RiceWiki - User contributions [en]

Os10g0397400

2014-06-09T01:47:16Z

Tangwei: /* Evolution */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The rice (''Oryza sativa'') ''brassinosteroid (BR)-deficient dwarf2'' (''brd2'') is a loss-of-function allele of ''Dim/dwf1'', a gene homologous to the Arabidopsis ''DIM/DWF1''.The gene ''brd2'' mutation causes a semidwarf phenotype in the vegetative stage,with severe defects in internode elongation and panicle and seed development. Quantitative analysis of the endogenous sterol levels showed that ''brd2'' is defective in the conversion of 24-MC to CR, as are the Arabidopsis ''dim/dwf1'' and pea ''lkb'' mutants.

===Expression===
The ''brd2'' mutatant possess a semidwarf phenotype in the vegetative stage.Introduction of the wild-type ''Dim/dwf1'' gene into ''brd2'' restored the normal phenotype. Overproduction and repression of ''Dim/dwf1'' resulted in contrasting phenotypes, with repressors mimicking the ''brd2'' phenotype and overproducers having large stature with increased numbers of flowers and seeds.
[[File:Figure1.png|right|thumb|320px|'''Figure 1.''' ''Phenotype of the brd2 Mutant'']]
Recently, we identified a dwarf mutant, brd2,which displays the typical BR-deficient phenotype but also has characteristics not observed in the other mutants.Figure 1A shows the gross morphology of the mutant in an early vegetative stage. At this stage, the mutant plant (right) displays a moderate dwarf phenotype with a height 70% of the wild-type plant (left) but no other obvious abnormalities. However, as development progresses, the phenotype becomes more severe with characteristics typical of BR-related mutants: dark-green, erect leaves and shortened leaf sheaths. After flowering, the height of the plant reaches only 40% of the wild type (Figure 1B). We compared the internode elongation patterns of ''brd2'', the wild type, and other BR-deficient mutants (Figure 1C). In the wild type, the five uppermost internodes elongate; the internodes are numbered from top to bottom such that the uppermost, just below the panicle, is designated as the first internode (Figure 1C).By contrast, the three BR-deficient mutants show different elongation patterns:''d2-1'' has a specific inhibition in the second internode,''brd1-1'' is completely defective in internode elongation, and the first internode of ''brd2'' elongates, but the lower internodes do not (Figure 1C).''d61-2'', which is defective in the rice ''Bri1'' gene, also exhibits dwarfism with a lack of internode elongation except for the first internode.The ''brd2'' mutant flowers and produces malformed panicles, but the numbers of spikelets and rachis branches, as well as fertility, are severely reduced (Figure 1D). The lengths of the first and second rachis branches in the panicle are also severely reduced. In contrast with these severe defects, the neck internode of the mutant is longer than that of the wild type (Figure 1D).This phenomenon is a common feature in rice BR-related mutants because long neck internodes are also observed in ''d2'' and ''d61-1''. In addition, the ''brd2'' mutant also exhibits shortened grains (Figure 1E) and defective root elongation and development (Figure 1F). Although one seminal root develops normally during embryogenesis, after germination the seminal root elongates to only two-thirds of the wild-type root and formation of the crown root is inhibited, but lateral root formation is not as severely affected as crown root formation.

To isolate ''Brd2'' by positional cloning, we first performed rough mapping of ''brd2'' using 30 F2 progeny with the dwarf phenotype.Using 62 molecular markers, the ''brd2'' locus was mapped to rice chromosome 10 between 21.8 and 30.2 centimorgan. Because a gene homologous to Arabidopsis ''DIM1/DWF1'' is present in this area, we suspected that ''brd2'' was identical to ''Dim/dwf1'' (Figure 2A).The predicted Dim/dwf1 protein consists of 561 amino acids with 80% identity to the Arabidopsis ''DIM/DWF1'' sequence, and comparison of the genomic and full-length cDNA sequences showed that ''Dim/dwf1'' contains three predicted exons (Figure 2B). Direct sequencing of the ''brd2'' mutant allele revealed a single base deletion(guanine) in exon 2, which leads to a frameshift and produces a premature stop codon near the mutation site (Figure 2B). The mutation causes the loss of the majority of a conserved FAD binding domain and the C-terminal region in ''Dim/dwf1'' (Figure 2C).

