<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Qingxiangmu</id>
		<title>RiceWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Qingxiangmu"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php/Special:Contributions/Qingxiangmu"/>
		<updated>2026-05-26T20:20:12Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184028</id>
		<title>Os05g0584200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184028"/>
				<updated>2014-06-13T09:08:27Z</updated>
		
		<summary type="html">&lt;p&gt;Qingxiangmu: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsLEA5 polypeptide isrich in Leu (10%), Ser (8.6%), and Asp (8.6%), while Cys,Trp, and Gln residue contents are very low, which are&lt;br /&gt;
2, 1.3, and 1.3%, respectively.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
Therefore,&lt;br /&gt;
in this work, the repeated freeze–thaw regime was selected&lt;br /&gt;
to investigate the cryophylactic function of OsLEA5 in E. coli cells. Herein, it was found that the expression of the&lt;br /&gt;
OsLEA5 protein could directly contribute to the enhanced&lt;br /&gt;
thermotolerance and cryophylactic of recombinant bacteria&lt;br /&gt;
cells. In general, both the denaturation and dysfunction of&lt;br /&gt;
proteins and damage of cellular architectures occur when&lt;br /&gt;
cells are subjected to low- or high-temperature stress. The&lt;br /&gt;
protective effect of OsLEA5 might be due to the maintenance&lt;br /&gt;
of proteins in a functional conformation (Reyes et al.&lt;br /&gt;
2008). Hence, it is suggested that the&lt;br /&gt;
OsLEA5 protein would play an important role in protecting&lt;br /&gt;
the host cells survival from extreme temperature stress,&lt;br /&gt;
which has action similar to the heat shock protein.Experimental evidence&lt;br /&gt;
here conforms that OsLEA5 is important in maintaining&lt;br /&gt;
BL/OsLEA5 cell survival during ultraviolet light stress.Although the scientific literature&lt;br /&gt;
provides few answers for such question, it is&lt;br /&gt;
assumed that OsLEA5 probably perform the role of protective&lt;br /&gt;
molecules cooperated with other factors to protect&lt;br /&gt;
cellular components against ROS-induced damage and&lt;br /&gt;
even an additional role as repair mechanisms in eliminating&lt;br /&gt;
the thymine dimer produced by photochemical injury of&lt;br /&gt;
UV radiation. It is concluded that the OsLEA5 may have a&lt;br /&gt;
unique function among LEA proteins, in that it is involved&lt;br /&gt;
in protecting cells against UV radiation stress.In summary, the rice OsLEA5 gene encodes a LEA-like&lt;br /&gt;
protein with an average negative hydropathy. It is classified&lt;br /&gt;
as the non-typical group 5C with highly hydrophobic,&lt;br /&gt;
intrinsically ordered and specific amino acid composition&lt;br /&gt;
and distribution, the most extraordinary LEA protein group&lt;br /&gt;
compared with canonical and other atypical LEAs. Realtime&lt;br /&gt;
PCR analysis showed that OsLEA5 can express in&lt;br /&gt;
different tissue organs at all times. The expression levels of&lt;br /&gt;
OsLEA5 in the roots and panicles of full ripe stage were&lt;br /&gt;
dramatically increased in comparison with other tissueorgan. The experimental finding showed that overexpression&lt;br /&gt;
of OsLEA5 in transgenic E. coli enhanced cell viability&lt;br /&gt;
and significantly improved tolerance under diverse&lt;br /&gt;
abiotic stresses, and the OsLEA5 protein protected LDH&lt;br /&gt;
against the inactivation induced by abiotic stress. Our&lt;br /&gt;
research suggested that OsLEA5 had multiple protective&lt;br /&gt;
efficiencies in response to a broader range of abiotic stress&lt;br /&gt;
conditions.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
[[File:Fig.4.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
Key Laboratory of Biorheological Science and Technology,&lt;br /&gt;
Ministry of Education, College of Bioengineering,&lt;br /&gt;
Chongqing University, Chongqing 400044, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
1. Shuai He;Lili Tan;Zongli Hu;Guoping Chen;Guixue Wang;Tingzhang Hu&lt;br /&gt;
  Molecular characterization and functional analysis by heterologous expression in E. coli under diverse abiotic stresses for OsLEA5, the atypical hydrophobic LEA protein from Oryza sativa L.&lt;br /&gt;
  Molecular Genetics and Genomics, 2011, 287(1): 39-54&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os05g0584200|&lt;br /&gt;
