http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=Wangshuqin 2026-10-12T07:23:28Z User contributions MediaWiki 1.30.0 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=182541 2014-06-09T13:09:00Z

<p>Wangshuqin: /* Labs working on this gene */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1<br /> that at least partially directly activates the expression of<br /> wax synthesis related genes to enhance wax production,<br /> through the regulation of the components of wax biosyn-<br /> thesis. This indicate that<br /> OsWR1 is a positive regulator of wax synthesis in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice and OsWR1 physically interacts with the<br /> GCC box and DRE in the wax synthesis related gene<br /> promoters.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> One of the rice WIN1-like genes, OsWR1(Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.<br /> The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3(57.8%) and OsWR2 (Os06g0604000, 81%), but low<br /> similarity to OsWR3 (Os02g0797100, 41.4%).these all contain the conserved ERF domain , suggesting that OsWR1 is a homology of WIN1/SHN1.<br /> <br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> Broun P, Poindexter P, Osborne E, Jiang CZ, Riechmann JL (2004)<br /> WIN1, a transcriptional activator of epidermal wax accumulation<br /> in Arabidopsis. Proc Natl Acad Sci USA 101:4706–4711<br /> <br /> Jung KH, Han MJ, Lee DY, Lee YS, Schreiber L, Franke R, Faust A,<br /> Yephremov A, Saedler H, Kim YW, Hwang I, An G (2006)<br /> Wax-deficient anther1 is involved in cuticle and wax production<br /> in rice anther walls and is required for pollen development. Plant<br /> Cell 18:3015–3032<br /> <br /> Rowland O, Zheng H, Hepworth SR, Lam P, Jetter R, Kunst L (2006)<br /> CER4 encodes an alcohol-forming fatty acyl-coenzyme a<br /> reductase involved in cuticular wax production in Arabidopsis.<br /> Plant Physiol 142:866–877<br /> <br /> ==Labs working on this gene==<br /> Biotechnology Research Institute, Chinese Academy<br /> of Agricultural Sciences, Beijing 100081, China<br /> <br /> National Key Facility of Crop Gene Resources and Genetic<br /> Improvement, Beijing 100081, China<br /> <br /> National Center for Plant Gene Research (Beijing),<br /> Beijing 100081, China<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=182534 2014-06-09T13:06:55Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1<br /> that at least partially directly activates the expression of<br /> wax synthesis related genes to enhance wax production,<br /> through the regulation of the components of wax biosyn-<br /> thesis. This indicate that<br /> OsWR1 is a positive regulator of wax synthesis in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice and OsWR1 physically interacts with the<br /> GCC box and DRE in the wax synthesis related gene<br /> promoters.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> One of the rice WIN1-like genes, OsWR1(Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.<br /> The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3(57.8%) and OsWR2 (Os06g0604000, 81%), but low<br /> similarity to OsWR3 (Os02g0797100, 41.4%).these all contain the conserved ERF domain , suggesting that OsWR1 is a homology of WIN1/SHN1.<br /> <br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> Broun P, Poindexter P, Osborne E, Jiang CZ, Riechmann JL (2004)<br /> WIN1, a transcriptional activator of epidermal wax accumulation<br /> in Arabidopsis. Proc Natl Acad Sci USA 101:4706–4711<br /> <br /> Jung KH, Han MJ, Lee DY, Lee YS, Schreiber L, Franke R, Faust A,<br /> Yephremov A, Saedler H, Kim YW, Hwang I, An G (2006)<br /> Wax-deficient anther1 is involved in cuticle and wax production<br /> in rice anther walls and is required for pollen development. Plant<br /> Cell 18:3015–3032<br /> <br /> Rowland O, Zheng H, Hepworth SR, Lam P, Jetter R, Kunst L (2006)<br /> CER4 encodes an alcohol-forming fatty acyl-coenzyme a<br /> reductase involved in cuticular wax production in Arabidopsis.<br /> Plant Physiol 142:866–877<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=182531 2014-06-09T13:05:24Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1<br /> that at least partially directly activates the expression of<br /> wax synthesis related genes to enhance wax production,<br /> through the regulation of the components of wax biosyn-<br /> thesis. This indicate that<br /> OsWR1 is a positive regulator of wax synthesis in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice and OsWR1 physically interacts with the<br /> GCC box and DRE in the wax synthesis related gene<br /> promoters.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> One of the rice WIN1-like genes, OsWR1(Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.<br /> The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3(57.8%) and OsWR2 (Os06g0604000, 81%), but low<br /> similarity to OsWR3 (Os02g0797100, 41.4%).these all contain the conserved ERF domain , suggesting that OsWR1 is a homology of WIN1/SHN1.<br /> <br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> Broun P, Poindexter P, Osborne E, Jiang CZ, Riechmann JL (2004)<br /> WIN1, a transcriptional activator of epidermal wax accumulation<br /> in Arabidopsis. Proc Natl Acad Sci USA 101:4706–4711<br /> <br /> Jung KH, Han MJ, Lee DY, Lee YS, Schreiber L, Franke R, Faust A,<br /> Yephremov A, Saedler H, Kim YW, Hwang I, An G (2006)<br /> Wax-deficient anther1 is involved in cuticle and wax production<br /> in rice anther walls and is required for pollen development. Plant<br /> Cell 18:3015–3032<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=182526 2014-06-09T13:04:18Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1<br /> that at least partially directly activates the expression of<br /> wax synthesis related genes to enhance wax production,<br /> through the regulation of the components of wax biosyn-<br /> thesis. This indicate that<br /> OsWR1 is a positive regulator of wax synthesis in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice and OsWR1 physically interacts with the<br /> GCC box and DRE in the wax synthesis related gene<br /> promoters.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> One of the rice WIN1-like genes, OsWR1(Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.<br /> The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3(57.8%) and OsWR2 (Os06g0604000, 81%), but low<br /> similarity to OsWR3 (Os02g0797100, 41.4%).these all contain the conserved ERF domain , suggesting that OsWR1 is a homology of WIN1/SHN1.<br /> <br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> Broun P, Poindexter P, Osborne E, Jiang CZ, Riechmann JL (2004)<br /> WIN1, a transcriptional activator of epidermal wax accumulation<br /> in Arabidopsis. Proc Natl Acad Sci USA 101:4706–4711<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=182523 2014-06-09T13:02:17Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1<br /> that at least partially directly activates the expression of<br /> wax synthesis related genes to enhance wax production,<br /> through the regulation of the components of wax biosyn-<br /> thesis. This indicate that<br /> OsWR1 is a positive regulator of wax synthesis in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice and OsWR1 physically interacts with the<br /> GCC box and DRE in the wax synthesis related gene<br /> promoters.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> One of the rice WIN1-like genes, OsWR1(Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.<br /> The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3(57.8%) and OsWR2 (Os06g0604000, 81%), but low<br /> similarity to OsWR3 (Os02g0797100, 41.4%).these all contain the conserved ERF domain , suggesting that OsWR1 is a homology of WIN1/SHN1.<br /> <br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178931 2014-06-06T06:45:50Z