We used gel blot analysis to examine the level of ''Dim/dwf1''transcripts in the mutant. RNA from 10-d-old light-grown wild-type and mutant seedlings was isolated and probed with the 800-bp 39 fragment of the ''Dim/dwf1'' cDNA. The ''Dim/dwf1''transcript was detected in wild-type seedlings but not in the mutant (Figure 2D). A wild-type genomic DNA fragment containing the entire ''Dim/dwf1'' was transformed into ''brd2'', which restored the wild-type phenotype in all plants that were resistant to the selection marker, hygromycin (Figure 2E, right). Transformation with the empty vector had no effect on the dwarf phenotype(Figure 2E, left).Based on these results, we predict that ''brd2'' is a knockout allele of ''Dim/dwf1''.[[File:Figure2.png|left|thumb|320px|'''Figure 2.''' ''Molecular Characterization of the ''brd2'' Mutation'']]

The ''Dim/dwf1'' expression pattern in various organs was studied using RNA gel blot analysis. ''Dim/dwf1'' transcripts were detected in all organs examined, albeit at different levels. The highest expression was in stems; intermediate expression was seen in roots, the shoot apex, and flowers; and expression
was low in leaves and panicles (Figure 2F). RNA gel blot analysis was also used to examine the effect of exogenously applied BL on ''Dim/dwf1'' expression (Figure 2G). Similar ''Dim/dwf1'' expression levels were observed in the wild type, the BR-deficient mutant ''brd1'', and ''d61-2'', which is partially defective in the BR
signaling pathway, and expression was not affected by treatment with BL. These results indicate that ''Dim/dwf1'' expression is not regulated by BL, in contrast with D2 and BRD1, which are downregulated by BL in a feedback manner.

===Evolution===
The ''brd2'' locus contains a single base deletion in the coding region of ''Dim/dwf1'',a homolog of Arabidopsis thaliana ''DIMINUTO/DWARF1''(''DIM/DWF1'').It is a knockout allele of ''Dim/dwf1''.
A knockout mutation, ''brd2'', of the rice gene encoding a protein similar to the Arabidopsis ''DIM/DWF1'' causes a semidwarf phenotype in the vegetative stage, with severe defects in internode elongation and panicle and seed development. Quantitative analysis of the endogenous sterol
levels showed that ''brd2'' is defective in the conversion of 24-MC to CR, as are the Arabidopsis ''dim/dwf1'' and pea ''lkb'' mutants.

==Labs working on this gene==
*BioScience and Biotechnology Center,Nagoya University,Chikusa,Nagoya 464-8601,Japan
*RIKEN,Institute of Physical and Chemical Research,Wako-shi,Saitama 351-0198,Japan
*Department of Chemistry,Joetsu University of Education,Joetsu-shi,Niigata 943-8512,Japan

==References==
*1.Zhi Hong,Miyako Ueguchi-Tanaka,Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.''The Plant Cell'',2005,17(8):2243-2254
*2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.''Nucleic Acids Res''.36 (DATABASE ISSUE),D1028-D1033(2008)
*3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.''Genome Res''.17(2),175-183(2007)

==Structured Information==
{{JaponicaGene|
GeneName = Os10g0397400|
Description = Similar to Cell elongation protein DIMINUTO (Cell elongation protein Dwarf1)|
Version = NM_001071069.1 GI:115481881 GeneID:4348555|
Length = 1378 bp|
Definition = Oryza sativa Japonica Group Os10g0397400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
AP = Chromosome 10:13717033..13718410|
CDS = 13717336..13717779,13718034..13718408|
GCID = <gbrowseImage1>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>gcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaa</cdnaseq>|
AA = <aaseq>ASKEEAKKKGNKINCVGWWFKPWFYQHAQTALKKGEFVEYIPTR EYYHRHTRCLYWEGKLILPFGDQFWFRFLLGWLMPPKVSLLKATQGESIRNYYHDNHV IQDMLVPLYKVGDALEFVHKEMEVYPLWLCPHRLYKLPVKTMVYPEPGFEHHHRQGDT SYAQMFTDVGVYYAPGAVLRGEEFNGALAVHRLEQWLIENHSYQPQYAVSELNEKDFW RMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRKTEKEVQEAEAAILEPAYADEA</aaseq>|
DNA = <dnaseqindica>632..1075#3..377#atgcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtgtgtttcacttcggatcgaatatttgatgtttaagtatcaaatatgcatttaaaacgaggcttttcaattatataactacttctagaaatgaatattccatgccataaattgttatgcttgcacatgcattctattacttatatctttgggcttgatgtaagttcacctaactattcttgtgcctgtaccaactattttagtgtactgcaatctactgctgcttacagttcactaataatttctgttattaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaatttcgttgagacctttgatggtttagtcgtccgggttttctccccattccaaatgggatttttcatctgaactatccttttgcttagaacttgatgtgcagtgtttgtagcactttgtaatcctgtcatcgtcgtccgtctgctcttggtacttctttcacccttgatcaagttgctgaacttagtcaggacttaagtggtatttaacccaagatctgaataattttgtggctactggactagttaatttcctcagctattaatttgagctgtagcatcagatgaggtgaactttagcaattg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071069.1 RefSeq:Os10g0397400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

