RiceWiki - User contributions [en]

Os11g0454000

2014-06-11T00:21:46Z

Sunny1227:

The description of the rice '''Os11g0454000'''gene is the ''rab 16c'' gene. The ''rab 16c'' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.
==Annotated Information==
===Function===
Drought and salt are two adverse factors affecting seriously growth, development, and productivity of rice. when subjecting rice to drought and salt as stresses, plants increase ABA sensitivity in rice . The ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well
as stomatal function and the response of plant tissues to osmotic stress.
===Expression===
Its expression is not tissue specific high in ABA-treated seedlings and roots and responsive to osmotic stress. Its mRNA accumulates to detectable levels in mature embryos.

===Evolution===
Two types of conserved DNA sequence motifs are found in the promoter regions of the ''rab 16C'' genes . The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes. The
core of Motif II (CGG/CCGCGCT), found once in ''rab 16C'', is 80% homologous with the binding site of SP1, an auxilliary transcription factor . These elements may play a role in modulating the transcriptional activation in the rab genes.Another conserved sequence, whose core is found in the promoter regions of ABA-responsive cotton genes, is reminiscent of the cAMP responsive element.
Ose717 shared a 91% homology with the 140 nucleotide coding sequences of a rice ABA response gene, ''rab16C''. The high degree of homology within the coding region implied that the genes were closely related.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
[1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
[2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
[3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
[4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
[5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.

==Structured Information==
{{JaponicaGene|
GeneName = Os11g0454000|
Description = Dehydrin RAB 16C|
Version = NM_001074374.1 GI:115485396 GeneID:4350452|
Length = 889 bp|
Definition = Oryza sativa Japonica Group Os11g0454000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
AP = Chromosome 11:17154225..17155113|
CDS = 17154447..17154713,17154809..17155036|
GCID = <gbrowseImage1>
name=NC_008404:17154225..17155113
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008404:17154225..17155113
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcgtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaa</cdnaseq>|
AA = <aaseq>MENYQGQHGYGADRVDVYGNPVAGQYGGGATAPGGGHGVMGMGG HHAGAGGQFQPVKEEHKTGGILHRSGSSSSSSSSEDDGMGGRRKKGIKEKIKEKLPGG NKGNNQQQQQMMGNTGGAYGQQGHAGMTGAGTGTGVHGAEYGNTGEKKGFMDKIKEKL PGQH</aaseq>|
DNA = <dnaseqindica>401..667#78..305#atcgatcacaagacacaagatttttcactgatagaatagcaacacttgggtgagagatcagacgcgtgtttgagaagatggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcggtacgttcactgtcgtccattcataaatctaattaatcgcctcgcttctgaattcctttatttaatttgagttgtactcgtgtgcgtttgtgcagtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaaataagctcgaccgggtcgtcaccaaatatgtcgtgatgtacgtgcagttttatatgttgttgaataaactagcgtgaaatgcgagtgatggtgtcttctgccttgggacggatgacacattgtctgttgtgttctcgcgtccgtgtcggttttacccttgaaatgtaatatggtgtgtgtacacactaaggttttattgaagtgtgactttgtgcttgtgtt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074374.1 RefSeq:Os11g0454000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 11]]
[[Category:Chromosome 11]]

Os11g0454000

2014-06-11T00:20:10Z

Sunny1227:

Please input one-sentence summary here.
The description of the rice '''Os11g0454000'''gene is the ''rab 16c'' gene. The ''rab 16c'' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.
==Annotated Information==
===Function===
Drought and salt are two adverse factors affecting seriously growth, development, and productivity of rice. when subjecting rice to drought and salt as stresses, plants increase ABA sensitivity in rice . The ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well
as stomatal function and the response of plant tissues to osmotic stress.
===Expression===
Its expression is not tissue specific high in ABA-treated seedlings and roots and responsive to osmotic stress. Its mRNA accumulates to detectable levels in mature embryos.

