<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xunaizia</id>
		<title>RiceWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xunaizia"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php/Special:Contributions/Xunaizia"/>
		<updated>2026-08-27T20:33:23Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=177458</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=177458"/>
				<updated>2014-06-04T12:18:18Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 2A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
[[File:Example.jpg]]===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].[[File:FiG1.png|300px|thumb|left|FIG1]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 1.''' Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FiG2.png|300px|thumb|left|FIG2]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 2.''' Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171943</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171943"/>
				<updated>2014-05-24T16:32:26Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 2A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].[[File:FiG1.png|300px|thumb|left|FIG1]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 1.''' Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FiG2.png|300px|thumb|left|FIG2]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 2.''' Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171942</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171942"/>
				<updated>2014-05-24T16:32:04Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 2A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].[[File:FiG1.png|300px|thumb|left|FIG1]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 1.''' Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FiG2.png|300px|thumb|left|FIG2]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 2.''' Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171941</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171941"/>
				<updated>2014-05-24T16:31:22Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 2A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].&lt;br /&gt;
&lt;br /&gt;
[[File:FiG1.png|300px|thumb|left|FIG1]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 1.''' Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FiG2.png|300px|thumb|left|FIG2]]&lt;br /&gt;
&lt;br /&gt;
'''Fig. 2.''' Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:FiG2.png&amp;diff=171940</id>
		<title>File:FiG2.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:FiG2.png&amp;diff=171940"/>
				<updated>2014-05-24T16:30:36Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plantsegregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1)&lt;br /&gt;
and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two&lt;br /&gt;
independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)&lt;br /&gt;
plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171938</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171938"/>
				<updated>2014-05-24T16:28:57Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 2A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].&lt;br /&gt;
&lt;br /&gt;
[[File:FiG1.png|300px|thumb|left|FIG1]]&lt;br /&gt;
&lt;br /&gt;
Fig. 1. Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FiG2.png|300px|thumb|left|FIG2]]&lt;br /&gt;
&lt;br /&gt;
Fig. 1. Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:FiG1.png&amp;diff=171935</id>
		<title>File:FiG1.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:FiG1.png&amp;diff=171935"/>
				<updated>2014-05-24T16:28:07Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, reg&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171934</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171934"/>
				<updated>2014-05-24T16:26:58Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 2A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].&lt;br /&gt;
[[File:FiG1.png|300px|thumb|left|FIG1]]&lt;br /&gt;
&lt;br /&gt;
Fig. 1. Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FiG2.png|300px|thumb|left|FIG2]]&lt;br /&gt;
&lt;br /&gt;
Fig. 1. Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:FIG1.png&amp;diff=171932</id>
		<title>File:FIG1.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:FIG1.png&amp;diff=171932"/>
				<updated>2014-05-24T16:25:28Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: Defense signaling model for the roles of OsWRKY13 in regulation
of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick
solid lines indicate direct action of OsWRKY13 has been confirmed by
protein-DNA binding assays; thin solid lines, reg&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Defense signaling model for the roles of OsWRKY13 in regulation&lt;br /&gt;
of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick&lt;br /&gt;
solid lines indicate direct action of OsWRKY13 has been confirmed by&lt;br /&gt;
protein-DNA binding assays; thin solid lines, regulation may be executed&lt;br /&gt;
by direct or indirect action; dotted lines, regulation has been confirmed in&lt;br /&gt;
rice or other plant species; the line ending with arrow, activation; and the&lt;br /&gt;
line ending with perpendicular short line indicates suppression.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171929</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171929"/>
