RiceWiki - User contributions [en]

Os01g0822900

2014-05-25T08:50:22Z

Mmma: /* Wide Type VS Mutant */

Please input one-sentence summary here.

==Annotated Information==
===Function===

*A rice'' Dwarf 1'' gene was identified by using a map-based cloning strategy. Its recessive mutant allele'' photoperiod-sensitive dwarf 1(Psd)'' confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. ''Dwarf'' mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. ''Dwarf'' mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the ''Dwarf(D1)'' gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice ''d1'' mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File: Genomic structure of the Psd1 locus.jpg|right|thumb|500px|''Genomic structure of the Psd1 locus.jpg (from reference <ref name="ref1" />).'']]

===Expression===

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals.

[[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg‎|right|thumb|500px|'''Figure 2.'''
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]''

===Wide Type VS Mutant===

*we observed that the plant height of ''Psd1'' mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the ''Psd1'' phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, ''Psd1'' is a novel photoperiod-sensitive dwarf mutant.(Fig.3)

*There is a big difference with the length of the third-leaf sheath between ''Psd1'' and ''ZH11'' plants.(Table.1)

*Average cell number and size are of obvious difference. Transverse sections of elongated internodes of ''Psd1'' and ''ZH11'' showed that the structure of parenchyma cells and vascular bundles of ''Psd1'' was different from ''ZH11'', the average number of cells and the cell size of the internodes were also different. All together, cell division and elongation were impaired in the ''Psd1'' mutant.

[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|right|thumb|500px|'''Figure 3.'''
''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.(from reference <ref name="ref1"/>).'']]''

[[File:Table1.jpg‎|right|thumb|500px|'''Table1.'''
''Length of the third-leaf sheath of ''Psd1'' and ''ZH11'' plants grown in dark and under light.'']]''

[[File:Fig5_Cell_numbers_and_length.jpg‎|right|thumb|500px|'''Fig5.'''
''Transverse sections of elongated internodes.'']]''

===Responses to GA and BR===

''Psd1''mutant respond to exogenous bioactive GA to a similar degree as wild-type rice, but exogenous GA could not rescue the dwarf phenotype. Also, the dwarf phenotype could not be rescued by exogenous BR.(Fig.4)
Moreover, the sheaths of ''Psd1'' seedings could elongate to the similar length as ''ZH11'' under complete darkness, a phenotype different from that of BR-related mutants, in which sheaths could not elongate in the dark. These characterization suggest that Psd1 may not be deficient in the bio synthesis and perception of GA or BR.

[[File:FigQWE.jpg‎|left|thumb|500px|'''Fig4.'''
''Length trend after the treatment with GA and BR .'']]''

==Labs working on this gene==
*Identification and characterization of the ''Psd1'' mutant
*responses of ''Psd1'' mutant to GA and BR
*Photoperiod sensitivity tests
*Linkage analysis and gene mapping
*RNA isolation and quantitative RT-PCR analysis
*Expression analysis of flowering-related genes in the mutant.

==References==
<references>
<ref name="ref1">
Riqing Li, Jixing Xia, Yiwei Xu, Xiucai Zhao, Yao-Guang Liu, Yuanling Chen. Characterization and genetic mapping of a ''Photoperiod-sensitive dwarf1'' locus in rice(Oryza sativa L.)[J] Theor Appl Genet, 2014, 127: 241-250.</ref>
<ref name="ref2">
Mits unagas, Tashiro T, Yamaguti J. Rice gibberellin-insensitive dwarf mutant gene ''Dwarf 1'' encodes the α-subunit of GTP-binding protein.[J] PNAS, 1999, 96: 10284-10289.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:Fig5 Cell numbers and length.jpg

2014-05-25T08:48:17Z

Mmma:

Os01g0822900

2014-05-25T08:32:21Z

Mmma: /* Wide Type VS Mutant */

Please input one-sentence summary here.

==Annotated Information==
===Function===

*A rice'' Dwarf 1'' gene was identified by using a map-based cloning strategy. Its recessive mutant allele'' photoperiod-sensitive dwarf 1(Psd)'' confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. ''Dwarf'' mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. ''Dwarf'' mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the ''Dwarf(D1)'' gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice ''d1'' mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File: Genomic structure of the Psd1 locus.jpg|right|thumb|500px|''Genomic structure of the Psd1 locus.jpg (from reference <ref name="ref1" />).'']]

===Expression===

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals.