Os10g0397400

2014-06-09T01:34:15Z

Tangwei: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The rice (''Oryza sativa'') ''brassinosteroid (BR)-deficient dwarf2'' (''brd2'') is a loss-of-function allele of ''Dim/dwf1'', a gene homologous to the Arabidopsis ''DIM/DWF1''.The gene ''brd2'' mutation causes a semidwarf phenotype in the vegetative stage,with severe defects in internode elongation and panicle and seed development. Quantitative analysis of the endogenous sterol levels showed that ''brd2'' is defective in the conversion of 24-MC to CR, as are the Arabidopsis ''dim/dwf1'' and pea ''lkb'' mutants.

===Expression===
The ''brd2'' mutatant possess a semidwarf phenotype in the vegetative stage.Introduction of the wild-type ''Dim/dwf1'' gene into ''brd2'' restored the normal phenotype. Overproduction and repression of ''Dim/dwf1'' resulted in contrasting phenotypes, with repressors mimicking the ''brd2'' phenotype and overproducers having large stature with increased numbers of flowers and seeds.
[[File:Figure1.png|right|thumb|320px|'''Figure 1.''' ''Phenotype of the brd2 Mutant'']]
Recently, we identified a dwarf mutant, brd2,which displays the typical BR-deficient phenotype but also has characteristics not observed in the other mutants.Figure 1A shows the gross morphology of the mutant in an early vegetative stage. At this stage, the mutant plant (right) displays a moderate dwarf phenotype with a height 70% of the wild-type plant (left) but no other obvious abnormalities. However, as development progresses, the phenotype becomes more severe with characteristics typical of BR-related mutants: dark-green, erect leaves and shortened leaf sheaths. After flowering, the height of the plant reaches only 40% of the wild type (Figure 1B). We compared the internode elongation patterns of ''brd2'', the wild type, and other BR-deficient mutants (Figure 1C). In the wild type, the five uppermost internodes elongate; the internodes are numbered from top to bottom such that the uppermost, just below the panicle, is designated as the first internode (Figure 1C).By contrast, the three BR-deficient mutants show different elongation patterns:''d2-1'' has a specific inhibition in the second internode,''brd1-1'' is completely defective in internode elongation, and the first internode of ''brd2'' elongates, but the lower internodes do not (Figure 1C).''d61-2'', which is defective in the rice ''Bri1'' gene, also exhibits dwarfism with a lack of internode elongation except for the first internode.The ''brd2'' mutant flowers and produces malformed panicles, but the numbers of spikelets and rachis branches, as well as fertility, are severely reduced (Figure 1D). The lengths of the first and second rachis branches in the panicle are also severely reduced. In contrast with these severe defects, the neck internode of the mutant is longer than that of the wild type (Figure 1D).This phenomenon is a common feature in rice BR-related mutants because long neck internodes are also observed in ''d2'' and ''d61-1''. In addition, the ''brd2'' mutant also exhibits shortened grains (Figure 1E) and defective root elongation and development (Figure 1F). Although one seminal root develops normally during embryogenesis, after germination the seminal root elongates to only two-thirds of the wild-type root and formation of the crown root is inhibited, but lateral root formation is not as severely affected as crown root formation.

To isolate ''Brd2'' by positional cloning, we first performed rough mapping of ''brd2'' using 30 F2 progeny with the dwarf phenotype.Using 62 molecular markers, the ''brd2'' locus was mapped to rice chromosome 10 between 21.8 and 30.2 centimorgan. Because a gene homologous to Arabidopsis ''DIM1/DWF1'' is present in this area, we suspected that ''brd2'' was identical to ''Dim/dwf1'' (Figure 2A).The predicted Dim/dwf1 protein consists of 561 amino acids with 80% identity to the Arabidopsis ''DIM/DWF1'' sequence, and comparison of the genomic and full-length cDNA sequences showed that ''Dim/dwf1'' contains three predicted exons (Figure 2B). Direct sequencing of the ''brd2'' mutant allele revealed a single base deletion(guanine) in exon 2, which leads to a frameshift and produces a premature stop codon near the mutation site (Figure 2B). The mutation causes the loss of the majority of a conserved FAD binding domain and the C-terminal region in ''Dim/dwf1'' (Figure 2C).

