http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=WangjinlongRiceWiki - User contributions [en]2026-05-24T12:56:45ZUser contributionsMediaWiki 1.30.0https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=182905Os03g02339002014-06-09T15:56:38Z<p>Wangjinlong: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Introduction===<br />
<br />
Hemoglobins (Hbs) with unknown functions have been found in most organisms. A hypothetical role common tomany of them is nitric oxide (NO) scavenging, which is grounded in the established contribution of Hbs to nitric oxide dioxygenase (HbO2 + NO == metHb + NO3-) (NOD) activity in bacterial flavohemoglobins, the effects of blood cell Hb on NO metabolism, and the general reactivity of oxy, deoxy, and ferric hemoglobins with NO. In plants, the NOD function for Hbs is supported by increases in the level of Hb expression in response to nitrate, nitrite, and nitric oxide, improvements in NO scavenging ability in plants overexpressing Hb, decreases in the levels of NO-sensitive enzymes in plants with down regulated Hb, and the encouragement of cell growth by cyanobacterial Hb in the presence of high concentrations of reactive nitrogen species.<br />
<br />
The metabolism of nitrogen is quite different in autotrophs such as plants and cyanobacteria, which must assimilate nitrogen through the reduction of nitrate under conditions ranging from<br />
normoxic to anoxic. In these organisms, nitrate and nitrite can accumulate to very high (millimolar) concentrations,particularly when oxygen concentrations are low.Such conditions are associated with plant Hb upregulation,and thus, reactions of nitrate and nitrite with plant and cyanobacterial Hbs are potentially physiologically significant.<br />
<br />
<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
====Rice nsHb1 have hypothetical roles in nitrogen metabolism====<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |center|" Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
====Rice nsHb1 could serve as anaerobic nitrite reductases in vivo====<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |center|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
====Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium==== <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref3' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |center|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref3'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
These Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. The deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name='ref1' /><br />
<br />
deoxyferrous rice nsHb1 and SynHb convert HA specifically to ammonium at rates 100−2500 times faster than the animal Hbs. These results complement those of nitrite reduction by rice nsHb1 and SynHb and support the hypothesis that they serve as an alternative means of reducing nitrogen metabolites, recycling NADH produced during anaerobic glycolysis, and continuing ammonium production during hypoxia.<ref name='ref3' /><br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=182889Os03g02339002014-06-09T15:52:34Z<p>Wangjinlong: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Introduction===<br />
<br />
Hemoglobins (Hbs) with unknown functions have been found in most organisms. A hypothetical role common tomany of them is nitric oxide (NO) scavenging, which is grounded in the established contribution of Hbs to nitric oxide dioxygenase (HbO2 + NO == metHb + NO3-) (NOD) activity in bacterial flavohemoglobins, the effects of blood cell Hb on NO metabolism, and the general reactivity of oxy, deoxy, and ferric hemoglobins with NO. In plants, the NOD function for Hbs is supported by increases in the level of Hb expression in response to nitrate, nitrite, and nitric oxide, improvements in NO scavenging ability in plants overexpressing Hb, decreases in the levels of NO-sensitive enzymes in plants with down regulated Hb, and the encouragement of cell growth by cyanobacterial Hb in the presence of high concentrations of reactive nitrogen species.<br />
<br />
The metabolism of nitrogen is quite different in autotrophs such as plants and cyanobacteria, which must assimilate nitrogen through the reduction of nitrate under conditions ranging from<br />
normoxic to anoxic. In these organisms, nitrate and nitrite can accumulate to very high (millimolar) concentrations,particularly when oxygen concentrations are low.Such conditions are associated with plant Hb upregulation,and thus, reactions of nitrate and nitrite with plant and cyanobacterial Hbs are potentially physiologically significant.<br />
<br />
<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
