RiceWiki - User contributions [en]

Os04g0541700

2017-03-09T08:18:07Z

Xysj1981:

Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.

===Function===
[[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]][[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts <ref name="ref 1"/> .]]
* ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions<ref name="ref 1"/>(Fig. 1). 
* Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains<ref name="ref 1"/>. This is typical of HD-Zip I family transcription factors<ref name="ref 2"/>. 
* Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''<ref name="ref 2"/> <ref name="ref 3"/> were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2<ref name="ref 1"/>. 
* Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA<ref name="ref 1"/>.
* The expression of Oshox22 is responsive to drought, salinity and ABA treatments, suggesting its role in regulating stress tolerance<ref name="ref 1"/>.

===Expression===
* Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. [[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''<ref name="ref 1"/> .]]
* Oshox22 is demonstrated as a nuclear-localized protein<ref name="ref 1"/>. 
* Zhang S et al.<ref name="ref 1"/> used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). 
* Agalou et al.<ref name="ref 4"/> demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.<ref name="ref 1"/> monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature<ref name="ref 1"/> .

===Evolution===
Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants<ref name="ref 1"/>. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2<ref name="ref 2"/>. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.

==Labs working on this gene==
*S. Zhang, L. Jiang, C.-M. Liu, P. B. F. Ouwerkerk: Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China. e-mail: p.b.f.ouwerkerk.2@gmail.com 
*S. Zhang, L. Jiang: Graduate School of Chinese Academy of Sciences, Beijing 100049, China 
*S. Zhang, A. H. Meijer, P. B. F. Ouwerkerk: Institute of Biology, Leiden University, P.O. BOX 9505, 2300 RA Leiden, The Netherlands 
*I. Haider, W. Kohlen, H. Bouwmeester. Laboratory of Plant Physiology, Wageningen University, Droevendaalsesteeg 1, 6708 PB Wageningen, The Netherlands 
*H. Schluepmann. Department of Molecular Plant Physiology, Utrecht University, Padualaan 8, 3584 CH Utrecht, The Netherlands 
*A. Agalou, S. Purwantomo, A. Estiati, R. J. de Kam, M. Wang, A. H. Meijer, P. B. F. OuwerkerkInsti: tute of Biology, Clusius Laboratory, Leiden University, P.O. Box 9505, 2300 RA Leiden, The Netherlands. e-mail: p.b.f.ouwerkerk@biology.leidenuniv.nl 

==References==
<references>
* <ref name="ref 1">
Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.
</ref>
* <ref name="ref 2">
Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.
</ref>
* <ref name="ref 3">
Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416

</ref>
* <ref name="ref 4">
Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.
</ref>
</references>

==Structured Information ==

Os04g0541700

2017-03-09T08:17:41Z

Xysj1981:

Gene Os04g0541700,namely '''Oshox22''',means Homeobox-leucine zipper protein HOX22.

[mailto:huanghuasheng@xtbg.ac.cn email me]

===Function===
[[File:Oshox22 structure.jpg|thumbnail|'''Fig. 1''' sequence annotation of ''Oshox22''.]][[File:Oshox22 binding.jpg|thumbnail|'''Fig. 2''' Interactions of Oshox22 with the HD-Zip binding site AH2 (CAAT(C/G)ATTG) and activation of reporter gene expression in a transient expression system using rice protoplasts <ref name="ref 1"/> .]]
* ''Oshox22'' (Os04g0541700) is located on chromosome 4 and encodes a protein of 262 amino acids (AA) including a 61-AA HD domain for DNA binding and a 43-AA Zip domain for protein–protein interactions<ref name="ref 1"/>(Fig. 1). 
* Oshox22 is a nuclear-localized protein. Trans-activation assays in yeast and transient expression analyses in rice protoplasts demonstrated that Oshox22 is able to bind the CAAT(G/C)ATTG element and acts as a transcriptional activator that requires both the HD and Zip domains<ref name="ref 1"/>. This is typical of HD-Zip I family transcription factors<ref name="ref 2"/>. 
* Transient expression assays were carried out with effector and reporter plasmids in rice protoplasts to confirm the interaction between Oshox22 protein and pseudopalindromic AH1 (CAAT(A/T)ATTG) and AH2 (CAAT(C/G)ATTG) sequences. Two reporter plasmids, ''4AH1-90-GUS'' and ''4AH2-90-GUS''<ref name="ref 2"/> <ref name="ref 3"/> were used, in which the AH1 and AH2 tetramers were fused to a CaMV -90 35S minimal promoter. Construct ''Pro35SOshox22'' with ''Oshox22'' expressed under control of the CaMV 35S promoter was used as an effector. The data show in Fig. 2 indicate that Oshox22 is capable to activate transcription of the reporter gene when upstream HD-Zip binding sites AH1 or AH2 are present. The interaction is less effective at the AH1 site than that at AH2<ref name="ref 1"/>. 
* Oshox22 functions in regulating ABA biosynthesis and ABA-mediated drought and salt tolerances in rice. The differences in ABA levels are likely causing changes in sensitivity of germinating and developing seedlings towards exogenous applied ABA<ref name="ref 1"/>.
* The expression of Oshox22 is responsive to drought, salinity and ABA treatments, suggesting its role in regulating stress tolerance<ref name="ref 1"/>.

