with rice G α or not<ref name="ref1" />.

== Labs working on this gene ==
1 Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun, Fukui, 910-1195 Japan

2 Bioscience and Biotechnology Center, Nagoya University, Chikusa, Nagoya, 464-8604 Japan

3 Department of Biology, University of North Carolina, Chapel Hill,North Carolina 27599, USA

4 Biology Department, Penn State University, University Park,Pennsylvania 16802-5301, USA

5 Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11724-2212

==References==
<references>
<ref name="ref1"> Izawa Y, Takayanagi Y, Inaba N, et al. Function and expression pattern of the α subunit of the heterotrimeric G protein in rice[J]. Plant and cell physiology, 2010, 51(2): 271-281.</ref>
<ref name="ref2">Offermanns S. Mammalian G-protein function in vivo: new insights through altered gene expression[M]//Reviews of Physiology, Biochemistry and Pharmacology, Volume 140. Springer Berlin Heidelberg, 2000: 63-133.</ref>
<ref name="ref3">Jones A M, Assmann S M. Plants: the latest model system for G‐protein research[J]. EMBO reports, 2004, 5(6): 572-578.</ref>
<ref name="ref4">Weiss C A, Huang H, Ma H. Immunolocalization of the G protein alpha subunit encoded by the GPA1 gene in Arabidopsis[J]. The Plant Cell Online, 1993, 5(11): 1513-1528.</ref>
<ref name="ref5">Huang H, Weiss C A, Ma H. Regulated expression of the Arabidopsis G protein α subunit gene GPA1[J]. International journal of plant sciences, 1994: 3-14.</ref>

Os05g0333200

2014-05-13T12:13:27Z

Mingtian0707: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The ''d1'' mutant, which is deficient for the heterotrimeric G-protein α subunit (G α ) gene of rice, shows dwarfi sm and sets small round seeds<ref name="ref1" />. Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components<ref name="ref2" /><ref name="ref3" />. Heterotrimeric G proteins act as signal transducer between a receptor (G-protein-coupled receptors, GPCRs) and downstream effectors. G-protein signaling starts with a conformational change of the GPCR upon ligand perception.The GPCR is a guanine-nucleotide-exchange
factor (GEF) and its activation by the ligand promotes the exchange of GDP for GTP in the associated G α subunit. Subsequently, this complex dissociates into a G α -GTP monomer and a G β γ dimer to regulate downstream effectors. Mammals have multiples of each of the > 20 G α , 5 G β and 11 G γgenes<ref name="ref2" />.
[[File:Plant and cell morphology of d1-5.png|right|thumb|500px|''Plant and cell morphology of d1-5 (from reference <ref name="ref1" />).'']]

===Expression===
The G α protein was expressed in all the organs . Previously, the expression of the Arabidopsis G α(GPA1) was investigated by immunohistochemistry using anti-Arabidopsis G α antibody<ref name="ref4" /> and it was shown that G α is present throughout all development stages and in all organs examined such as roots, fl oral stems, rosette leaves, cauline leaves, fl owers and seed pods, with the exception of mature seeds. The accumulation of G α in Arabidopsis was higher in immature than in mature organs. The fact that the rice and Arabidopsis G α s were accumulated in the developing organs, fitted well the possibility that plant G α s are involved in the regulation of cell proliferation<ref name="ref1" />.
The expression pattern of rice G α suggests that this is also the case in rice. It was shown by immunochemical analysis that in Arabidopsis, G α accumulates highly in the root meristems, the shoot apical meristems and the floral meristems<ref name="ref4" />. The differences in expression in the meristem region between rice and Arabidopsis may refl ect speciesspecifi c expression patterns. The expression of the promoter of the Arabidopsis G α gene (GPA1) has also been investigated using histochemical analysis of transgenic plants expressing the GPA1::GUS reporter gene<ref name="ref5" />.

=== Evolution ===

Studies of proteins that interact with plant G α will also be important for understanding dwarfi sm in d1 . As previously mentioned, many proteins that interact with Arabidopsis G α were isolated, namely three GPCR-type proteins, GCR1,GTG1 and GTG2; one modulator, AtRGS1; four effectors, AtPrin1, AtPLD α 1, PD1 and THF1. It is not known whether rice homologues of these genes interact with rice G α or not<ref name="ref1" />.