====Rice nsHb1 have hypothetical roles in nitrogen metabolism====<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |center|" Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
====Rice nsHb1 could serve as anaerobic nitrite reductases in vivo====<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |center|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
====Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium==== <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref3' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |center|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref3'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
deoxyferrous rice nsHb1 and SynHb convert HA specifically to ammonium at rates 100−2500 times faster than the animal Hbs. These results complement those of nitrite reduction by rice nsHb1 and SynHb and support the hypothesis that they serve as an alternative means of reducing nitrogen metabolites, recycling NADH produced during anaerobic glycolysis, and continuing ammonium production during hypoxia.<ref name='ref3' /><br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=182886Os03g02339002014-06-09T15:51:49Z<p>Wangjinlong: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Introduction===<br />
<br />
Hemoglobins (Hbs) with unknown functions have been found in most organisms. A hypothetical role common tomany of them is nitric oxide (NO) scavenging, which is grounded in the established contribution of Hbs to nitric oxide dioxygenase (HbO2 + NO == metHb + NO3-) (NOD) activity in bacterial flavohemoglobins, the effects of blood cell Hb on NO metabolism, and the general reactivity of oxy, deoxy, and ferric hemoglobins with NO. In plants, the NOD function for Hbs is supported by increases in the level of Hb expression in response to nitrate, nitrite, and nitric oxide, improvements in NO scavenging ability in plants overexpressing Hb, decreases in the levels of NO-sensitive enzymes in plants with down regulated Hb, and the encouragement of cell growth by cyanobacterial Hb in the presence of high concentrations of reactive nitrogen species.<br />
<br />
The metabolism of nitrogen is quite different in autotrophs such as plants and cyanobacteria, which must assimilate nitrogen through the reduction of nitrate under conditions ranging from<br />
normoxic to anoxic. In these organisms, nitrate and nitrite can accumulate to very high (millimolar) concentrations,particularly when oxygen concentrations are low.Such conditions are associated with plant Hb upregulation,and thus, reactions of nitrate and nitrite with plant and cyanobacterial Hbs are potentially physiologically significant.<br />
<br />
<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
====Rice nsHb1 have hypothetical roles in nitrogen metabolism====<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |center|" Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
====Rice nsHb1 could serve as anaerobic nitrite reductases in vivo====<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |center|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
====Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium==== <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref3' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |center|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref3'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
deoxyferrous rice nsHb1 and SynHb convert HA specifically to ammonium at rates 100−2500 times faster than the animal Hbs. These results complement those of nitrite reduction by rice nsHb1 and SynHb and support the hypothesis that they serve as an alternative means of reducing nitrogen metabolites, recycling NADH produced during anaerobic glycolysis, and continuing ammonium production during hypoxia.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=182869Os03g02339002014-06-09T15:45:20Z<p>Wangjinlong: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Introduction===<br />
<br />
Hemoglobins (Hbs) with unknown functions have been found in most organisms. A hypothetical role common tomany of them is nitric oxide (NO) scavenging, which is grounded in the established contribution of Hbs to nitric oxide dioxygenase (HbO2 + NO == metHb + NO3-) (NOD) activity in bacterial flavohemoglobins, the effects of blood cell Hb on NO metabolism, and the general reactivity of oxy, deoxy, and ferric hemoglobins with NO. In plants, the NOD function for Hbs is supported by increases in the level of Hb expression in response to nitrate, nitrite, and nitric oxide, improvements in NO scavenging ability in plants overexpressing Hb, decreases in the levels of NO-sensitive enzymes in plants with down regulated Hb, and the encouragement of cell growth by cyanobacterial Hb in the presence of high concentrations of reactive nitrogen species.<br />