We used gel blot analysis to examine the level of ''Dim/dwf1''transcripts in the mutant. RNA from 10-d-old light-grown wild-type and mutant seedlings was isolated and probed with the 800-bp 39 fragment of the ''Dim/dwf1'' cDNA. The ''Dim/dwf1''transcript was detected in wild-type seedlings but not in the mutant (Figure 2D). A wild-type genomic DNA fragment containing the entire ''Dim/dwf1'' was transformed into ''brd2'', which restored the wild-type phenotype in all plants that were resistant to the selection marker, hygromycin (Figure 2E, right). Transformation with the empty vector had no effect on the dwarf phenotype(Figure 2E, left).Based on these results, we predict that ''brd2'' is a knockout allele of ''Dim/dwf1''.[[File:Figure2.png|left|thumb|320px|'''Figure 2.''' ''Molecular Characterization of the ''brd2'' Mutation'']]

The ''Dim/dwf1'' expression pattern in various organs was studied using RNA gel blot analysis. ''Dim/dwf1'' transcripts were detected in all organs examined, albeit at different levels. The highest expression was in stems; intermediate expression was seen in roots, the shoot apex, and flowers; and expression
was low in leaves and panicles (Figure 2F). RNA gel blot analysis was also used to examine the effect of exogenously applied BL on ''Dim/dwf1'' expression (Figure 2G). Similar ''Dim/dwf1'' expression levels were observed in the wild type, the BR-deficient mutant ''brd1'', and ''d61-2'', which is partially defective in the BR
signaling pathway, and expression was not affected by treatment with BL. These results indicate that ''Dim/dwf1'' expression is not regulated by BL, in contrast with D2 and BRD1, which are downregulated by BL in a feedback manner.

===Evolution===
The ''brd2'' locus contains a single base deletion in the coding region of ''Dim/dwf1'',a homolog of Arabidopsis thaliana ''DIMINUTO/DWARF1''(''DIM/DWF1'').It is a knockout allele of ''Dim/dwf1''.

==Labs working on this gene==
*BioScience and Biotechnology Center,Nagoya University,Chikusa,Nagoya 464-8601,Japan
*RIKEN,Institute of Physical and Chemical Research,Wako-shi,Saitama 351-0198,Japan
*Department of Chemistry,Joetsu University of Education,Joetsu-shi,Niigata 943-8512,Japan

==References==
*1.Zhi Hong,Miyako Ueguchi-Tanaka,Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.''The Plant Cell'',2005,17(8):2243-2254
*2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.''Nucleic Acids Res''.36 (DATABASE ISSUE),D1028-D1033(2008)
*3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.''Genome Res''.17(2),175-183(2007)

==Structured Information==
{{JaponicaGene|
GeneName = Os10g0397400|
Description = Similar to Cell elongation protein DIMINUTO (Cell elongation protein Dwarf1)|
Version = NM_001071069.1 GI:115481881 GeneID:4348555|
Length = 1378 bp|
Definition = Oryza sativa Japonica Group Os10g0397400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
AP = Chromosome 10:13717033..13718410|
CDS = 13717336..13717779,13718034..13718408|
GCID = <gbrowseImage1>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>gcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaa</cdnaseq>|
AA = <aaseq>ASKEEAKKKGNKINCVGWWFKPWFYQHAQTALKKGEFVEYIPTR EYYHRHTRCLYWEGKLILPFGDQFWFRFLLGWLMPPKVSLLKATQGESIRNYYHDNHV IQDMLVPLYKVGDALEFVHKEMEVYPLWLCPHRLYKLPVKTMVYPEPGFEHHHRQGDT SYAQMFTDVGVYYAPGAVLRGEEFNGALAVHRLEQWLIENHSYQPQYAVSELNEKDFW RMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRKTEKEVQEAEAAILEPAYADEA</aaseq>|
DNA = <dnaseqindica>632..1075#3..377#atgcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtgtgtttcacttcggatcgaatatttgatgtttaagtatcaaatatgcatttaaaacgaggcttttcaattatataactacttctagaaatgaatattccatgccataaattgttatgcttgcacatgcattctattacttatatctttgggcttgatgtaagttcacctaactattcttgtgcctgtaccaactattttagtgtactgcaatctactgctgcttacagttcactaataatttctgttattaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaatttcgttgagacctttgatggtttagtcgtccgggttttctccccattccaaatgggatttttcatctgaactatccttttgcttagaacttgatgtgcagtgtttgtagcactttgtaatcctgtcatcgtcgtccgtctgctcttggtacttctttcacccttgatcaagttgctgaacttagtcaggacttaagtggtatttaacccaagatctgaataattttgtggctactggactagttaatttcctcagctattaatttgagctgtagcatcagatgaggtgaactttagcaattg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071069.1 RefSeq:Os10g0397400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