<p>Wangshuqin: /* Evolution */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1 mainly affects wax synthesis and composition<br /> in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice and OsWR1 physically interacts with the<br /> GCC box and DRE in the wax synthesis related gene<br /> promoters.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> One of the rice WIN1-like genes, OsWR1(Os02g0202000), encodes a protein of 205 amino acids with a predicted protein molecular weight of 22.45 kDa.<br /> The amino acid of full length OsWR1 shows a high similarity to WIN1/SHN1 (68.8%), SHN2 (58%), SHN3(57.8%) and OsWR2 (Os06g0604000, 81%), but low<br /> similarity to OsWR3 (Os02g0797100, 41.4%).these all contain the conserved ERF domain , suggesting that OsWR1 is a homology of WIN1/SHN1.<br /> <br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178515 2014-06-05T14:22:51Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1 mainly affects wax synthesis and composition<br /> in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice and OsWR1 physically interacts with the<br /> GCC box and DRE in the wax synthesis related gene<br /> promoters.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178513 2014-06-05T14:20:30Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1 mainly affects wax synthesis and composition<br /> in rice.<br /> <br /> OsWR1 modulates the expression of wax biosynthesis<br /> related genes in rice.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178505 2014-06-05T14:16:38Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> OsWR1 mainly affects wax synthesis and composition<br /> in rice.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178503 2014-06-05T14:15:19Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> OsWR1 might participate in the regulation of oxidative<br /> stress response and membrane stability, and this regulation<br /> might be a compensation for the modulation of OsWR1 in<br /> drought response.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178501 2014-06-05T14:10:59Z

