<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Tangdanwiki</id>
		<title>RiceWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Tangdanwiki"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php/Special:Contributions/Tangdanwiki"/>
		<updated>2026-08-27T22:29:54Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=182000</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=182000"/>
				<updated>2014-06-09T07:49:09Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 255 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450130 NCBI Gene:atp6]&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=181939</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=181939"/>
				<updated>2014-06-09T07:02:13Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=181938</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=181938"/>
				<updated>2014-06-09T07:01:44Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=181935</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=181935"/>
				<updated>2014-06-09T06:59:29Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180782</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180782"/>
				<updated>2014-06-08T06:49:22Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180777</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180777"/>
				<updated>2014-06-08T06:48:37Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Knowledge extension */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref15&amp;quot;&amp;gt;Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180775</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180775"/>
				<updated>2014-06-08T06:47:28Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref15&amp;quot;&amp;gt;Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180764</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180764"/>
				<updated>2014-06-08T06:42:32Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180761</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180761"/>
				<updated>2014-06-08T06:41:04Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180759</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180759"/>
				<updated>2014-06-08T06:40:27Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Knowledge extension */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180758</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180758"/>
				<updated>2014-06-08T06:39:17Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180757</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180757"/>
				<updated>2014-06-08T06:37:14Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows: Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180754</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180754"/>
				<updated>2014-06-08T06:36:07Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180753</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180753"/>
				<updated>2014-06-08T06:35:33Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180749</id>
		<title>Atp9</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Atp9&amp;diff=180749"/>
				<updated>2014-06-08T06:32:55Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
The protein it encodes has only two transmembrane segments, yet is extremely hydrophobic and classified as a proteolipid because it can easily be extracted from mitochondria with organic solvents . Subunit 9 is present in several copies , forming a ring structure that is an essential component of the ATP synthase proton-translocating domain . During proton transport, the subunit 9-ring rotates, resulting in conformational changes that favour the production of ATP by the catalytic head of the ATP synthase and its release into the mitochondrial matrix.&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&lt;br /&gt;
=== Mutation ===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Wei Jiang, Shouping Yang*, Deyue Yu and Junyi Gai.A comparative study of A TPase subunit 9 (Atp9) gene between cytoplasmic male sterile line and its maintainer line in soybeans.African Journal of Biotechnology Vol. 10(51), pp. 10387-10392, 7 September , 2011&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sandrine Bonhomme, 1 Sharon Bird and Linda Bonen*.Comparison of the wheat mitochondrial atp9 gene sequence with mitochondrial and chloroplast homologues from  other plants .Plant Molecular Biology 13: 395-397, 1989.&amp;lt;/ref&amp;gt;&lt;br /&gt;
 &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial&lt;br /&gt;
Genome Evolution PLOS Genetics August 2012&amp;lt;/ref&amp;gt;&lt;br /&gt;
== Structured Information ==&lt;br /&gt;
{{Mitochondrion|&lt;br /&gt;
GeneName = atp9|&lt;br /&gt;
Description = ATP synthase F0 subunit 9|&lt;br /&gt;
Version = GeneID:6450130|&lt;br /&gt;
Length = 225 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Mitochondrion|Mitochondrion]]|&lt;br /&gt;
AP = Mitochondrion:263141..263365|&lt;br /&gt;
CDS = 263141..263365|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_011033:263141..263365&lt;br /&gt;
source=Rice_Japonica_Mitochondrion&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA &amp;lt;dnaseqindica&amp;gt;1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Mitochondrion]]&lt;br /&gt;
[[Category:Mitochondrion]&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=168285</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=168285"/>
				<updated>2014-05-11T14:38:58Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167975</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167975"/>
				<updated>2014-05-10T08:12:59Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167974</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167974"/>
				<updated>2014-05-10T08:09:59Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level.Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long.Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level.Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long.Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level.Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long.Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level.Extended observations to the cDNA sequence of atp9 demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The atp9 transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long.Transcription of the single-copy rice mitochondrial atp9 gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167972</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167972"/>
				<updated>2014-05-10T07:48:24Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt;&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167970</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167970"/>
				<updated>2014-05-10T07:42:21Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Knowledge extension */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria &amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt; and the addition of guanosine residues on paramyxovirus RNA &amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes &amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians &amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species &amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified &amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167969</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167969"/>
				<updated>2014-05-10T07:41:22Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same &amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively &amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167968</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167968"/>
				<updated>2014-05-10T07:40:59Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level &amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long &amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure &amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167967</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167967"/>
				<updated>2014-05-10T07:40:28Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167965</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167965"/>
				<updated>2014-05-10T07:34:46Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167964</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167964"/>