File:Figure2.png

2014-06-09T01:22:15Z

Tangwei: uploaded a new version of "File:Figure2.png": Molecular Characterization of the brd2 Mutation

Os10g0397400

2014-06-09T01:05:58Z

Tangwei: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The rice (''Oryza sativa'') ''brassinosteroid (BR)-deficient dwarf2'' (''brd2'') is a loss-of-function allele of ''Dim/dwf1'', a gene homologous to the Arabidopsis ''DIM/DWF1''.The gene ''brd2'' mutation causes a semidwarf phenotype in the vegetative stage,with severe defects in internode elongation and panicle and seed development. Quantitative analysis of the endogenous sterol levels showed that ''brd2'' is defective in the conversion of 24-MC to CR, as are the Arabidopsis ''dim/dwf1'' and pea ''lkb'' mutants.

===Expression===
The ''brd2'' mutatant possess a semidwarf phenotype in the vegetative stage.Introduction of the wild-type ''Dim/dwf1'' gene into ''brd2'' restored the normal phenotype. Overproduction and repression of ''Dim/dwf1'' resulted in contrasting phenotypes, with repressors mimicking the ''brd2'' phenotype and overproducers having large stature with increased numbers of flowers and seeds.
[[File:Figure1.png|right|thumb|320px|'''Figure 1.''' ''Phenotype of the brd2 Mutant'']]
Recently, we identified a dwarf mutant, brd2,which displays the typical BR-deficient phenotype but also has characteristics not observed in the other mutants.Figure 1A shows the gross morphology of the mutant in an early vegetative stage. At this stage, the mutant plant (right) displays a moderate dwarf phenotype with a height 70% of the wild-type plant (left) but no other obvious abnormalities. However, as development progresses, the phenotype becomes more severe with characteristics typical of BR-related mutants: dark-green, erect leaves and shortened leaf sheaths. After flowering, the height of the plant reaches only 40% of the wild type (Figure 1B). We compared the internode elongation patterns of ''brd2'', the wild type, and other BR-deficient mutants (Figure 1C). In the wild type, the five uppermost internodes elongate; the internodes are numbered from top to bottom such that the uppermost, just below the panicle, is designated as the first internode (Figure 1C).By contrast, the three BR-deficient mutants show different elongation patterns:''d2-1'' has a specific inhibition in the second internode,''brd1-1'' is completely defective in internode elongation, and the first internode of ''brd2'' elongates, but the lower internodes do not (Figure 1C).''d61-2'', which is defective in the rice ''Bri1'' gene, also exhibits dwarfism with a lack of internode elongation except for the first internode.The ''brd2'' mutant flowers and produces malformed panicles, but the numbers of spikelets and rachis branches, as well as fertility, are severely reduced (Figure 1D). The lengths of the first and second rachis branches in the panicle are also severely reduced. In contrast with these severe defects, the neck internode of the mutant is longer than that of the wild type (Figure 1D).This phenomenon is a common feature in rice BR-related mutants because long neck internodes are also observed in ''d2'' and ''d61-1''. In addition, the ''brd2'' mutant also exhibits shortened grains (Figure 1E) and defective root elongation and development (Figure 1F). Although one seminal root develops normally during embryogenesis, after germination the seminal root elongates to only two-thirds of the wild-type root and formation of the crown root is inhibited, but lateral root formation is not as severely affected as crown root formation.

===Evolution===
The ''brd2'' locus contains a single base deletion in the coding region of ''Dim/dwf1'',a homolog of Arabidopsis thaliana ''DIMINUTO/DWARF1''(''DIM/DWF1'').It is a knockout allele of ''Dim/dwf1''.

==Labs working on this gene==
*BioScience and Biotechnology Center,Nagoya University,Chikusa,Nagoya 464-8601,Japan
*RIKEN,Institute of Physical and Chemical Research,Wako-shi,Saitama 351-0198,Japan
*Department of Chemistry,Joetsu University of Education,Joetsu-shi,Niigata 943-8512,Japan

==References==
*1.Zhi Hong,Miyako Ueguchi-Tanaka,Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.''The Plant Cell'',2005,17(8):2243-2254
*2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.''Nucleic Acids Res''.36 (DATABASE ISSUE),D1028-D1033(2008)
*3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.''Genome Res''.17(2),175-183(2007)