<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
====Rice nsHb1 have hypothetical roles in nitrogen metabolism====<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |center|" Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
====Rice nsHb1 could serve as anaerobic nitrite reductases in vivo====<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |center|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
====Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium==== <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref3' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |center|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref3'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=182865Os03g02339002014-06-09T15:44:07Z<p>Wangjinlong: /* Annotated Information */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Introduction===<br />
<br />
Hemoglobins (Hbs) with unknown functions have been found in most organisms. A hypothetical role common tomany of them is nitric oxide (NO) scavenging, which is grounded in the established contribution of Hbs to nitric oxide dioxygenase (HbO2 + NO == metHb + NO3-) (NOD) activity in bacterial flavohemoglobins, the effects of blood cell Hb on NO metabolism, and the general reactivity of oxy, deoxy, and ferric hemoglobins with NO. In plants, the NOD function for Hbs is supported by increases in the level of Hb expression in response to nitrate, nitrite, and nitric oxide, improvements in NO scavenging ability in plants overexpressing Hb, decreases in the levels of NO-sensitive enzymes in plants with down regulated Hb, and the encouragement of cell growth by cyanobacterial Hb in the presence of high concentrations of reactive nitrogen species.<br />
<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
====Rice nsHb1 have hypothetical roles in nitrogen metabolism====<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |center|thumb|'' Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
====Rice nsHb1 could serve as anaerobic nitrite reductases in vivo====<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |center|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
====Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium==== <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref3' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |center|thumb|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref3'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179926Os03g02339002014-06-07T07:43:16Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |center|thumb|'' Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |center|thumb||"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref3' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |center|thumb|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref3'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179923Os03g02339002014-06-07T07:42:11Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |right|thumb|150px|'' Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |right|thumb|150px|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref2' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |center|thumb|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref2'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179920Os03g02339002014-06-07T07:41:11Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |right|thumb|150px|'' Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |right|thumb|150px|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.GIF |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref2' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.GIF |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref2'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179918Os03g02339002014-06-07T07:40:34Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
<br />
[[File: nshb1.GIF |right|thumb|150px|'' Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 <ref name="ref1" />).'']]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
<br />
[[File: nshb1_Reactivity.GIF |right|thumb|150px|"Reactivity of nitrite and nitrate with other forms of rice nsHb1, SynHb, and Mb. (from reference <ref name="ref1" />)."]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.gif |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref2' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.gif |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref2'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179916Os03g02339002014-06-07T07:34:23Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
[[File:nshb1.gif]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