== Labs working on this gene ==
1 Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun, Fukui, 910-1195 Japan

2 Bioscience and Biotechnology Center, Nagoya University, Chikusa, Nagoya, 464-8604 Japan

3 Department of Biology, University of North Carolina, Chapel Hill,North Carolina 27599, USA

4 Biology Department, Penn State University, University Park,Pennsylvania 16802-5301, USA

5 Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11724-2212

==References==
<references>
<ref name="ref1"> Izawa Y, Takayanagi Y, Inaba N, et al. Function and expression pattern of the α subunit of the heterotrimeric G protein in rice[J]. Plant and cell physiology, 2010, 51(2): 271-281.</ref>
<ref name="ref2">Offermanns S. Mammalian G-protein function in vivo: new insights through altered gene expression[M]//Reviews of Physiology, Biochemistry and Pharmacology, Volume 140. Springer Berlin Heidelberg, 2000: 63-133.</ref>
<ref name="ref3">Jones A M, Assmann S M. Plants: the latest model system for G‐protein research[J]. EMBO reports, 2004, 5(6): 572-578.</ref>
<ref name="ref4">Weiss C A, Huang H, Ma H. Immunolocalization of the G protein alpha subunit encoded by the GPA1 gene in Arabidopsis[J]. The Plant Cell Online, 1993, 5(11): 1513-1528.</ref>
<ref name="ref5">Huang H, Weiss C A, Ma H. Regulated expression of the Arabidopsis G protein α subunit gene GPA1[J]. International journal of plant sciences, 1994: 3-14.</ref>

File:Plant and cell morphology of d1-5.png

2014-05-13T12:11:17Z

Mingtian0707: Undo revision 168564 by Mingtian0707 (talk)

(A and B) Aerial parts of 1-month-old WT (A) and d1-5 (B) (bars = 10 cm). LB, leaf blade; LS, leaf sheath.
(C and D) Panicle and internode of WT (C) and d1-5 (D) (bars = 10 cm). PA, panicle; BRI, basal rachis internode; IN, internode. I, II and III are fi rst,
second and third internodes, respectively. (E and F) Lemma and palea of WT (E) and d1-5 (F). LM, lemma; PL, palea (bars = 1 mm). (G and H) Root
of 1-month-old WT (G) and d1-5 (H) (bars = 10 cm). (I and J) Longitudinal sections of the fourth leaf sheath from WT (I) and d1-5 (J) (bars = 100 μm).
(K and L) Longitudinal sections of the third internode from WT (K) and d1-5 (L) (bars = 1 mm). (M and N) Inner epidermal cells of lemma from
WT (M) and d1-5 (N) observed by SEM (bars = 100 μm). (O and P) Longitudinal sections of the crown root from WT (O) and d1-5 (P)
(bars = 100 μm).

File:Plant and cell morphology of d1-5.png

2014-05-13T12:10:24Z

Mingtian0707:

Os05g0333200

2014-05-13T12:07:52Z

Mingtian0707: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The ''d1'' mutant, which is deficient for the heterotrimeric G-protein α subunit (G α ) gene of rice, shows dwarfi sm and sets small round seeds<ref name="ref1" />. Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components<ref name="ref2" /><ref name="ref3" />. Heterotrimeric G proteins act as signal transducer between a receptor (G-protein-coupled receptors, GPCRs) and downstream effectors. G-protein signaling starts with a conformational change of the GPCR upon ligand perception.The GPCR is a guanine-nucleotide-exchange
factor (GEF) and its activation by the ligand promotes the exchange of GDP for GTP in the associated G α subunit. Subsequently, this complex dissociates into a G α -GTP monomer and a G β γ dimer to regulate downstream effectors. Mammals have multiples of each of the > 20 G α , 5 G β and 11 G γgenes<ref name="ref2" />.
[[File:Plant and cell morphology of d1-5.PNG|right|thumb|500px|''Plant and cell morphology of d1-5 (from reference <ref name="ref1" />).'']]