==Structured Information==
{{JaponicaGene|
GeneName = Os10g0397400|
Description = Similar to Cell elongation protein DIMINUTO (Cell elongation protein Dwarf1)|
Version = NM_001071069.1 GI:115481881 GeneID:4348555|
Length = 1378 bp|
Definition = Oryza sativa Japonica Group Os10g0397400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
AP = Chromosome 10:13717033..13718410|
CDS = 13717336..13717779,13718034..13718408|
GCID = <gbrowseImage1>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>gcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaa</cdnaseq>|
AA = <aaseq>ASKEEAKKKGNKINCVGWWFKPWFYQHAQTALKKGEFVEYIPTR EYYHRHTRCLYWEGKLILPFGDQFWFRFLLGWLMPPKVSLLKATQGESIRNYYHDNHV IQDMLVPLYKVGDALEFVHKEMEVYPLWLCPHRLYKLPVKTMVYPEPGFEHHHRQGDT SYAQMFTDVGVYYAPGAVLRGEEFNGALAVHRLEQWLIENHSYQPQYAVSELNEKDFW RMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRKTEKEVQEAEAAILEPAYADEA</aaseq>|
DNA = <dnaseqindica>632..1075#3..377#atgcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtgtgtttcacttcggatcgaatatttgatgtttaagtatcaaatatgcatttaaaacgaggcttttcaattatataactacttctagaaatgaatattccatgccataaattgttatgcttgcacatgcattctattacttatatctttgggcttgatgtaagttcacctaactattcttgtgcctgtaccaactattttagtgtactgcaatctactgctgcttacagttcactaataatttctgttattaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaatttcgttgagacctttgatggtttagtcgtccgggttttctccccattccaaatgggatttttcatctgaactatccttttgcttagaacttgatgtgcagtgtttgtagcactttgtaatcctgtcatcgtcgtccgtctgctcttggtacttctttcacccttgatcaagttgctgaacttagtcaggacttaagtggtatttaacccaagatctgaataattttgtggctactggactagttaatttcctcagctattaatttgagctgtagcatcagatgaggtgaactttagcaattg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071069.1 RefSeq:Os10g0397400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

Os10g0397400

2014-06-09T00:57:21Z

Tangwei: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The rice (''Oryza sativa'') ''brassinosteroid (BR)-deficient dwarf2'' (''brd2'') is a loss-of-function allele of ''Dim/dwf1'', a gene homologous to the Arabidopsis ''DIM/DWF1''.The gene ''brd2'' mutation causes a semidwarf phenotype in the vegetative stage,with severe defects in internode elongation and panicle and seed development. Quantitative analysis of the endogenous sterol levels showed that ''brd2'' is defective in the conversion of 24-MC to CR, as are the Arabidopsis ''dim/dwf1'' and pea ''lkb'' mutants.

===Expression===
The ''brd2'' mutatant possess a semidwarf phenotype in the vegetative stage.Introduction of the wild-type ''Dim/dwf1'' gene into ''brd2'' restored the normal phenotype. Overproduction and repression of ''Dim/dwf1'' resulted in contrasting phenotypes, with repressors mimicking the ''brd2'' phenotype and overproducers having large stature with increased numbers of flowers and seeds.
[[File:figure.png|frame|caption]]
Recently, we identified a dwarf mutant, brd2,which displays the typical BR-deficient phenotype but also has characteristics not observed in the other mutants.Figure 1A shows the gross morphology of the mutant in an early vegetative stage. At this stage, the mutant plant (right) displays a moderate dwarf phenotype with a height 70% of the wild-type plant (left) but no other obvious abnormalities. However, as development progresses, the phenotype becomes more severe with characteristics typical of BR-related mutants: dark-green, erect leaves and shortened leaf sheaths. After flowering, the height of the plant reaches only 40% of the wild type (Figure 1B). We compared the internode elongation patterns of ''brd2'', the wild type, and other BR-deficient mutants (Figure 1C). In the wild type, the five uppermost internodes elongate; the internodes are numbered from top to bottom such that the uppermost, just below the panicle, is designated as the first internode (Figure 1C).By contrast, the three BR-deficient mutants show different elongation patterns:''d2-1'' has a specific inhibition in the second internode,''brd1-1'' is completely defective in internode elongation, and the first internode of ''brd2'' elongates, but the lower internodes do not (Figure 1C).''d61-2'', which is defective in the rice ''Bri1'' gene, also exhibits dwarfism with a lack of internode elongation except for the first internode.The ''brd2'' mutant flowers and produces malformed panicles, but the numbers of spikelets and rachis branches, as well as fertility, are severely reduced (Figure 1D). The lengths of the first and second rachis branches in the panicle are also severely reduced. In contrast with these severe defects, the neck internode of the mutant is longer than that of the wild type (Figure 1D).This phenomenon is a common feature in rice BR-related mutants because long neck internodes are also observed in ''d2'' and ''d61-1''. In addition, the ''brd2'' mutant also exhibits shortened grains (Figure 1E) and defective root elongation and development (Figure 1F). Although one seminal root develops normally during embryogenesis, after germination the seminal root elongates to only two-thirds of the wild-type root and formation of the crown root is inhibited, but lateral root formation is not as severely affected as crown root formation.