[[File:nshb1_Reactivity.gif]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.gif |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref2' />)"]]<br />
<br />
[[File:Hydroxylamine_reduction.gif |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref2'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179914Os03g02339002014-06-07T07:33:38Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
[[File:nshb1.gif]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
[[File:nshb1_Reactivity.gif]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.gif |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref2' />)"]]<br />
<br />
[[Hydroxylamine_reduction.gif |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref2'/>)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179910Os03g02339002014-06-07T07:32:05Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
[[File:nshb1.gif]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
[[File:nshb1_Reactivity.gif]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.gif |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref2' />)"]]<br />
<br />
[[Hydroxylamine_reduction.GIF|right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref2' />)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179907Os03g02339002014-06-07T07:27:06Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
[[File:nshb1.jpg]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
[[File:nshb1_Reactivity.jpg]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.jpg |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name='ref2' />)"]]<br />
<br />
[[hydroxylamine_reduction.jpg |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name='ref2' />)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179902Os03g02339002014-06-07T07:25:16Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<ref name="ref1"/><br />
[[File:nshb1.jpg]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<ref name="ref2"/><br />
[[File:nshb1_Reactivity.jpg]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<ref name="ref3"/><br />
<br />
[[File:Reaction_HA.jpg |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name="ref2" />)"]]<br />
<br />
[[hydroxylamine_reduction.jpg |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name="ref2" />)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179898Os03g02339002014-06-07T07:23:12Z<p>Wangjinlong: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
[[File:nshb1.jpg]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
[[File:nshb1_Reactivity.jpg]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
[[File:Reaction_HA.jpg |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name="ref2" />)"]]<br />
<br />
[[hydroxylamine_reduction.jpg |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name="ref2" />)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<references><br />
<ref name="ref1"> <br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179894Os03g02339002014-06-07T07:20:57Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
[[File:nshb1.jpg]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
[[File:nshb1_Reactivity.jpg]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
[[File:Reaction_HA.jpg |right|thumb|150px|"Reaction of deoxyferrous Hbs with HA(from reference <ref name="ref2" />)"]]<br />
<br />
[[hydroxylamine_reduction.jpg |right|thumb|150px|"Relative rates of hydroxylamine reduction by different Hbs(from reference <ref name="ref2" />)"]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
<br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179888Os03g02339002014-06-07T07:18:43Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
[[File:nshb1.jpg]]<br />
<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
[[File:nshb1_Reactivity.jpg]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
[[File:Reaction_HA.jpg |right|thumb|150px|'' Reaction of deoxyferrous Hbs with HA(from reference <ref name="ref2" />).'']]<br />
<br />
[[hydroxylamine_reduction.jpg |right|thumb|150px|'' Relative rates of hydroxylamine reduction by different Hbs.(from reference <ref name="ref2" />).'']]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
<br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179882Os03g02339002014-06-07T07:11:14Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
[[File:nshb1.jpg]]<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
[[File:nshb1_Reactivity.jpg]]<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
[[File:Reaction_HA.jpg]]<br />
[[hydroxylamine_reduction.jpg]]<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
<br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Reaction_HA.GIF&diff=179871File:Reaction HA.GIF2014-06-07T07:04:53Z<p>Wangjinlong: Reaction of deoxyferrous Hbs with HA: (A) rice nsHb1 (16