				<updated>2014-05-24T16:23:49Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 2A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].&lt;br /&gt;
[[File:FIG1]]&lt;br /&gt;
Fig. 1. Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FIG2]]&lt;br /&gt;
Fig. 1. Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171928</id>
		<title>OsWRKY13</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=OsWRKY13&amp;diff=171928"/>
				<updated>2014-05-24T16:23:23Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: Created page with &amp;quot;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,ab...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Rice transcription regulator OsWRKY13 influences the functioning of more than 500 genes in multiple signalling pathways, with roles in disease resistance, redox homeostasis,abiotic stress responses, and development[1].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Comparative analysis of the genomic and cDNA sequences of OsWRKY13 (GenBank accession number EF143611) from resistant cultivar Minghui 63 (Oryza sativa subsp. indica) showed that the gene was 1,505 bp in length and had a coding region interrupted by two introns. The putative encoding product of OsWRKY13 consisted of 316 amino acids, which contained a WRKY motif, a zinc-finger motif, and a potential nuclear localization signal (Fig. 1A). According&lt;br /&gt;
to the classification of the WRKY superfamily (Eulgem et al. 2000), OsWRKY13 belongs to group II[2].&lt;br /&gt;
OsWRKY13 was overexpressed in cultivar Mudanjiang 8 (O.sativa subsp. japonica).&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
Rice OsWRKY13 is a potentially important transcriptional regulator involved in multiple physiological processes. It mediates disease resistance to bacterial blight caused by Xanthomonas oryzae pv. oryzae (Xoo) and fungal blast caused by Magnaporthe grisea through activation of salicylic acid (SA)-dependent pathways and suppression of jasmonic acid (JA)-dependent pathways(FIG1); OsWRKY13 can bind to the W-box and W-box like cis-elements that are present in the promoters of some pathogen-induced defence-responsive genes [2,3]. Furthermore, genomewide analyses of the expression profiling of OsWRKY13-activated lines reveal that OsWRKY13 directly or indirectly regulates the expression of more than 500 genes [4].&lt;br /&gt;
[[File:FIG1]]&lt;br /&gt;
Fig. 1. Defense signaling model for the roles of OsWRKY13 in regulation of salicylic acid (SA)- and jasmonic acid (JA)-dependent pathways. Thick solid lines indicate direct action of OsWRKY13 has been confirmed by protein-DNA binding assays; thin solid lines, regulation may be executed by direct or indirect action; dotted lines, regulation has been confirmed in rice or other plant species; the line ending with arrow, activation; and the line ending with perpendicular short line indicates suppression.&lt;br /&gt;
&lt;br /&gt;
OsWRKY13 is also a potential regulator of other physiological processes during pathogen infection. It activates redox homeostasis by the glutathione/glutaredoxin system as well as the flavonoid biosynthesis pathway, which may enhance the biosynthesis of antimicrobial flavonoid phytoalexins [4]. OsWRKY13 inhibits the SNAC1-mediated abiotic stress defence pathway and terpenoid metabolism pathway to suppress salt and cold defence responses as well as to putatively retard rice growth and development[4]. Compared to the large number of differentially expressed genes in OsWRKY13-activated plants, however,most OsWRKY13-regulated pathways have yet to be elucidated.&lt;br /&gt;
To understand the transcriptional regulation of OsWRKY13, the types of transcription factors and conserved motifs in the promoter regions of the genes differentially expressed in OsWRKY13-activated plants were analyzed. The results suggest that the actions of OsWRKY13 on the expression of more than 500 genes are partitioned by different types of transcription factors through binding to distinctly distributed cis-acting elements in the promoters of OsWRKY13-upregulated and -downregulated genes. Furthermore, OsWRKY13 appears to bind preferentially to the promoters of downregulated genes in vitro, suggesting that it may function more as a negative transcriptional regulator[1].&lt;br /&gt;
[[File:FIG2]]&lt;br /&gt;
Fig. 1. Product and function of the OsWRKY13 gene. A, Schematic diagrams of conserved motifs of OsWRKY13. NLS = nuclear localization signal, WRKY =WRKY motif, and zinc finger = zinc-finger motif. Conserved sequences of these structures are presented, and numbers indicate the amino acid position of each structure in OsWRKY13. B, OsWRKY13-overexpressing plants show enhanced resistance to Xanthomonas oryzae pv. oryzae PXO61 at both the seedling and booting stages. The T2 transgenic plants (1-1, 7-2, 18-10) are from T0 plants D11UM1, D11UM7, and D11UM18. 7-2N is a transgene-negative plant segregated in the D11UM7-2 family. C, Expression analysis of OsWRKY13 in noninoculated T0 transgenic plants, wild type, mock (water)-inoculated Minghui 63 (donor of OsWRKY13, M), and PXO61-inoculated Minghui 63 (P) by RNA gel blot analysis. D, Enhanced resistance to PXO61 cosegregates with overexpression of OsWRKY13 in T2 families D11UM1-4 and D11UM7-2. E, Growth of PXO61 in leaves of T3 OsWRKY13-overexpressing (D11UM1) and wild-type plants. Bacterial populations were determined from three leaves at each timepoint by counting CFUs. Similar results were obtained in two independent biological experiments. F, Resistance of OsWRKY13-overexpressing plants for Blast. The T1 negative (D11UM18-1N) and positive (D11UM18-4)plants were from T0 plant D11UM18. Similar results were obtained in two independent biological experiments. ck = Mudanjiang 8 (wild type).&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Deyun Qiu, Jun Xiao, Weibo Xie&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1.Deyun Qiu, Jun Xiao, Weibo Xie:'''Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice'''.''BMC Plant Biology'' 2009, 9:74&lt;br /&gt;