===Evolution===
Two types of conserved DNA sequence motifs are found in the promoter regions of the ''rab 16C'' genes . The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes. The
core of Motif II (CGG/CCGCGCT), found once in ''rab 16C'', is 80% homologous with the binding site of SP1, an auxilliary transcription factor . These elements may play a role in modulating the transcriptional activation in the rab genes.Another conserved sequence, whose core is found in the promoter regions of ABA-responsive cotton genes, is reminiscent of the cAMP responsive element.
Ose717 shared a 91% homology with the 140 nucleotide coding sequences of a rice ABA response gene, ''rab16C''. The high degree of homology within the coding region implied that the genes were closely related.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
[1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
[2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
[3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
[4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
[5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.

==Structured Information==
{{JaponicaGene|
GeneName = Os11g0454000|
Description = Dehydrin RAB 16C|
Version = NM_001074374.1 GI:115485396 GeneID:4350452|
Length = 889 bp|
Definition = Oryza sativa Japonica Group Os11g0454000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
AP = Chromosome 11:17154225..17155113|
CDS = 17154447..17154713,17154809..17155036|
GCID = <gbrowseImage1>
name=NC_008404:17154225..17155113
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008404:17154225..17155113
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcgtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaa</cdnaseq>|
AA = <aaseq>MENYQGQHGYGADRVDVYGNPVAGQYGGGATAPGGGHGVMGMGG HHAGAGGQFQPVKEEHKTGGILHRSGSSSSSSSSEDDGMGGRRKKGIKEKIKEKLPGG NKGNNQQQQQMMGNTGGAYGQQGHAGMTGAGTGTGVHGAEYGNTGEKKGFMDKIKEKL PGQH</aaseq>|
DNA = <dnaseqindica>401..667#78..305#atcgatcacaagacacaagatttttcactgatagaatagcaacacttgggtgagagatcagacgcgtgtttgagaagatggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcggtacgttcactgtcgtccattcataaatctaattaatcgcctcgcttctgaattcctttatttaatttgagttgtactcgtgtgcgtttgtgcagtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaaataagctcgaccgggtcgtcaccaaatatgtcgtgatgtacgtgcagttttatatgttgttgaataaactagcgtgaaatgcgagtgatggtgtcttctgccttgggacggatgacacattgtctgttgtgttctcgcgtccgtgtcggttttacccttgaaatgtaatatggtgtgtgtacacactaaggttttattgaagtgtgactttgtgcttgtgtt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074374.1 RefSeq:Os11g0454000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 11]]
[[Category:Chromosome 11]]

Os11g0454000

2014-06-10T14:48:17Z

Sunny1227:

Please input one-sentence summary here.
The description of the rice '''Os11g0454000'''gene is the ''rab 16c'' gene. The ''rab 16c'' is ABA response protein.Therefore, the rice '''Os11g0454000'''gene is a functional gene in response to abiotic stresses, such as drought and salt.
==Annotated Information==
===Function===
Please input function information here.
Drought and salt are two adverse factors affecting seriously growth, development, and productivity of rice. when subjecting rice to drought and salt as stresses, plants increase ABA sensitivity in rice . The ''rab 16c'' gene and other functional genes are expression in a high level to response to the stresses.
The expression of ''rab 16c''is controlled by ABA which appears to mediate important physiological and developmental processes in plants. These include embryo morphogenesis and germination in seeds as well
as stomatal function and the response of plant tissues to osmotic stress.
===Expression===
Please input expression information here.
Its expression is not tissue specific high in ABA-treated seedlings and roots and responsive to osmotic stress. Its mRNA accumulates to detectable levels in mature embryos.