μM); (B) SynHb (16 μM); (C) Mb (24 μM). All titrations exhibit
sharp deviations from linearity at [HA]/[Hb] = 0.5, at which point the
titration reaches 100% completion. This shows that the reacti</p>
<hr />
<div>Reaction of deoxyferrous Hbs with HA: (A) rice nsHb1 (16<br />
μM); (B) SynHb (16 μM); (C) Mb (24 μM). All titrations exhibit<br />
sharp deviations from linearity at [HA]/[Hb] = 0.5, at which point the<br />
titration reaches 100% completion. This shows that the reactions<br />
proceed by a mechanism in which two Hbs are oxidized by one HA. In<br />
each case the spectral transition is from deoxyferrous Hb2+ to ferric<br />
Hb3+.</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Hydroxylamine_reduction.GIF&diff=179866File:Hydroxylamine reduction.GIF2014-06-07T07:02:38Z<p>Wangjinlong: Relative rates of hydroxylamine reduction by different Hbs.
(A) Time courses for the reaction of deoxyferrous rice nsHb1, SynHb,
Mb, Cgb, and Ngb with 150 μM HA, as measured by the oxidation of
the Hb (as in Figure 1). (B) Dependence of the reaction rate</p>
<hr />
<div>Relative rates of hydroxylamine reduction by different Hbs.<br />
(A) Time courses for the reaction of deoxyferrous rice nsHb1, SynHb,<br />
Mb, Cgb, and Ngb with 150 μM HA, as measured by the oxidation of<br />
the Hb (as in Figure 1). (B) Dependence of the reaction rate constant<br />
(kobs) on [HA] for rice nsHb1, SynHb, and Mb, demonstrating that<br />
reaction rates for rice nsHb1 and SynHb are 2 orders of magnitude<br />
faster than Mb, having pseudo-first-order rates of 25 and 28 mM−1 s−1,<br />
respectively, compared to 0.25 mM−1 s−1.</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Nshb1_Reactivity.GIF&diff=179861File:Nshb1 Reactivity.GIF2014-06-07T06:58:51Z<p>Wangjinlong: Reactivity of nitrite and nitrate with other forms of rice
nsHb1, SynHb, and Mb. The deoxyferrous (Hb), CO (HbCO), ferric
(metHb), and oxy (oxyHb) forms of each Hb were reacted with 100 μM
nitrite, and the reaction progress was measured after 300 s. Each</p>
<hr />
<div>Reactivity of nitrite and nitrate with other forms of rice<br />
nsHb1, SynHb, and Mb. The deoxyferrous (Hb), CO (HbCO), ferric<br />
(metHb), and oxy (oxyHb) forms of each Hb were reacted with 100 μM<br />
nitrite, and the reaction progress was measured after 300 s. Each<br />
deoxyferrous Hb was also reacted with 100 μM nitrate over the same<br />
period of time. In each case, only the reaction of deoxyferrous Hb with<br />
nitrite shows any appreciable reaction</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Nshb1.GIF&diff=179860File:Nshb1.GIF2014-06-07T06:56:25Z<p>Wangjinlong: Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 (A) and SynHb (B) oxidation are shown at
30 s intervals following the addition of 50 μM sodium nitrite. Panels C and D show ferric and ferrous nitrosyl (HbNO) </p>
<hr />
<div>Reaction of rice nsHb1 and SynHb with nitrite. The spectral changes associated with Rice nsHb1 (A) and SynHb (B) oxidation are shown at<br />
30 s intervals following the addition of 50 μM sodium nitrite. Panels C and D show ferric and ferrous nitrosyl (HbNO) reference spectra, the final<br />
experimental spectrum, and a sum of the reference spectra to determine the contribution of each species to the final experimental spectrum for rice<br />
nsHb1 and SynHb, respectively.</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179769Os03g02339002014-06-07T04:56:09Z<p>Wangjinlong: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
<br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179767Os03g02339002014-06-07T04:54:58Z<p>Wangjinlong: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<br />
<br />
<ref name="ref1"><br />
<br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
<br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
<br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179765Os03g02339002014-06-07T04:54:01Z<p>Wangjinlong: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<br />
<br />
<ref name="ref1"><br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179764Os03g02339002014-06-07T04:53:30Z<p>Wangjinlong: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
<br />
<references><br />
<ref name="ref1"><br />
1. Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
</ref><br />
<ref name="ref2"><br />
2. Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
</ref><br />
<ref name="ref3"><br />
3. Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
</ref><br />
</references><br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179753Os03g02339002014-06-07T04:49:20Z<p>Wangjinlong: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