Description = Similar to Late embryogenesis abundant protein Lea14-A|&lt;br /&gt;
Version = NM_001062984.1 GI:115465698 GeneID:4339745|&lt;br /&gt;
Length = 1237 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os05g0584200, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:29070275..29071511|&lt;br /&gt;
CDS = 29070755..29070960,29071073..29071322|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN                     VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI                     SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062984.1 RefSeq:Os05g0584200]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Qingxiangmu</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184027</id>
		<title>Os05g0584200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184027"/>
				<updated>2014-06-13T09:06:13Z</updated>
		
		<summary type="html">&lt;p&gt;Qingxiangmu: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
Therefore,&lt;br /&gt;
in this work, the repeated freeze–thaw regime was selected&lt;br /&gt;
to investigate the cryophylactic function of OsLEA5 in E. coli cells. Herein, it was found that the expression of the&lt;br /&gt;
OsLEA5 protein could directly contribute to the enhanced&lt;br /&gt;
thermotolerance and cryophylactic of recombinant bacteria&lt;br /&gt;
cells. In general, both the denaturation and dysfunction of&lt;br /&gt;
proteins and damage of cellular architectures occur when&lt;br /&gt;
cells are subjected to low- or high-temperature stress. The&lt;br /&gt;
protective effect of OsLEA5 might be due to the maintenance&lt;br /&gt;
of proteins in a functional conformation (Reyes et al.&lt;br /&gt;
2008). Hence, it is suggested that the&lt;br /&gt;
OsLEA5 protein would play an important role in protecting&lt;br /&gt;
the host cells survival from extreme temperature stress,&lt;br /&gt;
which has action similar to the heat shock protein.Experimental evidence&lt;br /&gt;
here conforms that OsLEA5 is important in maintaining&lt;br /&gt;
BL/OsLEA5 cell survival during ultraviolet light stress.Although the scientific literature&lt;br /&gt;
provides few answers for such question, it is&lt;br /&gt;
assumed that OsLEA5 probably perform the role of protective&lt;br /&gt;
molecules cooperated with other factors to protect&lt;br /&gt;
cellular components against ROS-induced damage and&lt;br /&gt;
even an additional role as repair mechanisms in eliminating&lt;br /&gt;
the thymine dimer produced by photochemical injury of&lt;br /&gt;
UV radiation. It is concluded that the OsLEA5 may have a&lt;br /&gt;
unique function among LEA proteins, in that it is involved&lt;br /&gt;
in protecting cells against UV radiation stress.In summary, the rice OsLEA5 gene encodes a LEA-like&lt;br /&gt;
protein with an average negative hydropathy. It is classified&lt;br /&gt;
as the non-typical group 5C with highly hydrophobic,&lt;br /&gt;
intrinsically ordered and specific amino acid composition&lt;br /&gt;
and distribution, the most extraordinary LEA protein group&lt;br /&gt;
compared with canonical and other atypical LEAs. Realtime&lt;br /&gt;
PCR analysis showed that OsLEA5 can express in&lt;br /&gt;
different tissue organs at all times. The expression levels of&lt;br /&gt;
OsLEA5 in the roots and panicles of full ripe stage were&lt;br /&gt;
dramatically increased in comparison with other tissueorgan. The experimental finding showed that overexpression&lt;br /&gt;
of OsLEA5 in transgenic E. coli enhanced cell viability&lt;br /&gt;
and significantly improved tolerance under diverse&lt;br /&gt;
abiotic stresses, and the OsLEA5 protein protected LDH&lt;br /&gt;
against the inactivation induced by abiotic stress. Our&lt;br /&gt;
research suggested that OsLEA5 had multiple protective&lt;br /&gt;
efficiencies in response to a broader range of abiotic stress&lt;br /&gt;
conditions.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
[[File:Fig.4.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
Key Laboratory of Biorheological Science and Technology,&lt;br /&gt;
Ministry of Education, College of Bioengineering,&lt;br /&gt;
Chongqing University, Chongqing 400044, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
1. Shuai He;Lili Tan;Zongli Hu;Guoping Chen;Guixue Wang;Tingzhang Hu&lt;br /&gt;
  Molecular characterization and functional analysis by heterologous expression in E. coli under diverse abiotic stresses for OsLEA5, the atypical hydrophobic LEA protein from Oryza sativa L.&lt;br /&gt;