===Evolution===
Please input evolution information here.
Two types of conserved DNA sequence motifs are found in the promoter regions of the ''rab 16C'' genes . The core of Motif I (PuTACGTGGCPu), reminiscent of the cAMP response element (TGACGTA [5]), appears to be conserved in the promoter regions of several cotton lea genes. The
core of Motif II (CGG/CCGCGCT), found once in ''rab 16C'', is 80% homologous with the binding site of SP1, an auxilliary transcription factor . These elements may play a role in modulating the transcriptional activation in the rab genes.Another conserved sequence, whose core is found in the promoter regions of ABA-responsive cotton genes, is reminiscent of the cAMP responsive element.
Ose717 shared a 91% homology with the 140 nucleotide coding sequences of a rice ABA response gene, ''rab16C''. The high degree of homology within the coding region implied that the genes were closely related.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.
[1]Yamaguchi-Shinozaki, K., J. Mundy, and N.H. Chua. Four tightly linked rab genes are differentially expressed in rice. Plant Mol. Biol.(1990) 14: 29_39.
[2]Peng-Wen Chen1, Li-Wen Fang2, Juey-Wen Lin3, et al.Isolation of cDNA clones for genes that are specifically expressed in the rice embryo.Bot. Bull. Acad. Sin. (1997) 38: 13-20.
[3]Hao-Wen Li, Bai-Sheng Zang, Xing-Wang Deng,et al.Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice.Planta (2011) 234:1007–1018.
[4]NÉLIDA OLAVE-CONCHA1, SIMÓN RUIZ-LARA2, XIMENA MUÑOZ1, et al.Accumulation of dehydrin transcripts and proteins in response to abiotic stresses in Deschampsia antarctica. Antarctic Science (2004)16 (2): 175–184.
[5]John Mundy, Nam-Hal Chua. Abscisic acid and water-stress induce the expression of a novel rice gene.The EMBO Journal (1988) 7(8): 2279-2286.

==Structured Information==
{{JaponicaGene|
GeneName = Os11g0454000|
Description = Dehydrin RAB 16C|
Version = NM_001074374.1 GI:115485396 GeneID:4350452|
Length = 889 bp|
Definition = Oryza sativa Japonica Group Os11g0454000, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|
AP = Chromosome 11:17154225..17155113|
CDS = 17154447..17154713,17154809..17155036|
GCID = <gbrowseImage1>
name=NC_008404:17154225..17155113
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008404:17154225..17155113
source=RiceChromosome11
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcgtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaa</cdnaseq>|
AA = <aaseq>MENYQGQHGYGADRVDVYGNPVAGQYGGGATAPGGGHGVMGMGG HHAGAGGQFQPVKEEHKTGGILHRSGSSSSSSSSEDDGMGGRRKKGIKEKIKEKLPGG NKGNNQQQQQMMGNTGGAYGQQGHAGMTGAGTGTGVHGAEYGNTGEKKGFMDKIKEKL PGQH</aaseq>|
DNA = <dnaseqindica>401..667#78..305#atcgatcacaagacacaagatttttcactgatagaatagcaacacttgggtgagagatcagacgcgtgtttgagaagatggagaactaccaggggcagcacggctacggcgccgaccgcgtcgacgtgtacggcaacccggtcgccggccagtacggcggcggcgccaccgctcccggcggaggccatggcgtgatgggaatgggagggcatcacgccggcgccggcgggcagttccagccggtgaaggaggagcacaagaccggcggcatcctccaccgctccggcagctcaagctccagctcggtacgttcactgtcgtccattcataaatctaattaatcgcctcgcttctgaattcctttatttaatttgagttgtactcgtgtgcgtttgtgcagtcgtctgaggacgacgggatgggagggaggaggaagaagggaatcaaggagaagatcaaggagaagctccccggcggcaacaagggcaacaaccagcagcagcagcagatgatggggaacaccggcggcgcgtacgggcagcaggggcacgccgggatgaccggcgccggcaccggcaccggcgtgcacggtgcggagtacggcaacaccggcgagaagaagggcttcatggacaagatcaaggaaaagcttcccggccagcactaaataagctcgaccgggtcgtcaccaaatatgtcgtgatgtacgtgcagttttatatgttgttgaataaactagcgtgaaatgcgagtgatggtgtcttctgccttgggacggatgacacattgtctgttgtgttctcgcgtccgtgtcggttttacccttgaaatgtaatatggtgtgtgtacacactaaggttttattgaagtgtgactttgtgcttgtgtt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001074374.1 RefSeq:Os11g0454000]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 11]]
[[Category:Chromosome 11]]