2.Qiu D, Xiao J, Ding X, Xiong M, Cai M, Cao Y, Li X, Xu C, Wang S: '''OsWRKY13 mediates rice disease resistance by regulating defense-related genes in salicylate- and jasmonate-dependent signaling'''. ''Mol Plant Microbe Interact'' 2007, 20:492-499.&lt;br /&gt;
3.Cai M, Qiu D, Yuan T, Ding X, Li H, Duan L, Xu C, Li X, Wang S: '''Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance'''. ''Plant Cell Environ'' 2008,31:86-96.&lt;br /&gt;
4.Qiu D, Xiao J, Xie W, Liu H, Li X, Xiong L, Wang S: '''Rice gene network inferred from expression profiling of plants overexpressing OsWRKY13, a positive regulator of disease resistance'''. ''Mol Plant'' 2008, 1:538-551.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171544</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171544"/>
				<updated>2014-05-24T03:17:16Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
[[File:Fig7.png|300px|thumb|left|Fig.7]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.7''':type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171543</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171543"/>
				<updated>2014-05-24T03:16:50Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
[[File:Fig7.png|300px|thumb|left|Fig.7]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.7''':type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171540</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171540"/>
				<updated>2014-05-24T03:16:19Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
[[File:Fig7.png|300px|thumb|left|Fig.7]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.7''':type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171539</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171539"/>
				<updated>2014-05-24T03:15:40Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
[[File:Fig7.png|300px|thumb|left|Fig.7]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.7''':type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171537</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171537"/>
				<updated>2014-05-24T03:15:14Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
[[File:Fig7.png|300px|thumb|left|Fig.7]]&lt;br /&gt;
&lt;br /&gt;
Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171536</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171536"/>
				<updated>2014-05-24T03:14:15Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171534</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171534"/>
				<updated>2014-05-24T03:13:40Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171531</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171531"/>
				<updated>2014-05-24T03:12:57Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.4''':Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
'''Fig.5''':The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
'''Fig.6''':Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171528</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171528"/>
				<updated>2014-05-24T03:12:05Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
&lt;br /&gt;
[[File:Fig4.png|300px|thumb|right|Fig.4]]&lt;br /&gt;
&lt;br /&gt;
Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
&lt;br /&gt;
[[File:Fig5.png|300px|thumb|right|Fig.5]]&lt;br /&gt;
&lt;br /&gt;
Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|300px|thumb|right|Fig.6]]&lt;br /&gt;
Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171526</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171526"/>
				<updated>2014-05-24T03:09:33Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.3''': Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171525</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171525"/>
				<updated>2014-05-24T03:08:50Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3]]&lt;br /&gt;
&lt;br /&gt;
Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171522</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171522"/>
				<updated>2014-05-24T03:07:44Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171520</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171520"/>
				<updated>2014-05-24T03:06:45Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.1''': Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''Fig.2''': OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171518</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171518"/>
				<updated>2014-05-24T03:05:22Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171516</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171516"/>
				<updated>2014-05-24T03:04:43Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1]]&lt;br /&gt;
Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171514</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171514"/>