===Expression===
The G α protein was expressed in all the organs . Previously, the expression of the Arabidopsis G α(GPA1) was investigated by immunohistochemistry using anti-Arabidopsis G α antibody<ref name="ref4" /> and it was shown that G α is present throughout all development stages and in all organs examined such as roots, fl oral stems, rosette leaves, cauline leaves, fl owers and seed pods, with the exception of mature seeds. The accumulation of G α in Arabidopsis was higher in immature than in mature organs. The fact that the rice and Arabidopsis G α s were accumulated in the developing organs, fitted well the possibility that plant G α s are involved in the regulation of cell proliferation<ref name="ref1" />.
The expression pattern of rice G α suggests that this is also the case in rice. It was shown by immunochemical analysis that in Arabidopsis, G α accumulates highly in the root meristems, the shoot apical meristems and the floral meristems<ref name="ref4" />. The differences in expression in the meristem region between rice and Arabidopsis may refl ect speciesspecifi c expression patterns. The expression of the promoter of the Arabidopsis G α gene (GPA1) has also been investigated using histochemical analysis of transgenic plants expressing the GPA1::GUS reporter gene<ref name="ref5" />.

=== Evolution ===

Studies of proteins that interact with plant G α will also be important for understanding dwarfi sm in d1 . As previously mentioned, many proteins that interact with Arabidopsis G α were isolated, namely three GPCR-type proteins, GCR1,GTG1 and GTG2; one modulator, AtRGS1; four effectors, AtPrin1, AtPLD α 1, PD1 and THF1. It is not known whether rice homologues of these genes interact with rice G α or not<ref name="ref1" />.

== Labs working on this gene ==
1 Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun, Fukui, 910-1195 Japan

2 Bioscience and Biotechnology Center, Nagoya University, Chikusa, Nagoya, 464-8604 Japan

3 Department of Biology, University of North Carolina, Chapel Hill,North Carolina 27599, USA

4 Biology Department, Penn State University, University Park,Pennsylvania 16802-5301, USA

5 Cold Spring Harbor Laboratory, Cold Spring Harbor, New York 11724-2212

==References==
<references>
<ref name="ref1"> Izawa Y, Takayanagi Y, Inaba N, et al. Function and expression pattern of the α subunit of the heterotrimeric G protein in rice[J]. Plant and cell physiology, 2010, 51(2): 271-281.</ref>
<ref name="ref2">Offermanns S. Mammalian G-protein function in vivo: new insights through altered gene expression[M]//Reviews of Physiology, Biochemistry and Pharmacology, Volume 140. Springer Berlin Heidelberg, 2000: 63-133.</ref>
<ref name="ref3">Jones A M, Assmann S M. Plants: the latest model system for G‐protein research[J]. EMBO reports, 2004, 5(6): 572-578.</ref>
<ref name="ref4">Weiss C A, Huang H, Ma H. Immunolocalization of the G protein alpha subunit encoded by the GPA1 gene in Arabidopsis[J]. The Plant Cell Online, 1993, 5(11): 1513-1528.</ref>
<ref name="ref5">Huang H, Weiss C A, Ma H. Regulated expression of the Arabidopsis G protein α subunit gene GPA1[J]. International journal of plant sciences, 1994: 3-14.</ref>

2014-05-07T15:58:36Z

Mingtian0707: /* Evolution */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The d1 mutant, which is defi cient for the heterotrimeric G-protein α subunit (G α ) gene of rice, shows dwarfi sm and sets small round seeds. To determine whether dwarfi sm in d1 is due to a reduction in cell number or to shortened cell length, the cell number of the leaf sheath, the internode, the root and the lemma was compared between Nipponbare, a wild-type rice and d1-5 , a d1 allele derived from Nipponbare.

===Expression===
Please input expression information here.
Heterotrimeric G proteins, which are composed of α (G α ),β (G β ) and γ (G γ ) subunits, play a variety of roles in a wide range of physiological responses by transducing extracellular information to intracellular components

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.
In the
shoot hypocotyl, the maximum cell length in gpa1 was not different
from that in WT while the cell number was signifi cantly
reduced. Our results support the idea that G α s regulate cell
proliferation.