===Expression===
* Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. [[File:Oshox22 expression.jpg|thumbnail|'''Fig. 3''' Expression profiling of ''Oshox22''<ref name="ref 1"/> .]]
* Oshox22 is demonstrated as a nuclear-localized protein<ref name="ref 1"/>. 
* Zhang S et al.<ref name="ref 1"/> used quantitative RT-PCR(qRT-PCR) to analyse RNA samples from different rice tissues at several developmental stages. The results showed that ''Oshox22'' is ubiquitously expressed, with a lower level in stems and higher in panicles and seeds(Fig. 3a). 
* Agalou et al.<ref name="ref 4"/> demonstrated that the expression of ''Oshox22'' in rice is strongly induced by drought, and that the induction is higher in three drought tolerant upland cultivars compared with three lowland cultivars. Zhang S et al.<ref name="ref 1"/> monitored the ''Oshox22'' expression under different abiotic stress conditions. As shown in Fig. 3b, ''Oshox22'' was rapidly and strongly induced by NaCl, PEG and ABA, and weakly induced by low temperature<ref name="ref 1"/> .

===Evolution===
Oshox22 belongs to the homeodomain-leucine zipper (HD-Zip) family I of transcription factors. The HD-Zip genes, are an abundant group of transcription factors that are exclusively found in plants<ref name="ref 1"/>. The NJ tree (Fig. 5) shows that the HD-Zip genes of family I can be divided into nine clades as ''α'', ''β''1, ''β''2, ''γ'', ''δ'', ''ε'', ''ζ'', ''φ''1 and ''φ''2<ref name="ref 2"/>. Subfamilies IB, IC and ID all have an intron at the same position in the Zip region. ''Oshox22'' belongs to subfamily IB.

==Labs working on this gene==
*S. Zhang, L. Jiang, C.-M. Liu, P. B. F. Ouwerkerk: Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China. e-mail: p.b.f.ouwerkerk.2@gmail.com 
*S. Zhang, L. Jiang: Graduate School of Chinese Academy of Sciences, Beijing 100049, China 
*S. Zhang, A. H. Meijer, P. B. F. Ouwerkerk: Institute of Biology, Leiden University, P.O. BOX 9505, 2300 RA Leiden, The Netherlands 
*I. Haider, W. Kohlen, H. Bouwmeester. Laboratory of Plant Physiology, Wageningen University, Droevendaalsesteeg 1, 6708 PB Wageningen, The Netherlands 
*H. Schluepmann. Department of Molecular Plant Physiology, Utrecht University, Padualaan 8, 3584 CH Utrecht, The Netherlands 
*A. Agalou, S. Purwantomo, A. Estiati, R. J. de Kam, M. Wang, A. H. Meijer, P. B. F. OuwerkerkInsti: tute of Biology, Clusius Laboratory, Leiden University, P.O. Box 9505, 2300 RA Leiden, The Netherlands. e-mail: p.b.f.ouwerkerk@biology.leidenuniv.nl 

==References==
<references>
* <ref name="ref 1">
Zhang S, Haider I, Kohlen W, Jiang L, Bouwmeester H, et al. Function of the HD-Zip I gene Oshox22 in ABA-mediated drought and salt tolerances in rice. ''Plant Mol Biol.'' 2012 Dec;80(6):571-85.
</ref>
* <ref name="ref 2">
Meijer AH, de Kam RJ, d'Ehrfurth I, Shen W, Hoge JHC. HD-Zip proteins of families I and II from rice: interactions and functional properties. ''Mol Gen Genet.'' 2000 Feb;263(1):12-21.
</ref>
* <ref name="ref 3">
Meijer AH, Ouwerkerk PBF, Hoge JHC. Vectors for transcription factor isolation and target gene identification by means of genetic selection in yeast. ''Yeast.'' 1998;14:1407–1416

</ref>
* <ref name="ref 4">
Agalou A, Purwantomo S, Overnäs E, Johannesson H, et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members. ''Plant Mol Biol.'' 2008 Jan;66(1-2):87-103.
</ref>
</references>

==Structured Information ==

Os10g0127900

2017-03-08T06:32:30Z

Xysj1981:

Please input one-sentence summary here.

==Annotated Information==
===Function===
This study identified an F-box gene, designed OsFbx352, from rice, and characterized its function during seed germination by generating transgenic rice plants with overexpression and knockdown of OsFbx352. More specifically, this study evaluated the role of OsFbx352 in seed germination with emphasis on the interactions
among ABA, OsFbx352, and glucose. The results reveal that OsFbx352 was involved in the regulation of glucose-induced delay of seed germination by modulating ABA metabolism.