				<updated>2014-05-24T03:03:11Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|300px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|300px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171513</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171513"/>
				<updated>2014-05-24T03:01:51Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|300px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171512</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171512"/>
				<updated>2014-05-24T03:01:17Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171510</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171510"/>
				<updated>2014-05-24T02:58:29Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:FiG7.png|200px|thumb|left|Fig.7:type-A response regulators in rice. (A) Exon-intron organization of OsRR genes. Exons and introns are represented by black boxes and lines, respectively. (B) Schematic representation of OsRR proteins (aligned with respect to the second conserved Asp (D) residue). The conserved receiver domain is represented as gray box with D-D-K residues. The black vertical bars represent intron position. The numbers 0, 1 and 2 above the vertical bars represent the phase 0, 1 and 2 introns, respectively. (C) Multiple alignments of the OsRR proteins obtained with ClustalX. Fully and partially conserved (present in more than 50% of aligned sequences) residues are highlighted in black and gray boxes, respectively. Gaps (marked with dashes) have been introduced to maximize the alignments. The conserved receiver domain has been underlined. Conserved Asp and Lys residues are marked with asterisks.]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171509</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171509"/>
				<updated>2014-05-24T02:56:36Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171508</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171508"/>
				<updated>2014-05-24T02:55:53Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171505</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171505"/>
				<updated>2014-05-24T02:55:03Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:Fig4.png|200px|thumb|right|Fig.4:Locations and duplications of putative cytokinin two-component regulators in the rice chromosomes (cv. Nipponbare). Ovals on the chromosomes represent centromeres.]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:Fig5.png|200px|thumb|right|Fig.5:The analysis of the response of the system genes family to cytokinin by RT-PCR. RNA was isolated from roots and leaves from Nipponbare rice growing in liquid nutrient medium either with 1 μM 6-benzylaminopurine (6-BA) for 4 h or with no 6-BA. OsACTIN primers were used as a template control.]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig6.png|200px|thumb|right|Fig.6:Real-time PCR analysis showing the organ-specific expression profiles of individual OsRR genes. The relative mRNA levels of individual OsRR genes normalized with respect to housekeeping gene, UBQ5, in different tissues (GS, green seedlings; ES, etiolated seedlings; S, green shoots]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171502</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171502"/>
				<updated>2014-05-24T02:51:04Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171500</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171500"/>
				<updated>2014-05-24T02:49:52Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig.1: Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:Fig2.png|200px|thumb|left|Fig.2: OsRR6 represses shoot regeneration in rice callus. Callus was transformed with Agrobacterium carrying a binary vector pActnos/Hmz (Vec.), Act1::OsRR6 (OsRR6) or Act1::OsRR6D103E (OsRR6D103E). Calli were selected with hygromycin B and grown on regeneration agar plates for 6 weeks.]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:Fig3.png|200px|thumb|left|Fig.3: Morphologies of transgenic plants overexpressing OsRR6. OsRR6-ox transgenic plants (T0 generation) were grown on MS-agar plates containing hygromycin B for 7 d, and then hydroponically grown for 75 d. Transgenic plants, transformed with vector pActnos/Hmz (Vec.) or Act1::OsRR6D103E (OsRR6D103E-ox), were also grown under the same conditions. The typical phenotype of each transgenic line and their panicles are shown in (A) and (B). Total RNA samples were prepared from the shoots of each transgenic plant. (C) Semiquantitative RT–PCR analysis of the OsRR6 gene in the transgenic lines. OsAct1 is an extraction and loading control.]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171495</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171495"/>
				<updated>2014-05-24T02:45:33Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Fig1 Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171494</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171494"/>
				<updated>2014-05-24T02:44:22Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:Fig1.png|200px|thumb|left|Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig1.png&amp;diff=171493</id>
		<title>File:Fig1.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig1.png&amp;diff=171493"/>
				<updated>2014-05-24T02:42:38Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: uploaded a new version of &amp;amp;quot;File:Fig1.png&amp;amp;quot;: Reverted to version as of 18:18, 23 May 2014&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig1.png&amp;diff=171491</id>