==Labs working on this gene==
Please input related labs here.
1 Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun, Fukui, 910-1195 Japan
2 Bioscience and Biotechnology Center, Nagoya University, Chikusa, Nagoya, 464-8604 Japan

==References==
Please input cited references here.
1. Yuki Izawa;Yoshiyuki Takayanagi;Noriko Inaba;Yuki Abe;Miho Minami;Yukiko Fujisawa;Hisaharu Kato;Shizuka Ohki;Hidemi Kitano;Yukimoto Iwasaki
Function and Expression Pattern of the α Subunit of the Heterotrimeric G Protein in Rice
Plant and Cell Physiology, 2010, 51(2): 271-281
2. Kotaro Miura;Masakazu Agetsuma;Hidemi Kitano;Atsushi Yoshimura;Makoto Matsuoka;Steven E. Jacobsen;Motoyuki Ashikari
A metastable DWARF1 epigenetic mutant affecting plant stature in rice
Proceedings of the National Academy of Sciences, 2009, 106(27): 11218-11223
3. Lei Wang;Yun-Yuan Xu;Qi-Bin Ma;Dan Li;Zhi-Hong Xu;Kang Chong
Heterotrimeric G protein α subunit is involved in rice brassinosteroid response
Cell Research, 2006, 16(12): 916-922
4. Miyako Ueguchi-Tanaka;Yukiko Fujisawa;Masatomo Kobayashi;Motoyuki Ashikari;Yukimoto Iwasaki;Hidemi Kitano;Makoto Matsuoka
Rice dwarf mutant d1, which is defective in the α subunit of the heterotrimeric G protein, affects gibberellin signal transduction
Proceedings of the National Academy of Sciences, 2000, 97(21): 11638-11643
5. Motoyuki Ashikari;Jianzhong Wu;Masahiro Yano;Takuji Sasaki;and Atsushi Yoshimura
Rice gibberellin-insensitive dwarf mutant gene Dwarf 1 encodes the α-subunit of GTP-binding protein
Proceedings of the National Academy of Sciences, 1999, 96(18): 10284-10289
6. Yukiko Fujisawa;Teruhisa Kato;Shizuka Ohki;Atsushi Ishikawa;Hidemi Kitano;Takuji Sasaki;Tadashi Asahi;and Yukimoto Iwasaki
Suppression of the heterotrimeric G protein causes abnormal morphology, including dwarfism, in rice
Proceedings of the National Academy of Sciences, 1999, 96(13): 7575-7580
7. Atsushi Ishikawa;Hitoshi Tsubouchi;Yukimoto Iwasaki;Tadashi Asahi
Molecular Cloning and Characterization of a cDNA for the α Subunit of a G Protein from Rice
Plant and Cell Physiology, 1995, 36(2): 353-359