  Molecular Genetics and Genomics, 2011, 287(1): 39-54&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os05g0584200|&lt;br /&gt;
Description = Similar to Late embryogenesis abundant protein Lea14-A|&lt;br /&gt;
Version = NM_001062984.1 GI:115465698 GeneID:4339745|&lt;br /&gt;
Length = 1237 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os05g0584200, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:29070275..29071511|&lt;br /&gt;
CDS = 29070755..29070960,29071073..29071322|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN                     VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI                     SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062984.1 RefSeq:Os05g0584200]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Qingxiangmu</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.4.jpg&amp;diff=184026</id>
		<title>File:Fig.4.jpg</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig.4.jpg&amp;diff=184026"/>
				<updated>2014-06-13T09:04:49Z</updated>
		
		<summary type="html">&lt;p&gt;Qingxiangmu: uploaded a new version of &amp;amp;quot;File:Fig.4.jpg&amp;amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Qingxiangmu</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184025</id>
		<title>Os05g0584200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184025"/>
				<updated>2014-06-13T08:59:42Z</updated>
		
		<summary type="html">&lt;p&gt;Qingxiangmu: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
Therefore,&lt;br /&gt;
in this work, the repeated freeze–thaw regime was selected&lt;br /&gt;
to investigate the cryophylactic function of OsLEA5 in E. coli cells. Herein, it was found that the expression of the&lt;br /&gt;
OsLEA5 protein could directly contribute to the enhanced&lt;br /&gt;
thermotolerance and cryophylactic of recombinant bacteria&lt;br /&gt;
cells. In general, both the denaturation and dysfunction of&lt;br /&gt;
proteins and damage of cellular architectures occur when&lt;br /&gt;
cells are subjected to low- or high-temperature stress. The&lt;br /&gt;
protective effect of OsLEA5 might be due to the maintenance&lt;br /&gt;
of proteins in a functional conformation (Reyes et al.&lt;br /&gt;
2008). Hence, it is suggested that the&lt;br /&gt;
OsLEA5 protein would play an important role in protecting&lt;br /&gt;
the host cells survival from extreme temperature stress,&lt;br /&gt;
which has action similar to the heat shock protein.Experimental evidence&lt;br /&gt;
here conforms that OsLEA5 is important in maintaining&lt;br /&gt;
BL/OsLEA5 cell survival during ultraviolet light stress.Although the scientific literature&lt;br /&gt;
provides few answers for such question, it is&lt;br /&gt;
assumed that OsLEA5 probably perform the role of protective&lt;br /&gt;
molecules cooperated with other factors to protect&lt;br /&gt;
cellular components against ROS-induced damage and&lt;br /&gt;
even an additional role as repair mechanisms in eliminating&lt;br /&gt;
the thymine dimer produced by photochemical injury of&lt;br /&gt;
UV radiation. It is concluded that the OsLEA5 may have a&lt;br /&gt;
unique function among LEA proteins, in that it is involved&lt;br /&gt;
in protecting cells against UV radiation stress.In summary, the rice OsLEA5 gene encodes a LEA-like&lt;br /&gt;
protein with an average negative hydropathy. It is classified&lt;br /&gt;
as the non-typical group 5C with highly hydrophobic,&lt;br /&gt;
intrinsically ordered and specific amino acid composition&lt;br /&gt;
and distribution, the most extraordinary LEA protein group&lt;br /&gt;
compared with canonical and other atypical LEAs. Realtime&lt;br /&gt;
PCR analysis showed that OsLEA5 can express in&lt;br /&gt;
different tissue organs at all times. The expression levels of&lt;br /&gt;
OsLEA5 in the roots and panicles of full ripe stage were&lt;br /&gt;
dramatically increased in comparison with other tissueorgan. The experimental finding showed that overexpression&lt;br /&gt;
of OsLEA5 in transgenic E. coli enhanced cell viability&lt;br /&gt;
and significantly improved tolerance under diverse&lt;br /&gt;
abiotic stresses, and the OsLEA5 protein protected LDH&lt;br /&gt;
against the inactivation induced by abiotic stress. Our&lt;br /&gt;
research suggested that OsLEA5 had multiple protective&lt;br /&gt;
efficiencies in response to a broader range of abiotic stress&lt;br /&gt;