				<updated>2014-05-10T07:33:52Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167963</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167963"/>
				<updated>2014-05-10T07:31:02Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;, and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&lt;br /&gt;
&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167961</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167961"/>
				<updated>2014-05-10T07:28:07Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&lt;br /&gt;
&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167960</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167960"/>
				<updated>2014-05-10T07:23:08Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA 90:2370-2374.&lt;br /&gt;
&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.&lt;br /&gt;
&lt;br /&gt;
9.Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.&lt;br /&gt;
&lt;br /&gt;
10.Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.&lt;br /&gt;
&lt;br /&gt;
11.Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.&lt;br /&gt;
&lt;br /&gt;
12.Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.&lt;br /&gt;
&lt;br /&gt;
13.Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
14 Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167959</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167959"/>
				<updated>2014-05-10T07:13:25Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Knowledge extension */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians [12]. The mechanism by which the C-to-U changes occur is unknown.&lt;br /&gt;
&lt;br /&gt;
Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species [13]. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified [14]. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A. (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA, 90:2370-2374.&lt;br /&gt;
&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A. (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA, 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y. (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant, 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A. (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol., 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A. (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell, 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W. (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology, 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI. (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol, 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W. (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research, 18: 370.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167958</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167958"/>
				<updated>2014-05-10T06:55:05Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
===Knowledge extension===&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A. (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA, 90:2370-2374.&lt;br /&gt;
&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A. (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA, 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y. (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant, 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A. (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol., 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A. (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell, 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W. (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology, 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI. (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol, 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W. (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research, 18: 370.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167956</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167956"/>
				<updated>2014-05-10T06:46:36Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A. (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA, 90:2370-2374.&lt;br /&gt;
&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A. (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA, 93:11259–11263.&lt;br /&gt;
&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y. (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant, 30:657–662.&lt;br /&gt;
&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A. (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol., 214: 1-6.&lt;br /&gt;
&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A. (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell, 2: 1283-1290.&lt;br /&gt;
&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W. (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology, 22: 899-905.&lt;br /&gt;
&lt;br /&gt;
7.Ishikawa M, Kadowaki KI. (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol, 34(6):959–963.&lt;br /&gt;
&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W. (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research, 18: 370.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167955</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167955"/>
				<updated>2014-05-10T06:45:46Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A. (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA, 90:2370-2374.&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A. (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA, 93:11259–11263.&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y. (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant, 30:657–662.&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A. (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol., 214: 1-6.&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A. (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell, 2: 1283-1290.&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W. (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology, 22: 899-905.&lt;br /&gt;
7.Ishikawa M, Kadowaki KI. (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol, 34(6):959–963.&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W. (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research, 18: 370.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167954</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167954"/>
				<updated>2014-05-10T06:45:13Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A. (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA, 90:2370-2374.&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A. (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA, 93:11259–11263.&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y. (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant, 30:657–662.&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A. (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol., 214: 1-6.&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A. (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell, 2: 1283-1290.&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W. (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology, 22: 899-905.&lt;br /&gt;
7.Ishikawa M, Kadowaki KI. (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol, 34(6):959–963.&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W. (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research, 18: 370.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167953</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167953"/>
				<updated>2014-05-10T06:44:36Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A. (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA, 90:2370-2374.&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A. (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA, 93:11259–11263.&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y. (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant, 30:657–662.&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A. (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol., 214: 1-6.&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A. (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell, 2: 1283-1290.&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W. (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology, 22: 899-905.&lt;br /&gt;