===Evolution===
The ''brd2'' locus contains a single base deletion in the coding region of ''Dim/dwf1'',a homolog of Arabidopsis thaliana ''DIMINUTO/DWARF1''(''DIM/DWF1'').It is a knockout allele of ''Dim/dwf1''.

==Labs working on this gene==
*BioScience and Biotechnology Center,Nagoya University,Chikusa,Nagoya 464-8601,Japan
*RIKEN,Institute of Physical and Chemical Research,Wako-shi,Saitama 351-0198,Japan
*Department of Chemistry,Joetsu University of Education,Joetsu-shi,Niigata 943-8512,Japan

==References==
*1.Zhi Hong,Miyako Ueguchi-Tanaka,Shozo Fujioka et al.The Rice brassinosteroid-deficient dwarf2 Mutant, Defective in the Rice Homolog of Arabidopsis DIMINUTO/DWARF1, Is Rescued by the Endogenously Accumulated Alternative Bioactive Brassinosteroid, Dolichosterone.''The Plant Cell'',2005,17(8):2243-2254
*2.Tanaka,T., Antonio,B.A., Kikuchi,S. et al. The Rice Annotation Project Database (RAP-DB): 2008 update.''Nucleic Acids Res''.36 (DATABASE ISSUE),D1028-D1033(2008)
*3.Itoh,T., Tanaka,T., Barrero,R.A. et al. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana.''Genome Res''.17(2),175-183(2007)

==Structured Information==
{{JaponicaGene|
GeneName = Os10g0397400|
Description = Similar to Cell elongation protein DIMINUTO (Cell elongation protein Dwarf1)|
Version = NM_001071069.1 GI:115481881 GeneID:4348555|
Length = 1378 bp|
Definition = Oryza sativa Japonica Group Os10g0397400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
AP = Chromosome 10:13717033..13718410|
CDS = 13717336..13717779,13718034..13718408|
GCID = <gbrowseImage1>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>gcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaa</cdnaseq>|
AA = <aaseq>ASKEEAKKKGNKINCVGWWFKPWFYQHAQTALKKGEFVEYIPTR EYYHRHTRCLYWEGKLILPFGDQFWFRFLLGWLMPPKVSLLKATQGESIRNYYHDNHV IQDMLVPLYKVGDALEFVHKEMEVYPLWLCPHRLYKLPVKTMVYPEPGFEHHHRQGDT SYAQMFTDVGVYYAPGAVLRGEEFNGALAVHRLEQWLIENHSYQPQYAVSELNEKDFW RMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRKTEKEVQEAEAAILEPAYADEA</aaseq>|
DNA = <dnaseqindica>632..1075#3..377#atgcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtgtgtttcacttcggatcgaatatttgatgtttaagtatcaaatatgcatttaaaacgaggcttttcaattatataactacttctagaaatgaatattccatgccataaattgttatgcttgcacatgcattctattacttatatctttgggcttgatgtaagttcacctaactattcttgtgcctgtaccaactattttagtgtactgcaatctactgctgcttacagttcactaataatttctgttattaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaatttcgttgagacctttgatggtttagtcgtccgggttttctccccattccaaatgggatttttcatctgaactatccttttgcttagaacttgatgtgcagtgtttgtagcactttgtaatcctgtcatcgtcgtccgtctgctcttggtacttctttcacccttgatcaagttgctgaacttagtcaggacttaagtggtatttaacccaagatctgaataattttgtggctactggactagttaatttcctcagctattaatttgagctgtagcatcagatgaggtgaactttagcaattg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071069.1 RefSeq:Os10g0397400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

File:Figure1.png

2014-06-09T00:51:30Z

Tangwei: uploaded a new version of "File:Figure1.png": Phenotype of the brd2 Mutant