conditions.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
Key Laboratory of Biorheological Science and Technology,&lt;br /&gt;
Ministry of Education, College of Bioengineering,&lt;br /&gt;
Chongqing University, Chongqing 400044, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
1. Shuai He;Lili Tan;Zongli Hu;Guoping Chen;Guixue Wang;Tingzhang Hu&lt;br /&gt;
  Molecular characterization and functional analysis by heterologous expression in E. coli under diverse abiotic stresses for OsLEA5, the atypical hydrophobic LEA protein from Oryza sativa L.&lt;br /&gt;
  Molecular Genetics and Genomics, 2011, 287(1): 39-54&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os05g0584200|&lt;br /&gt;
Description = Similar to Late embryogenesis abundant protein Lea14-A|&lt;br /&gt;
Version = NM_001062984.1 GI:115465698 GeneID:4339745|&lt;br /&gt;
Length = 1237 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os05g0584200, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:29070275..29071511|&lt;br /&gt;
CDS = 29070755..29070960,29071073..29071322|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN                     VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI                     SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062984.1 RefSeq:Os05g0584200]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Qingxiangmu</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184024</id>
		<title>Os05g0584200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184024"/>
				<updated>2014-06-13T08:58:32Z</updated>
		
		<summary type="html">&lt;p&gt;Qingxiangmu: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
Therefore,&lt;br /&gt;
in this work, the repeated freeze–thaw regime was selected&lt;br /&gt;
to investigate the cryophylactic function of OsLEA5 in E. coli cells. Herein, it was found that the expression of the&lt;br /&gt;
OsLEA5 protein could directly contribute to the enhanced&lt;br /&gt;
thermotolerance and cryophylactic of recombinant bacteria&lt;br /&gt;
cells. In general, both the denaturation and dysfunction of&lt;br /&gt;
proteins and damage of cellular architectures occur when&lt;br /&gt;
cells are subjected to low- or high-temperature stress. The&lt;br /&gt;
protective effect of OsLEA5 might be due to the maintenance&lt;br /&gt;
of proteins in a functional conformation (Reyes et al.&lt;br /&gt;
2008). Hence, it is suggested that the&lt;br /&gt;
OsLEA5 protein would play an important role in protecting&lt;br /&gt;
the host cells survival from extreme temperature stress,&lt;br /&gt;
which has action similar to the heat shock protein.Experimental evidence&lt;br /&gt;
here conforms that OsLEA5 is important in maintaining&lt;br /&gt;
BL/OsLEA5 cell survival during ultraviolet light stress.Although the scientific literature&lt;br /&gt;
provides few answers for such question, it is&lt;br /&gt;
assumed that OsLEA5 probably perform the role of protective&lt;br /&gt;
molecules cooperated with other factors to protect&lt;br /&gt;
cellular components against ROS-induced damage and&lt;br /&gt;
even an additional role as repair mechanisms in eliminating&lt;br /&gt;
the thymine dimer produced by photochemical injury of&lt;br /&gt;
UV radiation. It is concluded that the OsLEA5 may have a&lt;br /&gt;
unique function among LEA proteins, in that it is involved&lt;br /&gt;
in protecting cells against UV radiation stress.In summary, the rice OsLEA5 gene encodes a LEA-like&lt;br /&gt;
protein with an average negative hydropathy. It is classified&lt;br /&gt;
as the non-typical group 5C with highly hydrophobic,&lt;br /&gt;
intrinsically ordered and specific amino acid composition&lt;br /&gt;
and distribution, the most extraordinary LEA protein group&lt;br /&gt;
compared with canonical and other atypical LEAs. Realtime&lt;br /&gt;
PCR analysis showed that OsLEA5 can express in&lt;br /&gt;
different tissue organs at all times. The expression levels of&lt;br /&gt;
OsLEA5 in the roots and panicles of full ripe stage were&lt;br /&gt;
dramatically increased in comparison with other tissueorgan. The experimental finding showed that overexpression&lt;br /&gt;
of OsLEA5 in transgenic E. coli enhanced cell viability&lt;br /&gt;
and significantly improved tolerance under diverse&lt;br /&gt;
abiotic stresses, and the OsLEA5 protein protected LDH&lt;br /&gt;
against the inactivation induced by abiotic stress. Our&lt;br /&gt;
research suggested that OsLEA5 had multiple protective&lt;br /&gt;