===Expression===
1.OsFbx352 encodes a F-box domain protein and is suppressed by glucose
A database search with the predicted polypeptide sequence showed that the F-box domain of OsFBX352 was related to those of the previously identified F-box proteins, including Arabidopsis SON (70% similarity), yeast CDC4 (65% similarity), rice OsDRF (67.5% similarity), and human SKP2 (57.5% similarity) (Fig. 1A). Phylogenetic analysis also revealed that OsFBX352 was closely related to Arabidopsis SON1 and UFO and to rice MAIF (Fig. 1B). These results suggest that OsFBX352 may be involved in the formation of E3 ubiquitin ligase complex.

Fig. 1. OsFbx352 contains a conserved F-box domain.(A) Alignment of the conserved F-box domain in OsFbx352 withother representative F-box-containing proteins: blue indicates residues identical to the OsFbx352 sequence; other colours indicate similar amino acids. The sequence at the bottom is the consensus sequence. (B)Phylogenetic tree analysis of the conserved F-box domain in OsFbx352 with other known F-box proteins from diverse organisms. Alignment and phylogenetic
analysis were performed using clustal x 2 and mega 5, respectively. Approximately 40 amino acids that constitute the
F-box motif in OsFBX352 were aligned with comparable regions from reported F-box proteins in humans (SKP2, BAB87202.1), yeast (CDC4, NP_116585.1), Arabidopsis (COI1, NP_565919; SON1, NP_179323; UFO, NP_564368.1; TIR1, NP_567135.1), and rice (OsMAIF, NP_001047698.1; OsDRF, NP_001052823.1).

2.Generation of transgenic rice plants with altered expression of OsFbx352

To characterize the function of OsFbx352, transgenic rice plants were generated by constructing a RNAi construct with part of the coding sequence fragment to knock down OsFbx352 expression, as well as an overexpression construct with the OsFbx352 full-length open reading frame driven by a maize ubiquitin promoter. Both constructs were introduced into rice calluses via Agrobacterium-mediated transformation. Several transgenic lines were obtained and subsequently confirmed
by qRT-PCR. The expression of OsFbx352 in the overexpression seeds was at least 11-fold higher than that in WT seeds, while OsFbx352 transcripts in seeds of the knockdown lines were reduced by approximately 70% compared with WT seeds (Fig. 2). Among the transgenic lines, two overexpression lines (OE10, OE24) and two knockdown lines (Ri15, Ri18) were selected to study the physiological function of OsFbx352 during seed germination.

Fig. 2. Quantitative real-time PCR analysis of OsFbx352 expression in wild-type (WT), overexpression (OE10, OE11, OE13, OE14, and OE24), and RNAi (Ri6, Ri15, and Ri18) plants. Data are mean ± SE for three replicates. Values above columns are the changes in gene expression relative to the WT.

3.Germination of transgenic seeds displayed different sensitivity to ABA
Given that seed germination is sensitive to ABA and expression of OsFbx352 was strongly induced by ABA, the role of OsFbx352 played in seed germination was evaluated. There were no differences in seed germination among WT and transgenic lines in the control medium, and both WT and transgenic seeds were fully
germinated after 4 days of incubation in the control medium (Fig. 3A). Germination of WT and RNAi4 seeds was delayed when ABA was present in the incubation medium, while germination of seeds with overexpressing OsFbx352 was relatively insensitive to ABA (Fig. 3B). In addition, the inhibitory effect of ABA
on germination of RNAi seeds was more evident than that of WT seeds (Fig. 3B). For instance, both WT and transgenic seeds were germinated after 4 days in the control medium, while the germination rate for WT and RNAi seeds was reduced to approximately 80 and 60%, respectively, after the same period incubation in the
presence of ABA (Fig. 3A, 3B). Moreover, the inhibitory effect of ABA on seed germination of WT and RNAi seeds was increased with an increase in ABA concentrations (Fig. 3C). In addition toseed germination, overexpression of OsFbx352 also rendered the seedlings less sensitive to ABA, as evidenced by longer shoot length of overexpression lines than the WT in the presence of ABA while suppression of OsFbx352 led to a shorter shoot length than the WT.

Fig. 3. OsFbx352-overexpressing seeds exhibited decreased sensitivity to exogenous abscisic acid (ABA). (A, B) Seeds of wild-type (WT), OE10, OE24, Ri15, and Ri18 lines were germinated in control medium (A) or 4 μM ABA (B) for 4 days. (C) Seed germination rate for WT and transgenic rice seeds after incubation in without and with different concentrations of ABA for 4 days. Data are mean ± SE for three replicates with each replicate containing 30 seeds. Statistically significant difference from the wild type within a treatment: *, P < 0.05; **, P < 0.01 (this figure is available in colour at JXB online).