7.Ishikawa M, Kadowaki KI. (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol, 34(6):959–963.&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W. (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research, 18: 370.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167952</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167952"/>
				<updated>2014-05-10T06:41:43Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Hernould M, Suharsono S, Litvak S, Araya A, Mouras A. (1993) Male sterility induction in transgenic tobacco plants with an unedited ATP9 mitochondrial gene from wheat. Proc Natl Acad Sci USA, 90:2370-2374.&lt;br /&gt;
2.Zabaleta E, Mouras A, Hernould M, Suharsono S, Araya A. (1996) Transgenic male-sterile plant induced by an unedited atp9 gene is restored to fertility by inhibiting its expression with antisense RNA. Proc Natl Acad Sci USA, 93:11259–11263.&lt;br /&gt;
3.Wei L, Yan ZX, Ding Y. (2008) Mitochondrial RNA editing of F0-ATPase subunit 9 gene (atp9) transcripts of Yunnan purple rice cytoplasmic male sterile line and its maintainer line. Acta Physiol Plant, 30:657–662.&lt;br /&gt;
4.Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A. (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol., 214: 1-6.&lt;br /&gt;
5.Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A. (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell, 2: 1283-1290.&lt;br /&gt;
6.Edward K, Kaleikau, Charles P, André, Virginia W. (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology, 22: 899-905.&lt;br /&gt;
7.Ishikawa M, Kadowaki KI. (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol, 34(6):959–963.&lt;br /&gt;
8.Edward K, Kaleikau, Charles P, Andre, Virginia W. (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research, 18: 370.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167951</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167951"/>
				<updated>2014-05-10T06:13:43Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France&lt;br /&gt;
Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland&lt;br /&gt;
Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland&lt;br /&gt;
Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany&lt;br /&gt;
Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA&lt;br /&gt;
Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167950</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167950"/>
				<updated>2014-05-10T06:04:46Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The three ''atp9'' transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same [7]. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.&lt;br /&gt;
The molecular weight of the rice atp9 protein is predicted to be 8.945kd. This is larger than in other species because of an additional 13 codons (compared to maize) at the 3' end of the gene. The nucleotide and amino acid sequence homologies to other sequenced plant atp9 genes (assuming no mRNA editing) are shown as follows:&lt;br /&gt;
Nucleotide sequence homology and Amino Acid sequence homology in rice show 96.4% and 94.6% identity in wheat, 95.6% and 98.7% in maize, 91.6% and 96.1% in petunia, 92.0% and 96.1% in tobacco, and 86.2% and 94.7% in pea, respectively [8].&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167948</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167948"/>
				<updated>2014-05-10T05:35:16Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial ''atp9'' gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level [4].&lt;br /&gt;
Extended observations to the cDNA sequence of ''atp9'' demonstrate the presence of partially modified mRNA molecules. One C-to-U conversion transforms an argininecodon into a stop codon, shortening the protein to the “standard” size when compared with other mitochondrial ATP 9. The analysis of subunit 9 by peptide sequencing and amino acid composition confirms these results. The ''atp9'' transcripts are modified by C-to-U changes in a process called RNA editing. Eight codons are involved in RNA editing: five lead to an amino acid change, two give no modification, and one transforms an Arg codon into astop codon. The editing process for wheat ATP 9 represents an important modification in genetic information, considering that the gene is only 243 nucleotides long [5].&lt;br /&gt;
Transcription of the single-copy rice mitochondrial ''atp9'' gene has been analyzed. A hypothesis shows that transcription initiates from this promoter to yield a 0.65 kb precursor mRNA and that this primary transcript is processed to a smaller 0.45 kb mature mRNA. This smaller mRNA ends at a putative double stem-loop structure [6].&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167947</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167947"/>
				<updated>2014-05-10T04:50:51Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of ''atp9'' transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167946</id>
		<title>Template:Mitochondrion</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Template:Mitochondrion&amp;diff=167946"/>
				<updated>2014-05-10T04:49:47Z</updated>
		
		<summary type="html">&lt;p&gt;Tangdanwiki: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
ATP synthase F0 subunit 9 (''atp9'') gene is known as the mitochondrial gene. Transgenic analysis of tobacco with an unedited ''atp9'' gene from wheat has revealed that the main effect of the unedited ''atp9'' expression in transgenic plants was male sterility[1], and it is also the case that the expression of the unedited gene was suppressed by using an antisense strategy resulting in the recovery of male fertility[2]. Thus, the protein ATP9 is clearly associated with male sterility.&lt;br /&gt;
The study of the unedited ''atp9'' transcript in rice mitochondria for the first time shows non-modified mRNA molecules may potentially influence male fertility through the accumulation of abnormal ATP9 or insufficient normal ATP9, which will influence the function of ATP synthase and then decrease the production of ATP. That is, unediting of atp9 transcript could be likely associated with cytoplasmic male sterility[3].&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
{| style=&amp;quot;background:#A1A3A6; width:85%;&amp;quot; border=&amp;quot;0&amp;quot;&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}}  |'''Gene Name'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{GeneName}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Description'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Description}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Version'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Version}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Length'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Length}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
!  {{table_heading_style}} |'''Definition'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Definition}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Source'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Source}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Chromosome'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Chromosome}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Location'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AP}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Sequence Coding Region'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{CDS}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Genome Context'''&lt;br /&gt;
||&lt;br /&gt;
{{{GCID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''Gene Structure &amp;lt;br&amp;gt;(RNA Editing)'''&lt;br /&gt;
||&lt;br /&gt;
{{{GSID}}}&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Protein Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{AA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; &lt;br /&gt;
! {{table_heading_style}} |'''Gene Sequence'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{DNA}}}'''&lt;br /&gt;
&lt;br /&gt;
|-style=&amp;quot;background:white; color:black&amp;quot; align=&amp;quot;center&amp;quot;&lt;br /&gt;
! {{table_heading_style}} |'''External Link(s)'''&lt;br /&gt;
||&lt;br /&gt;
'''{{{Link}}}'''&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Tangdanwiki</name></author>	</entry>

	</feed>