efficiencies in response to a broader range of abiotic stress&lt;br /&gt;
conditions.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
1. Shuai He;Lili Tan;Zongli Hu;Guoping Chen;Guixue Wang;Tingzhang Hu&lt;br /&gt;
  Molecular characterization and functional analysis by heterologous expression in E. coli under diverse abiotic stresses for OsLEA5, the atypical hydrophobic LEA protein from Oryza sativa L.&lt;br /&gt;
  Molecular Genetics and Genomics, 2011, 287(1): 39-54&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os05g0584200|&lt;br /&gt;
Description = Similar to Late embryogenesis abundant protein Lea14-A|&lt;br /&gt;
Version = NM_001062984.1 GI:115465698 GeneID:4339745|&lt;br /&gt;
Length = 1237 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os05g0584200, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:29070275..29071511|&lt;br /&gt;
CDS = 29070755..29070960,29071073..29071322|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN                     VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI                     SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062984.1 RefSeq:Os05g0584200]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Qingxiangmu</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184023</id>
		<title>Os05g0584200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184023"/>
				<updated>2014-06-13T08:54:59Z</updated>
		
		<summary type="html">&lt;p&gt;Qingxiangmu: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
Therefore,&lt;br /&gt;
in this work, the repeated freeze–thaw regime was selected&lt;br /&gt;
to investigate the cryophylactic function of OsLEA5 in E. coli cells. Herein, it was found that the expression of the&lt;br /&gt;
OsLEA5 protein could directly contribute to the enhanced&lt;br /&gt;
thermotolerance and cryophylactic of recombinant bacteria&lt;br /&gt;
cells. In general, both the denaturation and dysfunction of&lt;br /&gt;
proteins and damage of cellular architectures occur when&lt;br /&gt;
cells are subjected to low- or high-temperature stress. The&lt;br /&gt;
protective effect of OsLEA5 might be due to the maintenance&lt;br /&gt;
of proteins in a functional conformation (Reyes et al.&lt;br /&gt;
2008). Hence, it is suggested that the&lt;br /&gt;
OsLEA5 protein would play an important role in protecting&lt;br /&gt;
the host cells survival from extreme temperature stress,&lt;br /&gt;
which has action similar to the heat shock protein.Experimental evidence&lt;br /&gt;
here conforms that OsLEA5 is important in maintaining&lt;br /&gt;
BL/OsLEA5 cell survival during ultraviolet light stress.Although the scientific literature&lt;br /&gt;
provides few answers for such question, it is&lt;br /&gt;
assumed that OsLEA5 probably perform the role of protective&lt;br /&gt;
molecules cooperated with other factors to protect&lt;br /&gt;
cellular components against ROS-induced damage and&lt;br /&gt;
even an additional role as repair mechanisms in eliminating&lt;br /&gt;
the thymine dimer produced by photochemical injury of&lt;br /&gt;
UV radiation. It is concluded that the OsLEA5 may have a&lt;br /&gt;
unique function among LEA proteins, in that it is involved&lt;br /&gt;
in protecting cells against UV radiation stress.In summary, the rice OsLEA5 gene encodes a LEA-like&lt;br /&gt;
protein with an average negative hydropathy. It is classified&lt;br /&gt;
as the non-typical group 5C with highly hydrophobic,&lt;br /&gt;
intrinsically ordered and specific amino acid composition&lt;br /&gt;
and distribution, the most extraordinary LEA protein group&lt;br /&gt;
compared with canonical and other atypical LEAs. Realtime&lt;br /&gt;
PCR analysis showed that OsLEA5 can express in&lt;br /&gt;
different tissue organs at all times. The expression levels of&lt;br /&gt;
OsLEA5 in the roots and panicles of full ripe stage were&lt;br /&gt;
dramatically increased in comparison with other tissueorgan. The experimental finding showed that overexpression&lt;br /&gt;
of OsLEA5 in transgenic E. coli enhanced cell viability&lt;br /&gt;
and significantly improved tolerance under diverse&lt;br /&gt;
abiotic stresses, and the OsLEA5 protein protected LDH&lt;br /&gt;
against the inactivation induced by abiotic stress. Our&lt;br /&gt;
research suggested that OsLEA5 had multiple protective&lt;br /&gt;
efficiencies in response to a broader range of abiotic stress&lt;br /&gt;
conditions.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os05g0584200|&lt;br /&gt;