4.Overexpression of OsFbx352 suppressed glucose-induced increase in seed ABA content

To investigate whether the altered sensitivity of seed germination in the OsFbx352-overexpressing and RNAi lines to glucose is related to ABA, changes in ABA contents in seeds of WT, overexpressing and RNAi lines were monitored during imbibition in the absence and presence of glucose. There were no differences in ABA contents in dry seeds among WT, overexpressing, and RNAi lines (Fig. 4). ABA contents in WT, overexpressing, and RNAi seeds were sharply reduced upon imbibition (Fig. 4). Moreover, ABA contents in the imbibed seeds were increased when glucose was present in the incubation medium, and the glucose-induced increase in ABA contents in the overexpressing seeds was significantly lower than in WT seeds, while ABA contents in the RNAi seeds were significantly higher than in WT seeds in the presence of glucose (Fig. 4). In contrast to glucose, addition of the same concentration of mannitol to the incubation medium had no effect on ABA levels in seeds of both WT and transgenic lines (Fig. 4）, discounting the possibility that the glucose-induced increases in ABA levels in seeds are due to osmotic
effect. These results suggest that overexpression of OsFbx352 disrupts glucose-dependent ABA metabolism, thus rendering the germination of overexpressing seeds less sensitive to glucose.

Fig. 4. Effects of water, mannitol, and glucose treatments on endogenous ABA contents in germinating seeds. Seeds were treated with water, mannitol, or glucose for 6 h at 28 °C and were subsequently collected for ABA quantification. Data are mean ± SE with three replicates. Data were statistically analysed with t-test. Statistically significant difference from the wild type within a treatment: *, P < 0.05; **, P < 0.01.

===Evolution===
F-box proteins comprise one of the large protein families in plants. There are more than 692 and 779 F-box genes in the A. thaliana and rice genomes, respectively .Previous studies demonstrated that F-box proteins are involved in the regulation of several biological processes, including circadian clock, self-incompatibility, photomorphogenesis, floral meristem, phytohormonal signalling, and responses to abiotic stresses ; Dreher and Callis, 2007). For instance, the F-box protein TIR1/AFB can bind to the transcriptional repressor protein Aux/IAA, thus promoting their proteasomal degradation and activating auxin-induced transcription. The involvement of F-box proteins in response to both biotic and abiotic stresses has also been reported. For example, four F-box proteins from different species (DOR, OsDRF1, PvFBS1, and MAIF1) have been shown to act as key regulators in responses to biotic and abiotic stress; reported that an F-box protein, ZTL, is a major factor to control the period of circadian and early photomorphogenesis by regulating PRR5 for proteasome-dependent degradation. As a primary sugar, glucose modulates many important physiological processes ranging from seed germination to seedling development.

It has been well documented that the inhibitory effect of sugaron seed germination is due to the increase in the active endogenous ABA level (Arenas-Huertero et . For example, Zhu et al. (2009) reported that a higher ABA content in imbibed seeds may account for the glucose-induced delay of rice seed germination. The present results showing that ABA contents were markedly increased in imbibed seeds of both WT and transgenic lines with altered expression of OsFbx352 when challenged with glucose are in line with those findings reported in the literature. In addition, this study found that the glucose-induced increase in ABA content in the
OsFbx352-overexpressing seeds was lower than in WT seeds, while it was higher in the two RNAi seeds than in WT seeds. These results suggest that overexpression of OsFbx352 disrupts glucose-induced ABA metabolism, thus rendering the germination of overexpressing seeds less sensitive to glucose.

==Labs working on this gene==
State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences,Beijing 100093 PR China.

==References==
1. Song, S., X. Dai, and W.H. Zhang, A rice F-box gene, OsFbx352, is involved in glucose-delayed seed germination in rice. J Exp Bot, 2012. 63(15): p. 5559-68.

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]
== Structured Information ==

Os09g0395300

2017-03-08T06:31:29Z

Xysj1981:

The rice ''SHALLOT-LIKE1'' (''SLL1'') gene, a member of KANADI family, is a key gene controlling rice leaf rolling.

==Annotated Information==
===Function===
[[File: ZhangF1.jpg|right|thumb|100px|Fig 1. ''sll1'' has extremely incurved leaves, with deficiency of sclerenchymatous cells at the abaxial side <ref name="ref1" />.]] [[File: ZhangF3.jpg|right|thumb|100px|Fig 3. Map-based cloning of ''SLL1'', which encodes an MYB transcription factor <ref name="ref1" />.]] [[File: ZhangF8.jpg|right|thumb|100px|Fig 8. ''Sll1'' alters adaxial-abaxial pattern formation <ref name="ref1" />.]]

''SLL1'' arrests normal sclerenchymatous cell formation and controls leaf rolling, controls the establishment of rice leaf polarity, and modulates ohotosynthesis by regulating cell fate <ref name="ref1" />.