[[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg‎|right|thumb|500px|'''Figure 2.'''
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]''

===Wide Type VS Mutant===

*we observed that the plant height of ''Psd1'' mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the ''Psd1'' phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, ''Psd1'' is a novel photoperiod-sensitive dwarf mutant.(Fig.3)

*There is a big difference with the length of the third-leaf sheath between ''Psd1'' and ''ZH11'' plants.(Table.1)

*Average cell number and size are of obvious difference. Transverse sections of elongated internodes of ''Psd1'' and ''ZH11'' showed that the structure of parenchyma cells and vascular bundles of ''Psd1'' was different from ''ZH11'', the average number of cells and the cell size of the internodes were also different. All together, cell division and elongation were impaired in the ''Psd1'' mutant.

[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|right|thumb|500px|'''Figure 3.'''
''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.(from reference <ref name="ref1"/>).'']]''

[[File:Table1.jpg‎|right|thumb|500px|'''Table1.'''
''Length of the third-leaf sheath of ''Psd1'' and ''ZH11'' plants grown in dark and under light.'']]''

===Responses to GA and BR===

''Psd1''mutant respond to exogenous bioactive GA to a similar degree as wild-type rice, but exogenous GA could not rescue the dwarf phenotype. Also, the dwarf phenotype could not be rescued by exogenous BR.(Fig.4)
Moreover, the sheaths of ''Psd1'' seedings could elongate to the similar length as ''ZH11'' under complete darkness, a phenotype different from that of BR-related mutants, in which sheaths could not elongate in the dark. These characterization suggest that Psd1 may not be deficient in the bio synthesis and perception of GA or BR.

[[File:FigQWE.jpg‎|left|thumb|500px|'''Fig4.'''
''Length trend after the treatment with GA and BR .'']]''

==Labs working on this gene==
*Identification and characterization of the ''Psd1'' mutant
*responses of ''Psd1'' mutant to GA and BR
*Photoperiod sensitivity tests
*Linkage analysis and gene mapping
*RNA isolation and quantitative RT-PCR analysis
*Expression analysis of flowering-related genes in the mutant.

==References==
<references>
<ref name="ref1">
Riqing Li, Jixing Xia, Yiwei Xu, Xiucai Zhao, Yao-Guang Liu, Yuanling Chen. Characterization and genetic mapping of a ''Photoperiod-sensitive dwarf1'' locus in rice(Oryza sativa L.)[J] Theor Appl Genet, 2014, 127: 241-250.</ref>
<ref name="ref2">
Mits unagas, Tashiro T, Yamaguti J. Rice gibberellin-insensitive dwarf mutant gene ''Dwarf 1'' encodes the α-subunit of GTP-binding protein.[J] PNAS, 1999, 96: 10284-10289.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:Fig.5 Cell numbers and length .jpg

2014-05-25T08:21:23Z

Mmma:

File:FigQWE.jpg

2014-05-25T08:18:25Z

Mmma:

Os01g0822900

2014-05-25T08:17:38Z

Mmma: /* Responses to GA and BR */

Please input one-sentence summary here.

==Annotated Information==
===Function===

*A rice'' Dwarf 1'' gene was identified by using a map-based cloning strategy. Its recessive mutant allele'' photoperiod-sensitive dwarf 1(Psd)'' confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. ''Dwarf'' mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. ''Dwarf'' mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the ''Dwarf(D1)'' gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice ''d1'' mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File: Genomic structure of the Psd1 locus.jpg|right|thumb|500px|''Genomic structure of the Psd1 locus.jpg (from reference <ref name="ref1" />).'']]

===Expression===

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals.

[[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg‎|right|thumb|500px|'''Figure 2.'''
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]''

===Wide Type VS Mutant===

*we observed that the plant height of ''Psd1'' mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the ''Psd1'' phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, ''Psd1'' is a novel photoperiod-sensitive dwarf mutant.(Fig.3)

*There is a big difference with the length of the third-leaf sheath between ''Psd1'' and ''ZH11'' plants.(Table.1)

[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|right|thumb|500px|'''Figure 3.'''
''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.(from reference <ref name="ref1"/>).'']]''

[[File:Table1.jpg‎|right|thumb|500px|'''Table1.'''
''Length of the third-leaf sheath of ''Psd1'' and ''ZH11'' plants grown in dark and under light.'']]''

===Responses to GA and BR===

''Psd1''mutant respond to exogenous bioactive GA to a similar degree as wild-type rice, but exogenous GA could not rescue the dwarf phenotype. Also, the dwarf phenotype could not be rescued by exogenous BR.(Fig.4)
Moreover, the sheaths of ''Psd1'' seedings could elongate to the similar length as ''ZH11'' under complete darkness, a phenotype different from that of BR-related mutants, in which sheaths could not elongate in the dark. These characterization suggest that Psd1 may not be deficient in the bio synthesis and perception of GA or BR.