		<title>File:Fig1.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Fig1.png&amp;diff=171491"/>
				<updated>2014-05-24T02:42:17Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: uploaded a new version of &amp;amp;quot;File:Fig1.png&amp;amp;quot;: Reverted to version as of 18:18, 23 May 2014&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171486</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171486"/>
				<updated>2014-05-24T02:38:49Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171485</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171485"/>
				<updated>2014-05-24T02:36:58Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1.png|200px|thumb|left|替换文字]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171483</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171483"/>
				<updated>2014-05-24T02:35:45Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171482</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171482"/>
				<updated>2014-05-24T02:35:07Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1.png|200px|fig1|left|]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171480</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171480"/>
				<updated>2014-05-24T02:33:20Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1.png|200px|fig1|left|Changes in transcript levels of the OsRR6 gene in response to different stress treatments. The transcript levels of OsRR6 gene in 6-day-old light-grown seedlings treated with ABA, NaCl, mannitol and cold for 6 h, were plotted as the relative expression (fold) of the seedlings mock-treated for the same duration.]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171478</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171478"/>
				<updated>2014-05-24T02:32:33Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1.png|200px|fig1|left|alt text]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171475</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171475"/>
				<updated>2014-05-24T02:28:04Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:李芸1.png|200px|fig1|left|alt text]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171473</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171473"/>
				<updated>2014-05-24T02:24:46Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:File.png|200px|thumb|left|alt text]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171436</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171436"/>
				<updated>2014-05-23T18:33:10Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter. Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171434</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171434"/>
				<updated>2014-05-23T18:32:17Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter (Zhang et al. 1991, Sentoku et al.2000). Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171433</id>
		<title>Os04g0673300</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os04g0673300&amp;diff=171433"/>
				<updated>2014-05-23T18:30:45Z</updated>
		
		<summary type="html">&lt;p&gt;Xunaizia: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator in rice[2].&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is a kind of CK-inducible type-A response regulator[2].The type-A response regulators are relatively small, containing a receiver domain along with short N- and C-terminal extensions. &lt;br /&gt;
&lt;br /&gt;
The expression of a majority of OsRR genes was not significantly altered under stress, with the notable exception of OsRR6. The expression of OsRR6 gene was induced to significant levels by salt, dehydration and low temperature treatments (Fig. 1), and results were reproducible. This indicates that OsRR6 may play an important role in abiotic stress signaling in rice, besides acting as a component in cytokinin signaling[1].&lt;br /&gt;
&lt;br /&gt;
The induction of OsRR6 by different abiotic stress stimuli provides a molecular link between stress and cytokinin signaling as well[1].&lt;br /&gt;
&lt;br /&gt;
Overexpression of OsRR6 also affected the expression of CK-responsive genes[2].&lt;br /&gt;
&lt;br /&gt;
OsRR6-ox plants displayed altered morphologies and changes in CK metabolism, probably due to changes in the gene regulatory network[2].&lt;br /&gt;
[[File:fig1]]&lt;br /&gt;
&lt;br /&gt;
Generated transgenic rice plants that overexpress OsRR6 (OsRR6-ox) by fusing its coding sequence to the rice actin1 (Act1) promoter, because this promoter generally produces much higher levels of constitutive expression in rice than the cauliflower mosaic virus(CaMV) 35S promoter (Zhang et al. 1991, Sentoku et al.2000). Callus transformed with Act1::OsRR6 showed severe retardation of shoot regeneration compared with callus transformed with a control vector (Fig. 2)[2].&lt;br /&gt;
[[File:fig2]]&lt;br /&gt;
&lt;br /&gt;
Moreover, each of 20 OsRR6D103E-ox independent lines was indistinguishable from plants transformed with a control vector (control plants; Fig. 3A, B). These results support the hypothesis that growth defects associated with OsRR6 overexpression are due to a requirement for phosphorylation of OsRR6[2].&lt;br /&gt;
[[File:fig3]]&lt;br /&gt;
&lt;br /&gt;
Future analyses of knockout or RNA interference mutants of OsRR6 will enable us to define further its possible participation in stress responses.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