Os10g0397400

2014-05-28T11:37:32Z

Tangwei: /* Expression */

Os10g0397400

2014-05-28T11:31:50Z

Tangwei: /* Expression */

Os10g0397400

2014-05-28T11:22:50Z

Tangwei: /* Evolution */

Os10g0397400

2014-05-28T11:16:50Z

Tangwei: /* Evolution */

Os10g0397400

2014-05-28T11:07:38Z

Tangwei: /* References */

Os10g0397400

2014-05-28T11:05:29Z

Tangwei: /* References */

Os10g0397400

2014-05-28T10:52:03Z

Tangwei: /* Labs working on this gene */

Os10g0397400

2014-05-28T10:47:58Z

Tangwei: /* Function */

Os10g0397400

2014-05-28T10:35:02Z

Tangwei: /* Function */

Os10g0397400

2014-05-28T10:23:30Z

Tangwei: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.
brd2 contains low levels of common
6-oxo-type BRs, the severity of the brd2 phenotype is much milder than brd1 mutants and most similar to d2 and d11, which
show a semidwarf phenotype at the young seedling stage. Quantitative analysis suggested that in brd2, the 24-methylene
BR biosynthesis pathway is activated and the uncommon BR, dolichosterone (DS), is produced. DS enhances the rice
lamina joint bending angle, rescues the brd1 dwarf phenotype, and inhibits root elongation, indicating that DS is a bioactive
BR in rice.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==
{{JaponicaGene|
GeneName = Os10g0397400|
Description = Similar to Cell elongation protein DIMINUTO (Cell elongation protein Dwarf1)|
Version = NM_001071069.1 GI:115481881 GeneID:4348555|
Length = 1378 bp|
Definition = Oryza sativa Japonica Group Os10g0397400, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 10|Chromosome 10]]|
AP = Chromosome 10:13717033..13718410|
CDS = 13717336..13717779,13718034..13718408|
GCID = <gbrowseImage1>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008403:13717033..13718410
source=RiceChromosome10
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>gcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaa</cdnaseq>|
AA = <aaseq>ASKEEAKKKGNKINCVGWWFKPWFYQHAQTALKKGEFVEYIPTR EYYHRHTRCLYWEGKLILPFGDQFWFRFLLGWLMPPKVSLLKATQGESIRNYYHDNHV IQDMLVPLYKVGDALEFVHKEMEVYPLWLCPHRLYKLPVKTMVYPEPGFEHHHRQGDT SYAQMFTDVGVYYAPGAVLRGEEFNGALAVHRLEQWLIENHSYQPQYAVSELNEKDFW RMFDASHYEHCRQKYGAVGTFMSVYYKSKKGRKTEKEVQEAEAAILEPAYADEA</aaseq>|
DNA = <dnaseqindica>632..1075#3..377#atgcttccaaagaagaggcaaagaagaagggcaataagatcaactgtgtcgggtggtggttcaagccttggttttaccaacatgctcagacagcactcaagaagggtgagtttgtggagtacattccaacaagagagtactaccaccgtcacacccggtgtctgtactgggaggggaagctgatcttgccattcggcgaccaattctggttcaggttcctcttgggctggctgatgccaccaaaggtgtctctgctcaaggccacacagggtgaatctatcaggaattactaccatgacaaccatgtgattcaagacatgctggttcccttgtacaaagttggagatgctcttgagtttgttcacaaggaaatggaggtgtgtttcacttcggatcgaatatttgatgtttaagtatcaaatatgcatttaaaacgaggcttttcaattatataactacttctagaaatgaatattccatgccataaattgttatgcttgcacatgcattctattacttatatctttgggcttgatgtaagttcacctaactattcttgtgcctgtaccaactattttagtgtactgcaatctactgctgcttacagttcactaataatttctgttattaggtttatccactgtggctgtgcccgcaccggctctacaagctccctgtgaaaaccatggtgtacccagagcctggctttgagcaccaccacaggcaaggtgacactagctatgcccagatgttcaccgatgttggtgtgtactatgctcctggtgctgtcctgaggggcgaggagttcaatggcgctctagctgtccacaggctggagcagtggctgattgagaaccacagctaccagccacagtacgctgtatctgagctcaacgagaaggacttctggaggatgtttgatgcttctcactacgagcattgccgccaaaagtatggtgccgtcggtacctttatgagcgtctactacaagtccaagaagggaaggaagactgagaaggaggtgcaggaagccgaggccgccatcctcgagccagcctacgctgatgaggcgtaatttcgttgagacctttgatggtttagtcgtccgggttttctccccattccaaatgggatttttcatctgaactatccttttgcttagaacttgatgtgcagtgtttgtagcactttgtaatcctgtcatcgtcgtccgtctgctcttggtacttctttcacccttgatcaagttgctgaacttagtcaggacttaagtggtatttaacccaagatctgaataattttgtggctactggactagttaatttcctcagctattaatttgagctgtagcatcagatgaggtgaactttagcaattg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001071069.1 RefSeq:Os10g0397400]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]