[[File:FigQWE.jpg‎|left|thumb|500px|'''Fig4.'''
''Length trend after the treatment with GA and BR .'']]''

==Labs working on this gene==
*Identification and characterization of the ''Psd1'' mutant
*responses of ''Psd1'' mutant to GA and BR
*Photoperiod sensitivity tests
*Linkage analysis and gene mapping
*RNA isolation and quantitative RT-PCR analysis
*Expression analysis of flowering-related genes in the mutant.

==References==
<references>
<ref name="ref1">
Riqing Li, Jixing Xia, Yiwei Xu, Xiucai Zhao, Yao-Guang Liu, Yuanling Chen. Characterization and genetic mapping of a ''Photoperiod-sensitive dwarf1'' locus in rice(Oryza sativa L.)[J] Theor Appl Genet, 2014, 127: 241-250.</ref>
<ref name="ref2">
Mits unagas, Tashiro T, Yamaguti J. Rice gibberellin-insensitive dwarf mutant gene ''Dwarf 1'' encodes the α-subunit of GTP-binding protein.[J] PNAS, 1999, 96: 10284-10289.</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

2014-05-25T06:57:33Z

Mmma:

Os01g0822900

2014-05-25T06:43:46Z

Mmma: /* Wide Type VS Mutant */

Please input one-sentence summary here.

==Annotated Information==
===Function===

*A rice'' Dwarf 1'' gene was identified by using a map-based cloning strategy. Its recessive mutant allele'' photoperiod-sensitive dwarf 1(Psd)'' confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. ''Dwarf'' mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. ''Dwarf'' mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the ''Dwarf(D1)'' gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice ''d1'' mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File: Genomic structure of the Psd1 locus.jpg|right|thumb|500px|''Genomic structure of the Psd1 locus.jpg (from reference <ref name="ref1" />).'']]

===Expression===

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals.

[[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg‎|right|thumb|500px|'''Figure 2.'''
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]''

===Wide Type VS Mutant===

we observed that the plant height of ''Psd1'' mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the ''Psd1'' phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, ''Psd1'' is a novel photoperiod-sensitive dwarf mutant.(Fig.3)

[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|left|thumb|500px|'''Figure 3.'''
''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.(from reference <ref name="ref1"/>).'']]''

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">XXX</ref>
<ref name="ref2">XXX</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0822900

2014-05-25T06:41:12Z

Mmma: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===

*A rice'' Dwarf 1'' gene was identified by using a map-based cloning strategy. Its recessive mutant allele'' photoperiod-sensitive dwarf 1(Psd)'' confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. ''Dwarf'' mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. ''Dwarf'' mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the ''Dwarf(D1)'' gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice ''d1'' mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File: Genomic structure of the Psd1 locus.jpg|right|thumb|500px|''Genomic structure of the Psd1 locus.jpg (from reference <ref name="ref1" />).'']]

===Expression===

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals.

[[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg‎|right|thumb|500px|'''Figure 2.'''
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]''

===Wide Type VS Mutant===

we observed that the plant height of ''Psd1'' mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the ''Psd1'' phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, ''Psd1'' is a novel photoperiod-sensitive dwarf mutant.(Fig.3)

[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|left|thumb|500px|'''Figure 3.'''
''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.(from reference <ref name="ref1"/>).'']]'']]

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">XXX</ref>
<ref name="ref2">XXX</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0822900

2014-05-25T06:40:40Z

Mmma: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===

*A rice'' Dwarf 1'' gene was identified by using a map-based cloning strategy. Its recessive mutant allele'' photoperiod-sensitive dwarf 1(Psd)'' confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. ''Dwarf'' mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. ''Dwarf'' mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the ''Dwarf(D1)'' gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice ''d1'' mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File: Genomic structure of the Psd1 locus.jpg|right|thumb|500px|''Genomic structure of the Psd1 locus.jpg (from reference <ref name="ref1" />).'']]

===Expression===

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals.

[[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg‎|left|thumb|500px|'''Figure 2.'''
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]''

===Wide Type VS Mutant===

we observed that the plant height of ''Psd1'' mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the ''Psd1'' phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, ''Psd1'' is a novel photoperiod-sensitive dwarf mutant.(Fig.3)

[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|left|thumb|500px|'''Figure 3.'''
''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.(from reference <ref name="ref1"/>).'']]'']]

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">XXX</ref>
<ref name="ref2">XXX</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0822900

2014-05-25T06:39:22Z

Mmma: /* Wide Type VS Mutant */

Please input one-sentence summary here.