<p>Wangshuqin: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> ===Expression===<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> Real-time PCR (Q-PCR) amplifications showed that the<br /> expression of OsWR1 was quickly responded at 1 h, and<br /> then gradually increased to peak at 2.5 h after drought<br /> treatment. The transcripts of OsWR1 induced by ABA<br /> treatment were clearly observed at 6 h, and reached max-<br /> imum induction at 9 h and then decreased, whereas the<br /> induction of OsWR1 by salt treatment was dramatically<br /> increased at 3 h and reached a maximum at 6 h, and sustained high induction thereafter.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178499 2014-06-05T14:08:45Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> OsWR1 is a positive regulator for drought response through affecting water loss.<br /> <br /> ===Expression===<br /> Nuclear localization<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178498 2014-06-05T14:08:07Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> Datas reveal that OsWR1 is responsive to drought, salt and ABA in rice.<br /> <br /> ===Expression===<br /> Nuclear localization<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178496 2014-06-05T14:05:08Z

<p>Wangshuqin: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> ===Expression===<br /> Nuclear localization<br /> <br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178495 2014-06-05T14:04:55Z

<p>Wangshuqin: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> ===Expression===<br /> Nuclear localization<br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178492 2014-06-05T14:04:12Z

<p>Wangshuqin: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> ===Expression===<br /> To test nuclear localization, an in vivo targeting experiment was performed by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The result indicates that WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178485 2014-06-05T13:59:09Z

<p>Wangshuqin: /* Expression */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> ===Expression===<br /> To test this possibility, an in vivo targeting experiment by fusing the coding region of OsWR1 to GFP, and the resulting constructs (WR1–GFP and GFP only) were introduced into rice calli by agroinfiltration. These fusion proteins, under the control of the CaMV 35S promoter, were expressed in rice callus cells,<br /> and the localization of the fusion protein was determined by visualization with a fluorescence microscope. The WR1–GFP was localized primarily in the nucleus, while GFP-only was observed in cytosol.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178473 2014-06-05T13:49:39Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region,Youhua Wang fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178471 2014-06-05T13:48:17Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> To investigate the functional role of<br /> this region, we fused the coding regions of OsWR1 and its<br /> deletion of the predicted acidic activation (DAD, located at<br /> 174–186 AA) region to the DNA-binding-domain expres-<br /> sion vector of GAL4 and examined the behavior of GAL4–<br /> OsWR1 and GAL4–OsWR1–DAD constructs as potential<br /> transcriptional activators in yeast. In the presence of the<br /> activation domain, the OsWR1 protein fused to the DNA-<br /> binding domain, e.g. GAL4–OsWR1 (indicated as WR1 in<br /> Fig. 2a), activated transcription of the lacZ reporter gene,<br /> whereas GAL4–OsWR1–DAD (indicated as WR1–DAD in<br /> Fig. 2a) could not, indicating that the OsWR1 protein may<br /> act as a transcriptional activator.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178457 2014-06-05T13:37:34Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago WXP1/2, have been shown to induce the production of epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like OsWR1 controls wax formation by direct or collaborative activation of wax synthesis genes, and this regulation, distinct from its homology regulator of WIN1/SHN1 in cutin synthesis, subsequently results in reduced water loss and enhanced drought tolerance.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178453 2014-06-05T13:36:22Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants.<br /> <br /> The WIN1-like<br /> OsWR1 controls wax formation by direct or collaborative<br /> activation of wax synthesis genes, and this regulation,<br /> distinct from its homology regulator of WIN1/SHN1 in<br /> cutin synthesis, subsequently results in reduced water loss<br /> and enhanced drought tolerance.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178431 2014-06-05T13:14:25Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A (2004)<br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178430 2014-06-05T13:13:53Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A <br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178428 2014-06-05T13:13:20Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A <br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178425 2014-06-05T13:12:35Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> Aharoni A, Dixit S, Jetter R, Thoenes E, van Arkel G, Pereira A <br /> The SHINE clade of AP2 domain transcription factors activates wax biosynthesis, alters cuticle properties, and confers drought tolerance when overexpressed in Arabidopsis. Plant Cell 16:2463–2480<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178422 2014-06-05T13:09:37Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178420 2014-06-05T13:09:09Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178419 2014-06-05T13:08:48Z