Description = Similar to Late embryogenesis abundant protein Lea14-A|&lt;br /&gt;
Version = NM_001062984.1 GI:115465698 GeneID:4339745|&lt;br /&gt;
Length = 1237 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os05g0584200, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:29070275..29071511|&lt;br /&gt;
CDS = 29070755..29070960,29071073..29071322|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN                     VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI                     SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062984.1 RefSeq:Os05g0584200]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Qingxiangmu</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184022</id>
		<title>Os05g0584200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0584200&amp;diff=184022"/>
				<updated>2014-06-13T08:47:45Z</updated>
		
		<summary type="html">&lt;p&gt;Qingxiangmu: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
In order to well understand the function of this protein, the expression pattern of OsLEA5 in rice was analyzed. Realtime PCR analysis showed that OsLEA5 transcript was detected in the roots and leaves of rice plant at the seedling stage, their roots, stems, and leaves at the tillering stage, and their roots, stems, leaves, and panicles at the heading stage, filling stage, and full ripe stage, which demonstrated OsLEA5 can express in different tissue organs during different development stages of rice (Fig. 5). However,significant differences were observed. The expression of OsLEA5 in leaves at all times kept at a relatively higher level during the different development stages of rice. In both roots and panicles of full ripe stage, the expression levels of OsLEA5 were dramatically upregulated, which were about 17-fold and 15-fold higher than those in leaves, respectively (Fig. 5). These results illustrated that OsLEA5 might cope with various environmental stresses,maturation, and desiccation phases of rice seed development.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os05g0584200|&lt;br /&gt;
Description = Similar to Late embryogenesis abundant protein Lea14-A|&lt;br /&gt;
Version = NM_001062984.1 GI:115465698 GeneID:4339745|&lt;br /&gt;
Length = 1237 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os05g0584200, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:29070275..29071511|&lt;br /&gt;
CDS = 29070755..29070960,29071073..29071322|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008398:29070275..29071511&lt;br /&gt;
source=RiceChromosome05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaacgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaa&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MSSLMDKAKGFVAEKIAHIPKPEASLDSLSFKGMSRECITVHSN                     VNVSNPYDHRLPICELTYTLKCAGNVVASGTMPDPGWIAASDTTKLEIPAKIPYDFLI                     SLVKDVGRDWDIDYQLDVGLTIDLPIVGNFTIPLSTSGEMKLPTLKDMF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;481..686#799..1048#agtgcagagatgggatcgccgatcagtgagcgattcggtgcaggcaactgataaggagggaggatctctccgccgactcagcaccgtccgtttcgggacgtggtgccgttttggccccgcgccgaagcttctcccctttgcagttatcaaattccccttgcagccacgcagatttacgccgcgcccccacgcaacccaaaagttcagcgtaaacttgcctatcaacaaaactacagctcaggcggccacgcgaaatcgcgaggtttcacgtaccaaaagcgcaaaaatccactcggattccacgcggccgagccactgcacgtgggcgcccacgacgcgcccccgtatcgatcggcaccgcgctttcctcctcctgatcttacccgctactatatcatcatctgcttgctttccccccgagagtccacggcctcctgctcctctcgatccaagataatttcactccagcgtgcgtcggccatgtcgagcttgatggacaaggcgaaagggttcgtggcggagaagatcgcgcacatcccaaagccggaggcgtcgctggacagcttgtcgttcaaggggatgagccgcgagtgcatcaccgtgcacagcaacgtcaacgtctccaacccctacgaccaccgcctccccatctgcgagctcacctacaccctcaagtgcgccggcaagtacgtgtcacagctagcttttgcttgtccgatcgatgatccatccatctcacgctcgatcgaattgtgctaattgtgtattggtcgatttggattgattggtcatcatcagcgttgtggcgtccggcacgatgcccgatccggggtggatcgcggcgagcgacacgacgaagctggagataccggccaagatcccctacgacttcctcatctcgctggtgaaggacgtgggccgggactgggacatcgactaccagctcgacgtcggcctcaccatcgacctccccatcgtcggcaacttcaccatcccgctctccaccagcggcgagatgaagctccccacactcaaggacatgttctaattatcttatctctaatctcatcaaccaactccgatcgatcgaactctctgtatgtgtgatgtgtctcgcgaataatggcagctgctctgcacctgtgttcttcttgccctgcatagtatagcatggctgtatgagcggctgaaaaattacctctattcctaatggttgcaataataagctagagaactg&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001062984.1 RefSeq:Os05g0584200]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Qingxiangmu</name></author>	</entry>

	</feed>