==Structured Information==
{{JaponicaGene|
GeneName = Os05g0333200|
Description = Guanine nucleotide-binding protein alpha-1 subunit (GP-alpha-1)|
Version = NM_001061761.1 GI:115463252 GeneID:4338448|
Length = 4020 bp|
Definition = Oryza sativa Japonica Group Os05g0333200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|
AP = Chromosome 5:15587381..15591400|
CDS = 15587656..15587821,15587986..15588065,15588143..15588202,15588289..15588382,15588459..15588593 ,15588773..15588828,15589531..15589632,15589716..15589823,15590378..15590455 ,15590604..15590693,15590775..15590812,15591062..15591134,15591233..15591325 |
GCID = <gbrowseImage1>
name=NC_008398:15587381..15591400
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008398:15587381..15591400
source=RiceChromosome05
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtccgtgcttacctgtgtgcttgataacatgggctcatcctgtagcagatctcattctttaagtgaggctgaaacaaccaaaaatgcaaaatctgcagacattgacaggcgaattttgcaagagacaaaagcagagcaacacatccacaagctcttacttcttggtgcgggagaatcagggaagtctacgatatttaaacagattaagctccttttccaaactggctttgatgaggcagaacttaggagctacacatcagttatccatgcaaacgtctatcagacaattaaaatactatatgaaggagcaaaagaactctcacaagtggaatcagattcctcaaagtatgttatatccccagataaccaggaaattggagaaaaactatcagatattgatggcaggttggattatccactgctgaacaaagaacttgtactcgatgtaaaaaggttatggcaagacccagccattcaggaaacttacttacgtggaagtattctgcaacttcctgattgtgcacaatacttcatggaaaatttggatcgattagctgaagcaggttatgtgccaacaaaggaggatgtgctttatgcaagagtacggacaaatggtgttgtacaaatacaatttagtcctgttggagaaaacaaaagaggtggagaggtatataggttgtatgatgtaggaggccagaggaatgagaggagaaagtggattcatctttttgaaggtgttaatgcggtaatcttttgtgctgccattagcgaatatgatcagatgctatttgaagatgagacaaaaaacagaatgatggagaccaaggaactctttgactgggttttaaagcaaagatgttttgagaaaacatcattcattctgtttctcaacaaatttgatatattcgagaagaaaatacaaaaggttcctttaagtgtgtgcgagtggtttaaagactaccagcctattgcacctgggaaacaggaggttgaacatgcatatgagtttgtcaagaagaagtttgaagagctctacttccagagcagcaagcctgaccgtgtggaccgcgtcttcaaaatctacagaactacggccctagaccagaaacttgtaaagaagacattcaagttgattgatgagagcatgagacgctccagggaaggaacttga</cdnaseq>|
AA = <aaseq>MSVLTCVLDNMGSSCSRSHSLSEAETTKNAKSADIDRRILQETK AEQHIHKLLLLGAGESGKSTIFKQIKLLFQTGFDEAELRSYTSVIHANVYQTIKILYE GAKELSQVESDSSKYVISPDNQEIGEKLSDIDGRLDYPLLNKELVLDVKRLWQDPAIQ ETYLRGSILQLPDCAQYFMENLDRLAEAGYVPTKEDVLYARVRTNGVVQIQFSPVGEN KRGGEVYRLYDVGGQRNERRKWIHLFEGVNAVIFCAAISEYDQMLFEDETKNRMMETK ELFDWVLKQRCFEKTSFILFLNKFDIFEKKIQKVPLSVCEWFKDYQPIAPGKQEVEHA YEFVKKKFEELYFQSSKPDRVDRVFKIYRTTALDQKLVKKTFKLIDESMRRSREGT</aaseq>|
DNA = <dnaseqindica>3580..3745#3336..3415#3199..3258#3019..3112#2808..2942#2573..2628#1769..1870#1578..1685#946..1023#708..797#589..626#267..339#76..168#ggatcctgagatctagacgtcaacgtgcttcctggaaagagagaggctcaggcatgagagcatacctctaaaataatgtccgtgcttacctgtgtgcttgataacatgggctcatcctgtagcagatctcattctttaagtgaggctgaaacaaccaaaaatgcaaaagtaagttagcactcggacttattgaacaagtaaatgctaactcaattcttgatttgagagttgccacatttggtttcttctaattcagctggtaacagtctgcagacattgacaggcgaattttgcaagagacaaaagcagagcaacacatccacaagctcttacttcttggtattgctaactttcccaaatttaagtggtcattttccttgtcacaattatctgtgctacctttagtatctattggttcagaaaattaattgtttatgttgttcctatttacctctataaaaaaacctttctcatgttatttccaaaaaaaaagaagataaataaatgtatcctagaaatttttagtttgaacttgttctcaatgtggatccatccttctttctctctctcaattgcttctgttttaaggtgcgggagaatcagggaagtctacgatatttaaacaggtgatgaatgttatattccatggagaatcataatccgtacgccgctagttagtctgatgtattcttactgttcacctgcagattaagctccttttccaaactggctttgatgaggcagaacttaggagctacacatcagttatccatgcaaacgtctatcagacaattaaagtatgcaatactggaaagggtgtgtcttttttttcttattgcaaagtggggattatgtaggagattcgactagggatttgtattctgttcataaggaaatgcgttcatacttttcctttttgtcgagtaatgtgttaaatgttaacagatactatatgaaggagcaaaagaactctcacaagtggaatcagattcctcaaagtatgttatatccccagataaccaggtttgtgcttactctttactcaacagttaaagctaaatctgtgcatatgaacatgtcttgttaaatctgggaatacaaacattttgatttgcaacatttctgttgtagtcaagctgctcggctctatgttttaacctgttaagaccttgtagactgtgctcggctctattgtagtcttatattttacacggtcattctataatgaaaacttgaaaaagatatctattgaaccgtacaatgtactgaacaaagtagaaaagaacaatgagattttgtaacatttattcttccttgtttatttgattgcttcagacaattgttgatatgctaaaaataacttggtatcaaatgtgggtgttataagattcaatttttttctcaaccaggttaaaaaaagtatacctttgtgcatttaccttgttccgttgctttggaactttaaaggaaaactgacttttcttaggcattgaaagacaaatatcaccagtttcacactgtacaccttaccaaccaattttgtttcttagatgtcatttactttgtcatatcatcaggaaattggagaaaaactatcagatattgatggcaggttggattatccactgctgaacaaagaacttgtactcgatgtaaaaaggttatggcaagacccagccattcaggtgaaaacaaatagccattcaaatcttttgaagttatatagttttcctggccaggtgtgctgaagcaatgctctatactgtaggaaacttacttacgtggaagtattctgcaacttcctgattgtgcacaatacttcatggaaaatttggatcgattagctgaagcaggttatgtgccaacaaaggtgtgctgtccatgttcatagacaattatttacatattctcagatatttgtgctgacaccatttcatgttgatttttagtctacttagtcagaggttgtcaaatggttaactatgtgtactgagtcagaggttgccaaatagttttaaaagatgggcatatgtttatccttatcttttaaataatattggaggctatcctttaaaattcaatattagggaggagaaactattattctaccgttattacgcagtctacataacgaaggtaaaaaatgtccctgtgaaacatagggtgcaaaactgctgtgaataaaactctacttatctaagcaccttgagcttttgagttcccacatattaatcttatgacactagcatatattttttttgttcagttccttcaataagttgcaaaccacaaatatgatcactgtaccatccacttttgcaaccatttcccgtcatttcttaagcatagaaaattgtttgtcacttgtttaagtccacactgcatcaaaattccaattaacattgtgtgtgctaagtgaagatatgactccatatttctgcatttagcagtctgatggataatttgtgattgtaccttgtctaatggttcgtttgaaaggctggtagttgatcttccatacttaagaatgcttgcagtattatagttgtcaatattatgagtcattttgcaggaggatgtgctttatgcaagagtacggacaaatggtgttgtacaaatacaatttaggtaatctgctgacactattttttgcacatttttttgctggttgctctactatgtacagaacgacaagttgaagtcctttttttctcccctttcacttctaagatatgacctgagaggttctgaatgtagctgttttaagatgagttgaatcatctagttaactgggtttctttctgcagtcctgttggagaaaacaaaagaggtggagaggtatataggttgtatgatgtaggaggccagaggaatgagaggagaaagtggattcatctttttgaaggtgttaatgcggtaatcttttgtgctgccattagcgagtaagtacaatttttttgattgttgaacttatcctaatctgctaagttcttctcataggcttcttgttcatttcagatatgatcagatgctatttgaagatgagacaaaaaacagaatgatggagaccaaggaactctttgactgggttttaaagcaaagatgttttgaggtctgcatgcatccatctctgcaacctttgtgctcatgctttttttctcattttgaaactaattacggtgctatattgaccatcagaaaacatcattcattctgtttctcaacaaatttgatatattcgagaagaaaatacaaaaggtaaggcctgctctttgtaccaatgcatagtttagtactaaatgttaccaacatttatgtttacgctggttacgtaggttcctttaagtgtgtgcgagtggtttaaagactaccagcctattgcacctgggaaacaggaggttgaacatgcatatgagtgagtgcactactcgccctctcagatgaacatgggcatttggccatttgtaatgttgctgcatggtgcacttatatgccttgataagtttttccattctaatgttatatagtatcaaacgttcatcattactgtggcttatggtctggagtgacgttttacaggtttgtcaagaagaagtttgaagagctctacttccagagcagcaagcctgaccgtgtggaccgcgtcttcaaaatctacagaactacggccctagaccagaaacttgtaaagaagacattcaagttgattgatgagagcatgagacgctccagggaaggaacttgattcagagctaagactaggttgtaagtcacacagggaaggtaattaggacggcgagaggaacaaagtttcacactgtcacagctttatctgttgtaattcttttacacgtggaccattgattgatcttttggttcttactgtgggctgttcaggtctgtaccctattttttgttctctagttagccattgtgcaaattttccttgaatcagattctctacctgttgtctatgtgtgttatcttggtctgttaatttgcatagcccacttgttcatt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001061761.1 RefSeq:Os05g0333200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]