To investigate the molecular mechanisms of rice leaf rolling, a rice mutant population (''Oryza sativa'' L. ssp. ''japonica'' variety Nipponbare) generated by ethyl methanesulphonate mutagenesis was screened. Two allelic mutants with extremely incurved leaves were identified, designated as ''sll1-1'' and ''sll1-2'' (Fig. 1A ). ''sll1'', a rice mutant with shallot-like Leaves, displays abnormal sclerenchymatous cell development in the abaxial cell layers, altered mesophyll cell distribution, increased amounts of chlorophyll, and enhanced photosynthesis.

Genetic analysis revealed that the abnormal character of ''sll1'' was controlled by a single recessive gene. To isolate the relevant mutant gene, ''SLL1'' was mapped to the long arm of rice chromosome 9 between markers RM1896 and RM3700. A large F2 mapping population was then generated, allowing the fine-mapping of ''SLL1'' to a 29.57-kb region, using the sequence tagged site and simple sequence repeat markers (Fig. 3A). Three annotated candidate genes, encoding a hypothetical protein, an En/Spm-like transposon, and a transcription factor containing a MYB-like domain, respectively, were located in this region. Further amplification of the relevant DNA fragments and sequence comparison revealed differences in ''sll1-1'' and ''sll1-2'' alleles in the gene encoding the transcription factor containing the MYB-like domain. Comparison with the corresponding genomic sequence revealed that the ''SLL1'' gene consists of six exons and five introns. The gene encodes a 377–amino acid MYB family transcription factor (Fig. 3B). Homologous analysis showed that ''SLL1'' shares high similarity with the KANADI family members in ''Arabidopsis''.

A distinguishing characteristic of the monocot leaf is that microhairs or ligules are present only at the adaxial surface. In ''sll1-1'', the microhairs can be observed on both epidermal surfaces of some plants (Fig. 8A ), and the ligules exist on the abaxial side of the joint (Fig. 8B). This suggests an adaxialized trend in the abaxial epidermis of ''sll1-1'' and indicates the involvement of ''SLL1'' in the development of polarity throughout the leaf abaxial epidermis. ''SLL1'' overexpression resulted in dwarf plants with twisted and abnormal inner rolled leaves. We also observed enlarged phloem in the midrib as well as large and small veins, revealing the enhanced abaxial features of leaves following ''SLL1'' overexpression.

''SLL1'' affected developmental processes in multiple developmental stages, in accordance with its expression patterns. Aside from altered leaf morphology, other tissues, including seeds, anthers, and roots, displayed abnormal development in ''sll1'' mutants (Fig. 10).

===Expression===
Quantitative real-time RT-PCR (qRT-PCR) analysis revealed the expression of ''SLL1'' in various tissues, including roots, stems, leaves, flowers, and seedlings, with relatively high expression in leaf and seedlings (Fig. 5A , top panel). With an emphasis on the leaf, analysis by qRT-PCR showed that ''SLL1'' is ubiquitously expressed in shoot apical meristem (SAM), leaf blade, or leaf sheath at different developmental stages (Figure 5A, bottom panel) <ref name="ref1" />.

To assess the expression pattern comprehensively, β-glucuronidase (GUS) activity was examined histochemically in transgenic plants carrying an ''SLL1'' promoter-GUS reporter gene. Results showed that ''SLL1'' was transcribed in stem (Fig. 5B, panels 1 and 2), anthers of young or mature flowers (Fig. 5B, panels 3 to 5), pistil tip (Fig. 5B, panel 6), glume (Fig. 5B, panel 7), vascular tissues of mature seeds (Fig. 5B, panels 8 and 9), coleoptile and embryonic root of germinating seedlings (Fig. 5B, panel 10), and root vascular tissues (Fig. 5B, panel 11). In addition, ''SLL1'' is highly transcribed in leaf veins and leaf sheath (Fig. 5C, panels 1 to 3), guard cells, and tracheal elements (Fig. 5C, panels 4 and 5).

The spatial and temporal localization of ''SLL1'' during leaf development was further examined by in situ hybridization analysis. The mRNA expression of ''SLL1'' was detected throughout the young leaf primordium (plastochrons 1 to 3) and was more intense in abaxial cell layer through leaf development (plastochrons 4 and 5) (Fig. 5D, panel 2). However, the ''SLL1'' transcript did not demonstrate apical/basal polarity and did not accumulate at the apex of the meristem (Fig.e 5D, panel 3). Cross-section analysis of the shoot apex showed that ''SLL1'' was more highly expressed in the abaxial cell layer, including the epidermis and vasculature of the early leaf blade (Fig. 5D, panels 5 and 6). In the mature leaf, ''SLL1'' mainly accumulated at the abaxial epidermis, abaxial mesophyll cells, and vasculature (Fig. 5D, panels 8 and 9). In contrast with the sense probe (Fig. 5D, panels 4 and 7), ''SLL1'' was transcribed at a relatively low level throughout other leaf positions including the adaxial epidermis (Fig. 5D, panels 5 and 6).