[[1]]Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
[[2]]Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
[[3]]Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179747Os03g02339002014-06-07T04:46:29Z<p>Wangjinlong: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Department of Biochemistry, Biophysics, and Molecular Biology, Iowa State University, United States<br />
<br />
Department of Biochemistry, The George W. Beadle Center, University of Nebraska-Lincoln, USA<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179728Os03g02339002014-06-07T04:31:38Z<p>Wangjinlong: /* Labs working on this gene */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179727Os03g02339002014-06-07T04:31:10Z<p>Wangjinlong: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1;<br />
Alternative name(s):ORYsa、 GLB1a、 rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179724Os03g02339002014-06-07T04:30:29Z<p>Wangjinlong: /* Expression */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Protein names <br />
<br />
Recommended name:Non-symbiotic hemoglobin 1<br />
Alternative name(s):ORYsa GLB1a rHb1<br />
<br />
Expressed in coleoptiles, embryos, leaves and roots By flooding and etiolating but not by oxidative, nitrosative or hormonal stresses.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179716Os03g02339002014-06-07T04:23:30Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
<br />
May not function as an oxygen storage or transport protein, but might act as an oxygen sensor or play a role in electron transfer, possibly to a bound oxygen molecule. Has an unusually high affinity for O2 because of a very low dissociation constant.<br />
<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179708Os03g02339002014-06-07T03:52:39Z<p>Wangjinlong: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.<br />
<br />
cd01040: globin [http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179707Os03g02339002014-06-07T03:51:45Z<p>Wangjinlong: /* Evolution */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Globins are heme proteins, which bind and transport oxygen. This family summarizes a diverse set of homologous protein domains, including: (1) tetrameric vertebrate hemoglobins, which are the major protein component of erythrocytes and transport oxygen in the bloodstream, (2) microorganismal flavohemoglobins, which are linked to C-terminal FAD-dependend reductase domains, (3) homodimeric bacterial hemoglobins, such as from Vitreoscilla, (4) plant leghemoglobins (symbiotic hemoglobins, involved in nitrogen metabolism in plant rhizomes), (5) plant non-symbiotic hexacoordinate globins and hexacoordinate globins from bacteria and animals, such as neuroglobin, (6) invertebrate hemoglobins, which may occur in tandem-repeat arrangements, and (7) monomeric myoglobins found in animal muscle tissue.[http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01040]<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179689Os03g02339002014-06-07T03:21:53Z<p>Wangjinlong: /* References */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Plant and cyanobacterial hemoglobins reduce nitrite to nitric oxide under anoxic conditions.<br />
Sturms R, et al. Biochemistry, 2011 May 17. PMID 21495624<br />
<br />
Role of phenylalanine B10 in plant nonsymbiotic hemoglobins.<br />
Smagghe BJ, et al. Biochemistry, 2006 Aug 15. PMID 16893175<br />
<br />
Hydroxylamine reduction to ammonium by plant and cyanobacterial hemoglobins.<br />
Sturms R, et al. Biochemistry, 2011 Dec 20. PMID 22080728<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179686Os03g02339002014-06-07T03:18:01Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
<br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179684Os03g02339002014-06-07T03:17:03Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
1、Rice nsHb1 have hypothetical roles in nitrogen metabolism<br />
The reactions of class 1 rice nonsymbiotic Hb (rice nsHb1) with nitrate and nitrite suggested that these Hbs are not oxygen transporters and have hypothetical roles in nitrogen metabolism. And the deoxyferrous forms of each react rapidly with nitrite to form ferric Hb and ferrous-nitrosyl Hb in a fixed ratio, indicative of the production of nitric oxide from the reduction of nitrite by ferrous Hb.<br />
<br />
2、Rice nsHb1 could serve as anaerobic nitrite reductases in vivo<br />
Rate constants for nitrite reduction by a ferrous plant hemoglobin (rice nonsymbiotic hemoglobin 1) are more than 10 times faster than those observed for animal hemoglobins. These rate constants, along with the relatively high concentrations of nitrite present during hypoxia, suggest that plant hemoglobins could serve as anaerobic nitrite reductases in vivo .<br />
<br />