OsRR6 is found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2  (Fig. 4)[4]. &lt;br /&gt;
[[File:fig4]]&lt;br /&gt;
&lt;br /&gt;
The OsRR genes express differentially in various organs examined, and also in response to light[1]. Most of the OsRR genes were expressed at relatively higher level in mature tissues (leaves and flowers).The majority of the type-A OsRR genes (OsRR2–9 and OsRR11) were expressed at various levels in roots, stems, leaves, and spikelets (Fig.5)([4]. OsRR6 was expressed mostly in roots and leaves.&lt;br /&gt;
&lt;br /&gt;
The transcript levels of OsRR2, 3, 4, 6, 7,and 9 were significantly higher in etiolated seedlings as compared to green seedlings (Fig. 6)[4].&lt;br /&gt;
[[File:fig5]]&lt;br /&gt;
&lt;br /&gt;
[[File:fig6]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
&lt;br /&gt;
The type-A RRs are mainly composed of a receiver domain with short N- and C-terminal extensions [2], essentially similar to the E. coli response regulator (RR) CheY involved in chemotaxis, and lack a typical output domain(3). All the OsRR proteins also contain the highly conserved Lys and two Asp residues (D-D-K) in the receiver domain (Fig. 7B, C).However, OsRR6 and OsRR7 have N-terminal extensions rich in gly and asp residues (Fig. 7C). These N- and C-terminal variable regions may play a role in their localization to different cellular compartments.&lt;br /&gt;
&lt;br /&gt;
[[File:fig7]]&lt;br /&gt;
 No homolog of OsRR6 was found within the duplicated region, suggesting the involvement of gene loss or more localized duplications[4].  &lt;br /&gt;
&lt;br /&gt;
OsRR6 were found as repeats on the top arm of chromosome 4. This area of chromosome 4 is included in a segmental duplication with a region on the upper arm of chromosome 2 that contains the OsRR11 gene [4](Fig. 4).&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi and Jitendra P Khurana&lt;br /&gt;
&lt;br /&gt;
2. Liming Du, Fangchan Jiao, Jun Chu,  Ming Chen, Ping Wu&lt;br /&gt;
&lt;br /&gt;
3. X. Cheng, H. Jiang, J. Zhang, Y. Qian, S. Zhu and B. Cheng&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&lt;br /&gt;
1. Mukesh Jain, Akhilesh K Tyagi: Molecular characterization and differential expression of cytokinin-responsive type-A response regulators in rice (Oryza sativa)BMC Plant Biology 2006, 6:1 &lt;br /&gt;
&lt;br /&gt;
2.Hirose N, Makita N, Kojima M, Kamada-Nobusada T, et al. Overexpression of a type-A response regulator alters rice morphology and cytokinin metabolism. Plant Cell Physiol. 2007,48: 523-539. &lt;br /&gt;
&lt;br /&gt;
3.Imamura A, Hanaki N, Umeda H, Nakamura A, Suzuki T, Ueguchi C, Mizuno T: Response regulators implicated in His-to-Asp phosphotransfer signaling in Arabidopsis. Proc Natl Acad Sci USA 1998,95:2691-2696&lt;br /&gt;
&lt;br /&gt;
4.Liming Du, Fangchan Jiao, Jun Chu:The two-component signal system in rice (Oryza sativa L.): A genome-wide study of cytokinin signal perception and transduction.Genomics 2007,89: 697–707&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os04g0673300|&lt;br /&gt;
Description = Similar to ZmRR2 protein (Response regulator 2)|&lt;br /&gt;
Version = NM_001060766.1 GI:115461261 GeneID:4337372|&lt;br /&gt;
Length = 1115 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os04g0673300, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 4|Chromosome 4]]|&lt;br /&gt;
AP = Chromosome 4:34775847..34776961|&lt;br /&gt;
CDS = 34775949..34776305,34776410..34776565|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008397:34775847..34776961&lt;br /&gt;
source=RiceChromosome04&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAAAAQAPAAAKVVVATSPRAGGGGGGGGDRKVVPVVVAAAAGD                     EAQSEMHVLAVDDSSVDRAVIAKILRSSKYRVTTVESATRALELLCLGLVPNVNMIIT                     DYWMPGMTGYELLKRVKESSQLKEIPVVIMSSENVPNRISRCLEEGAEDFLLKPVRPS                     DVSRLCSRIR&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;103..459#564..719#attgcaaccgcaaagcctcttctcctcttcttctcctactcgcttactcaatcgctcgaggattcttggattggattattgggttggattttgagttgatcaatggcggcagcggcgcaggctccggcggcggcgaaggtggtggtggcgacgtcgccgagggcaggcggaggcggaggcggcggcggggacaggaaggtggtgccggttgtggtggcggcggcggccggcgacgaggcgcagagcgagatgcacgtgctggcggtggacgacagctccgtggaccgcgccgtcatcgccaagatcctccggagctccaagtacagggtgaccacggtggagtcggcgacgagggcgctcgagctcctctgcctcggcctcgtccccaacgtcaacatgatcatcaccgactactggatgcccggcatgaccggctacgagctcctcaagcgcgtcaaggtaatttaaattcgattcgatcgaattatcgcgatgatccatgtgaatgtggaacccccaatttcttgagactgaatttgtttcgtgtgtggttcttgctgcaggaatcgtctcagctcaaggagatcccggtggtgatcatgtcgtcggagaacgtgccgaaccggatcagccggtgcctggaggagggcgccgaggacttcctgctcaagcccgtacgcccctccgacgtgtcgcggctctgcagccgtatcagatgatcgctcgctcgccatgttggatcatggagaggatgattaactcctaggattttttttggtggctttctcaattcttggacatagttcttcttcttctgctgctgcctcaaacaagaagctaaacatttggggctttaggagatgattagccttactgccttagcaagttagaattgaaattaggtgtcaggcatttgcttgttcccctgtgtgctctgcaaagacgccatgaaaaaaaaacagagagagaagagattcttctgaagcttctgttcaggaggtttctcttgtcacaatgttgaaatggcaccagagcatcaatctgttctttttaactgtttcaagatcggtcagagttttgacattaatttaagtcttgccaattaaccatgcatc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001060766.1 RefSeq:Os04g0673300]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 4]]&lt;br /&gt;
[[Category:Chromosome 4]]&lt;/div&gt;</summary>
		<author><name>Xunaizia</name></author>	</entry>

	</feed>