===Evolution===

==Labs working on this gene==
*State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, Zhejiang, China
*National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China

==References==
<references>
<ref name="ref1">Zhang GH, et al. (2009) ''SHALLOT-LIKE1'' is a KANADI transcription factor that modulates rice leaf rolling by regulating leaf abaxial cell development. The Plant Cell Online 21: 719-735.</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 9]]
[[Category:Chromosome 9]]

Os09g0395300

2017-03-08T06:31:08Z

Xysj1981:

The rice ''SHALLOT-LIKE1'' (''SLL1'') gene, a member of KANADI family, is a key gene controlling rice leaf rolling.

==Annotated Information==
===Function===
[[File: ZhangF1.jpg|right|thumb|100px|Fig 1. ''sll1'' has extremely incurved leaves, with deficiency of sclerenchymatous cells at the abaxial side <ref name="ref1" />.]] [[File: ZhangF3.jpg|right|thumb|100px|Fig 3. Map-based cloning of ''SLL1'', which encodes an MYB transcription factor <ref name="ref1" />.]] [[File: ZhangF8.jpg|right|thumb|100px|Fig 8. ''Sll1'' alters adaxial-abaxial pattern formation <ref name="ref1" />.]]

''SLL1'' arrests normal sclerenchymatous cell formation and controls leaf rolling, controls the establishment of rice leaf polarity, and modulates ohotosynthesis by regulating cell fate <ref name="ref1" />.

To investigate the molecular mechanisms of rice leaf rolling, a rice mutant population (''Oryza sativa'' L. ssp. ''japonica'' variety Nipponbare) generated by ethyl methanesulphonate mutagenesis was screened. Two allelic mutants with extremely incurved leaves were identified, designated as ''sll1-1'' and ''sll1-2'' (Fig. 1A ). ''sll1'', a rice mutant with shallot-like Leaves, displays abnormal sclerenchymatous cell development in the abaxial cell layers, altered mesophyll cell distribution, increased amounts of chlorophyll, and enhanced photosynthesis.

Genetic analysis revealed that the abnormal character of ''sll1'' was controlled by a single recessive gene. To isolate the relevant mutant gene, ''SLL1'' was mapped to the long arm of rice chromosome 9 between markers RM1896 and RM3700. A large F2 mapping population was then generated, allowing the fine-mapping of ''SLL1'' to a 29.57-kb region, using the sequence tagged site and simple sequence repeat markers (Fig. 3A). Three annotated candidate genes, encoding a hypothetical protein, an En/Spm-like transposon, and a transcription factor containing a MYB-like domain, respectively, were located in this region. Further amplification of the relevant DNA fragments and sequence comparison revealed differences in ''sll1-1'' and ''sll1-2'' alleles in the gene encoding the transcription factor containing the MYB-like domain. Comparison with the corresponding genomic sequence revealed that the ''SLL1'' gene consists of six exons and five introns. The gene encodes a 377–amino acid MYB family transcription factor (Fig. 3B). Homologous analysis showed that ''SLL1'' shares high similarity with the KANADI family members in ''Arabidopsis''.

A distinguishing characteristic of the monocot leaf is that microhairs or ligules are present only at the adaxial surface. In ''sll1-1'', the microhairs can be observed on both epidermal surfaces of some plants (Fig. 8A ), and the ligules exist on the abaxial side of the joint (Fig. 8B). This suggests an adaxialized trend in the abaxial epidermis of ''sll1-1'' and indicates the involvement of ''SLL1'' in the development of polarity throughout the leaf abaxial epidermis. ''SLL1'' overexpression resulted in dwarf plants with twisted and abnormal inner rolled leaves. We also observed enlarged phloem in the midrib as well as large and small veins, revealing the enhanced abaxial features of leaves following ''SLL1'' overexpression.

''SLL1'' affected developmental processes in multiple developmental stages, in accordance with its expression patterns. Aside from altered leaf morphology, other tissues, including seeds, anthers, and roots, displayed abnormal development in ''sll1'' mutants (Fig. 10).

===Expression===
[[File: ZhangF5.jpg|right|thumb|100px|Fig 5. ''SLL1'' expression pattern analysis <ref name="ref1" />.]]

Quantitative real-time RT-PCR (qRT-PCR) analysis revealed the expression of ''SLL1'' in various tissues, including roots, stems, leaves, flowers, and seedlings, with relatively high expression in leaf and seedlings (Fig. 5A , top panel). With an emphasis on the leaf, analysis by qRT-PCR showed that ''SLL1'' is ubiquitously expressed in shoot apical meristem (SAM), leaf blade, or leaf sheath at different developmental stages (Figure 5A, bottom panel) <ref name="ref1" />.