3、Rice nsHb1 catalyze the reduction of hydroxylamine to ammonium <br />
Class 1 rice nonsymbiotic hemoglobin (rice nsHb1) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support the hypothesis that plant contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179642Os03g02339002014-06-07T02:19:32Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
gene name Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)<br />
class 1 rice nonsymbiotic hemoglobin (rice nsHb1) and the hemoglobin from the cyanobacterium Synechocystis (SynHb) catalyze the reduction of hydroxylamine to ammonium at rates 100−2500 times faster than animal hemoglobins including myoglobin, neuroglobin, cytoglobin, and blood cell hemoglobin. These results support<br />
the hypothesis that plant and cyanobacterial hemoglobins contribute to anaerobic nitrogen metabolism in support of anaerobic respiration and survival during hypoxia.<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179635Os03g02339002014-06-07T02:03:31Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
gene name Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlonghttps://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0233900&diff=179633Os03g02339002014-06-07T02:03:03Z<p>Wangjinlong: /* Function */</p>
<hr />
<div>Please input one-sentence summary here.<br />
<br />
==Annotated Information==<br />
===Function===<br />
Please input function information here.<br />
gene name Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)<br />
<br />
===Expression===<br />
Please input expression information here.<br />
<br />
===Evolution===<br />
Please input evolution information here.<br />
<br />
You can also add sub-section(s) at will.<br />
<br />
==Labs working on this gene==<br />
Please input related labs here.<br />
<br />
==References==<br />
Please input cited references here.<br />
<br />
==Structured Information==<br />
{{JaponicaGene|<br />
GeneName = Os03g0233900|<br />
Description = Non-symbiotic hemoglobin 1 (rHb1) (ORYsa GLB1a)|<br />
Version = NM_001056011.1 GI:115451750 GeneID:4332166|<br />
Length = 1125 bp|<br />
Definition = Oryza sativa Japonica Group Os03g0233900, complete gene.|<br />
Source = Oryza sativa Japonica Group<br />
<br />
ORGANISM Oryza sativa Japonica Group<br />
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br />
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br />
clade; Ehrhartoideae; Oryzeae; Oryza.<br />
|<br />
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|<br />
AP = Chromosome 3:7142189..7143313|<br />
CDS = 7142289..7142416,7142533..7142647,7142743..7142859,7142975..7143115|<br />
GCID = <gbrowseImage1><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage1>|<br />
GSID = <gbrowseImage2><br />
name=NC_008396:7142189..7143313<br />
source=RiceChromosome03<br />
preset=GeneLocation<br />
</gbrowseImage2>|<br />
CDNA = <cdnaseq>atggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatgacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtga</cdnaseq>|<br />
AA = <aaseq>MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKI FEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTL KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQ EMKPAE</aaseq>|<br />
DNA = <dnaseqindica>101..228#345..459#555..671#787..927#agatcgaaaccagcagttgttttcagagcccagctagctctcgatcatttgttacagagaaattgatcaaagcaggaaattaaccagctgtcaggaagcaatggctctcgtggaggataacaatgccgtagcggtgagcttcagcgaggagcaggaggcgctggtgctcaagtcatgggcgatcttgaagaaggattccgccaatattgccctccgcttcttcttgaagtatgtacatgcgtgttactaccatttctctttttgcggaatcagagattgggtttgtgaagcattaaattgagcaatgcatttcgctgatacatgtgtgtctgattgtgttgtaggatcttcgaggtcgcgccgtcggcgagccagatgttctcgttcctgcgcaactccgacgtgccgctcgagaagaaccccaagctcaagacccacgccatgtccgtcttcgtcatggtaatactaccatcattatttcaggcaagtaaatttgttgtggtagtagacactgacagaatgtgtgcgtgcgtcgcgatcaatcgatattgcagacatgcgaggccgccgcgcagctgcggaaagccgggaaggtcaccgtgagagacaccaccctcaagaggctcggcgccacgcacctcaagtacggcgtcggagacgcccacttcgaggtacagtgatccccaatggctgcctgcgctccattcgatcgacatgaaacttgatcgttttctgatcgtgtctttgtcgaacaacgtacatgcgatcgatcgatcgtgtaaacaggtggtgaagttcgcgctgcttgacacgatcaaggaggaggttccggcggacatgtggagcccggcgatgaagagcgcgtggagcgaagcctacgaccacctggtcgctgccatcaagcaggagatgaagcccgcggagtgatcgacaggcatgctagctgctccacctccatgatcctcgcctcgcgagtccgattagcttttgttgctttcaaatgctcgtttcatattcatcgtgtcccacaaaaaaaggagtgtgtatgtggtgtacgattggtgcacgctcctgctgttttcttctcgtgataagacataaataaagatggttttctacgcttgc</dnaseqindica>|<br />
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001056011.1 RefSeq:Os03g0233900]|<br />
}}<br />
[[Category:Genes]]<br />
[[Category:Japonica mRNA]]<br />
[[Category:Oryza Sativa Japonica Group]]<br />
[[Category:Japonica Genes]]<br />
[[Category:Japonica Chromosome 3]]<br />
[[Category:Chromosome 3]]</div>Wangjinlong