==Annotated Information==
===Function===

*A rice'' Dwarf 1'' gene was identified by using a map-based cloning strategy. Its recessive mutant allele'' photoperiod-sensitive dwarf 1(Psd)'' confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. ''Dwarf'' mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. ''Dwarf'' mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the ''Dwarf(D1)'' gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice ''d1'' mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File: Genomic structure of the Psd1 locus.jpg|right|thumb|500px|''Genomic structure of the Psd1 locus.jpg (from reference <ref name="ref1" />).'']]

===Expression===

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals.

[[File:Expression_analyses_of_five_flowering-related_genes_of_the_''Psd1''_and_''ZH11''_plants_harvested_at_12-00.jpg‎|left|thumb|500px|'''Figure 2.'''
''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]'']]

===Wide Type VS Mutant===

we observed that the plant height of ''Psd1'' mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the ''Psd1'' phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, ''Psd1'' is a novel photoperiod-sensitive dwarf mutant.(Fig.3)

[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎|left|thumb|500px|'''Figure 3.'''
''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.(from reference <ref name="ref1"/>).'']]'']]

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">XXX</ref>
<ref name="ref2">XXX</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0822900

2014-05-25T06:29:51Z

Mmma: /* Expression */

Os01g0822900

2014-05-25T06:28:08Z

Mmma: /* Expression */

Os01g0822900

2014-05-25T06:26:04Z

Mmma: /* Expression */

2014-05-25T06:04:36Z

Mmma:

File:Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12-00.jpg

2014-05-25T06:01:53Z

Mmma:

Os01g0822900

2014-05-25T05:57:22Z

Mmma: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
*A rice Dwarf 1 gene was identified by using a map-based cloning strategy. Its recessive mutant allele photoperiod-sensitive dwarf 1(Psd) confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. Dwarf mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. Dwarf mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the Dwarf 1 (D1) gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice d1 mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File:Genomic structure of the Psd1 locus.jpg]]
Fig1. Genomic structure of the Psd1 locus[1].

===Expression===
Please input expression information here.
[[File: Expression Pattern.jpg|right|thumb|500px|'''Figure 2.''' ''Expression analyses of five flowering-related genes of the ''Psd1'' and ''ZH11'' plants harvested at 12:00(from reference <ref name="ref1"/>).'']]'']]
[[File: Phenotypic character.jpg|right|thumb|500px|'''Figure 3.''' ''Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day(from reference <ref name="ref1"/>).'']]'']]

*It is expressed in elongating stem, vegetative sheath and young inflorescence.

'''(1)'''Expression analysis of flowering-related genes, ''Hd3a'', ''RFT1'', ''Ehd1'', ''Ghd7''and ''DTH8'' in the'' Psd1'' mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so ''Psd1'' mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

'''(2)'''''Psd1''-related genetic network is regulated by day-length dependent signals. (Fig.3)

===Wide Type VS Mutant===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">XXX</ref>
<ref name="ref2">XXX</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:2.jpg

2014-05-25T05:55:33Z

Mmma: uploaded a new version of "File:2.jpg"

Gross morphology of wildtype (left) and gid1-1 (right) plants. Scale bar, 10 cm. Inset: higher magnification of gid1-1. Scale bar, 1 cm

Os01g0822900

2014-05-25T05:22:36Z

Mmma: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
*A rice Dwarf 1 gene was identified by using a map-based cloning strategy. Its recessive mutant allele photoperiod-sensitive dwarf 1(Psd) confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.<ref name="ref1" />

*Plant height is an important agronomic trait for crop architecture and yield. Dwarf mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. Dwarf mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the Dwarf 1 (D1) gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice d1 mutant was classified as gibberellin-insensitive,<ref name="ref2" /> though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

[[File:Genomic structure of the Psd1 locus.jpg]]
Fig1. Genomic structure of the Psd1 locus[1].

===Expression===
Please input expression information here.

===Wide Type VS Mutant===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">XXX</ref>
<ref name="ref2">XXX</ref>
</references>

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

File:Genomic structure of the Psd1 locus.jpg

2014-05-25T03:19:54Z

Mmma:

2014-05-24T14:38:03Z

Mmma: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
A rice Dwarf 1 gene was identified by using a map-based cloning strategy. Its recessive mutant allele photoperiod-sensitive dwarf 1(Psd) confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.

Plant height is an important agronomic trait for crop architecture and yield. Dwarf mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. Dwarf mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the Dwarf 1 (D1) gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice d1 mutant was classified as gibberellin-insensitive, though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os01g0822900|
Description = Similar to Lipid transfer protein|
Version = NM_001051189.1 GI:115440748 GeneID:4327617|
Length = 901 bp|
Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:36885860..36886760|
CDS = 36886214..36886223,36886310..36886662|
GCID = <gbrowseImage1>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:36885860..36886760
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>|
AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>|
DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]