To assess the expression pattern comprehensively, β-glucuronidase (GUS) activity was examined histochemically in transgenic plants carrying an ''SLL1'' promoter-GUS reporter gene. Results showed that ''SLL1'' was transcribed in stem (Fig. 5B, panels 1 and 2), anthers of young or mature flowers (Fig. 5B, panels 3 to 5), pistil tip (Fig. 5B, panel 6), glume (Fig. 5B, panel 7), vascular tissues of mature seeds (Fig. 5B, panels 8 and 9), coleoptile and embryonic root of germinating seedlings (Fig. 5B, panel 10), and root vascular tissues (Fig. 5B, panel 11). In addition, ''SLL1'' is highly transcribed in leaf veins and leaf sheath (Fig. 5C, panels 1 to 3), guard cells, and tracheal elements (Fig. 5C, panels 4 and 5).

The spatial and temporal localization of ''SLL1'' during leaf development was further examined by in situ hybridization analysis. The mRNA expression of ''SLL1'' was detected throughout the young leaf primordium (plastochrons 1 to 3) and was more intense in abaxial cell layer through leaf development (plastochrons 4 and 5) (Fig. 5D, panel 2). However, the ''SLL1'' transcript did not demonstrate apical/basal polarity and did not accumulate at the apex of the meristem (Fig.e 5D, panel 3). Cross-section analysis of the shoot apex showed that ''SLL1'' was more highly expressed in the abaxial cell layer, including the epidermis and vasculature of the early leaf blade (Fig. 5D, panels 5 and 6). In the mature leaf, ''SLL1'' mainly accumulated at the abaxial epidermis, abaxial mesophyll cells, and vasculature (Fig. 5D, panels 8 and 9). In contrast with the sense probe (Fig. 5D, panels 4 and 7), ''SLL1'' was transcribed at a relatively low level throughout other leaf positions including the adaxial epidermis (Fig. 5D, panels 5 and 6).

===Evolution===

==Labs working on this gene==
*State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, Zhejiang, China
*National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200032, China

==References==
<references>
<ref name="ref1">Zhang GH, et al. (2009) ''SHALLOT-LIKE1'' is a KANADI transcription factor that modulates rice leaf rolling by regulating leaf abaxial cell development. The Plant Cell Online 21: 719-735.</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 9]]
[[Category:Chromosome 9]]

Os07g0616800

2017-03-08T06:29:28Z

Xysj1981:

Please input one-sentence summary here.
===characteristic===
The current work <ref name="ref1" /> confirms that six genes comprise the entire rice Sucrose synthase (SUS) gene family. [[File:picture1 The Sus gene family in rice.jpg|right|thumb|150px|''picture1. Rice Sus gene family is comprised of six genes (from reference <ref name="ref1" />).'']] It is obvious to note that each of the SUS genes is present on a separate chromosome, except SUS1 and 4 which are both located on chromosome. SUS3 is situated on chromosome 7.
Analysis of gene structure for the six rice Sus genes [[File:picture2 Gene structure of the six SUS genes.jpg|right|thumb|150px|''picture2. Analysis of gene structure for the six rice Sus genes (from reference <ref name="ref1" />).'']] revealed that the genes typically consist of 14 or 15 exons. SUS3 is consisted of 15 exons similar to SUS2 and SUS4.
Properties of the six predicted rice Sus proteins are shown in picture3. [[File:Comparison of the predicted rice Sus proteins as deduced from their cDNA sequences.jpg|right|thumb|150px|''picture3. Properties of the six predicted rice Sus proteins (from reference <ref name="ref1" />).'']] A multiple sequence alignment analysis of the six rice sequences with Sus peptide sequences from other plant species revealed that the six rice Sus peptides can be classified into the three groups as suggested by Komatsu et al., namely Sus1 group (SUS1, 2 and 3), SusA group (SUS4), New Group (NG;SUS5 and 6). The predicted molecular weights of the six polypeptides are very close ranging from 92.1 to 96.5 kDa, with SUS3 being 93.2kDa. High levels of similarity exist between the predicted amino acid sequences of SUS1-4, ranging between 89 and 68%. The similarity between SUS3 and SUS1, SUS2, SUS4, SUS5 SUS6 are 89%, 79%, 68%, 53%, 52%, respectively. The predicted isoelectric point of SUS3 is somewhat lower (pI 5.94) than those of the other family members which range from 6.03 (SUS6) to 7.73 (SUS5) except indistinguishably with SUS2 (pI 5.93).