<p>Wangshuqin: /* Function */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> ERF proteins, Arabidopsis WIN1/SHN1 and Medicago<br /> WXP1/2, have been shown to induce the production of<br /> epidermal waxes when overexpressed in plants<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178388 2014-06-05T12:41:40Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178387 2014-06-05T12:40:22Z

<p>Wangshuqin: /* Annotated Information */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> ===References===<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178380 2014-06-05T12:36:21Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=178378 2014-06-05T12:34:36Z

<p>Wangshuqin: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> Please input function information here.<br /> <br /> ===Expression===<br /> Please input expression information here.<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> Please input related labs here.<br /> <br /> ==References==<br /> Youhua Wang;Liyun Wan;Lixia Zhang;Zhijin Zhang;Haiwen Zhang;Ruidang Quan;Shirong Zhou;Rongfeng Huang<br /> An ethylene response factor OsWR1 responsive to drought stress transcriptionally activates wax synthesis related genes and increases wax production in rice<br /> Plant Molecular Biology, 2012, 78(3): 275-288<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os06g0181700|<br /> Description = Pathogenesis-related transcriptional factor and ERF domain containing protein|<br /> Version = NM_001063516.1 GI:115466763 GeneID:4340313|<br /> Length = 980 bp|<br /> Definition = Oryza sativa Japonica Group Os06g0181700, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|<br /> AP = Chromosome 6:4039785..4040764|<br /> CDS = 4039909..4039991,4040099..4040552|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008399:4039785..4040764<br /> source=RiceChromosome06<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MARPQQRYRGVRQRHWGSWVSEIRHPLLKTRIWLGTFETAEDAA RAYDEAARIMCGPRVRTNFPHDVADEAAPPPPPHSAAAASSSFLSAALVAKLHRFNLA SVQAAQRGNSNDDDSTTSSSAAASSRAVIPSLPAAAGALGNAAATAEWSGGFLEEQYV DQMIEELLDSNFSMEISC&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;125..207#315..768#actgatcacctcgacctcacttcctcctcaacctcgagctcactcctcgctctcccgccgcgagcgcgcgctctctctcgccgcgaccacgcgcaatccgtcgccgagctcgaggacgtcggcaatggcgcggccgcagcagcggtatcgcggcgtgcggcagcgccactggggctcatgggtctccgagatccgccaccctctcctgtaattcatcgtcgccatcctcctcctgattgattgattctttgtttcttcctcgcgtagattggtttcttggccatggcggtttgatttcttggttgggcttgcaggaagacgaggatctggctgggcacgttcgagacggcggaggacgcggcacgcgcgtacgacgaggcggcgcggatcatgtgcggcccgcgcgtgcgcaccaacttcccccacgacgtcgccgacgaggccgcgccgccgccgccgccgcacagcgccgccgcagcctcctcgtcgttcctctccgcggcgctcgtcgccaagctccaccgcttcaacctcgcctccgtccaggctgcgcagcgcggcaacagcaacgacgacgactccaccacctcctcctccgccgccgcgtcgtcgcgcgccgtgattccgtcccttcccgccgccgccggcgcattgggcaatgcggcggcgacggcggagtggagcggcgggttcctcgaggagcagtacgtggaccagatgatcgaggagctcctcgactccaacttctccatggagatctcctgctgatgtgccctgttcatctacctgttcttctctgctccatctcctgtttctttctctctctcttttttttctttctttttttttgtttttttagtttagtaagctatgtgaggaagaactctgatcgaggttagtttggtcacagtgagttctggagcagcttgtgtatacggtagcatcatttagagcataatagggttgcagttgagaccttc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063516.1 RefSeq:Os06g0181700]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Wangshuqin