===Function===
In higher plants sucrose is the major form in which carbohydrate is transported from photosynthetic source tissues to sink tissues, and its subsequent cleavage in the sink tissues is the first step for utilization of the photoassimilate in various metabolic pathways. Sucrose synthase (Sus) plays a major role(s) in sucrose metabolism in a number of different growth processes within a variety of sink tissues. Sus catalyzes a reaction of sucrose and UDP to form fructose and UDPG, the latter being a precursor of complex saccharide biosynthesis. Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme. In addition to these major roles in sink tissue metabolism, Sus gene expression has also been reported to be induced in response to environmental stresses such as hypoxia and cold. Further roles for Sus were proposed in other important metabolic processes including nitrogen fixation in legume nodules and phloem loading and/or unloading.
Specially, rice sucrose synthase 3(RSUS3) has its own role in sucrose metabolism. First, Tatsuro Hirose et al <ref name="ref1" /> and Wang et al <ref name="ref2" /> suggest that SUS3 play a catalyzed reaction when the RSUS1 which is rich in the phloem and aleurone layers of the seeds, transport sugar into the endosperm cells. Second, RSUS3 is expressed predominantly in rice seed endosperm and is thought to play an important role in starch filling during the milky stage of rice seed ripening <ref name="ref3" />. Third, SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain and participated in the cleavage of sucrose, taken up by aleurone, thus providing the precursors for starch synthesis. <ref name="ref1" />

===Expression===
Wang et al <ref name="ref2" /> used the mono-specific antibodies for three RSuS isoforms and found differentially and developmentally regulated expression of three rice sucroce synthase genes. The expression of RSuS3 could only be detected in the seeds in etiolated seedlings.[[File:picture. 4 Distribution of RSuS isozymes in various rice tissues.jpg|right|thumb|150px|''picture 4. Distribution of RSuS isozymes in various rice tissues (from reference <ref name="ref2" />).'']] However, researchers found temporal expression of RSus3 genes in developing seeds. RSuS3 was barely detectable before 3 DAP and reached a plateau from 6 to 12 DAP, or the milky stage in which the starch filling in the endosperm was the most active.[[File:picture.5 Temporal expression of RSuS in seeds at various maturation stages.jpg|right|thumb|150px|''picture 5. Temporal expression of RSuS in seeds at various maturation stages (from reference <ref name="ref2" />).'']]
Tatsuro Hirose et al <ref name="ref1" /> used Real-time RT-PCR to determine the expression profile for each member of the Sus gene family in various tissues of rice and found tissue-specific expression of each member of the Sus gene family. The transcript of SUS3 was most abundant in either the panicles at the grain filling stage of development or dry seeds respectively, and was absent from or expressed only at very low levels in the other tissues examined.[[File:picture.6A The transcript levels of the SUS genes in various rice tissues.jpg|right|thumb|150px|''picture 6A. The transcript levels of the SUS genes in various rice tissues (from reference <ref name="ref1" />).'']] Furthermore, to investigate the response of the SUS genes to submergence, their transcript levels were determined in the shoots of seedlings, germinated under submerged conditions, during a developmental time-course from 3 to 7 days after imbibition (DAI). The SUS3 transcript was not detectable in both control and submerged samples.[[File:picture.9 Sus activity and transcript levels of four of the rice SUS genes in germinating shoots in response to submergence.jpg|right|thumb|150px|''picture 9.Sus activity and transcript levels of four of the rice SUS genes in germinating shoots in response to submergence <ref name="ref1" />).'']]

===Nucleotide Polymorphisms===
Nucleotide changes and indels at the RSUS3 locus were identified, and the results are summarized in picture 10.Puji Lestari <ref name="ref3" /> analyzed the full sequence of RSUS3 from 43 rice varieties consisting of 13 indica varieties, 22 japonica varieties, and 8 wild rice accessions( Oryza rufipogon) to examine the distribution of DNA polymorphisms, revealed allelic diversity at the RSUS3 locus. Sequence polymorphisms were detected across the length of 7733 bp, which covers a 1652 bp upstream region, a 2815 bp coding region, a 2724 bp noncoding region, and a 542 bp downstream region. No triallelic SNPs were found in any of the defined regions. The frequency of SNPs/indels was highest in the promoter region. The 3’ NTR contained abundant nucleotide and length polymorphisms (frequency of total variants 50.041). However, the overall indel frequency in the transcribed region was higher than the nucleotide substitution frequency in the region. The SNP frequency in the coding region was less than the average of SNP frequency in the entire transcribed region; one SNP occurred every 216.5 bp in the coding region. The frequency of nucleotide substitutions was about 1.6 times higher in the noncoding region than in the coding region, and both nucleotide changes and indels were more frequent in the noncoding region than in the coding region. The differences in the distribution of the differences in the lengths of the indels in all regions varied in size from 1 to 32 bp, with an average indel length of 2.87 bp. The distribution of SNP and indel sites was not significantly different (when degrees of freedom =2, SNPs χ2=0.228; indels χ2=0.377) across the entire region excluding intron (5’ NTR-transcript-3’ NTR).

===Allele Distribution===
Puji Lestari <ref name="ref3" /> adopted Tajima’s D test and Fu and Li’s D* and F* tests to evaluate the allele distribution in the germplasm used in this study and assess the neutrality of the mutations. The frequency spectrum of polymorphic sites for the total length was skewed toward a deficit of low-frequency alleles relative to expectations based on a positive outcome by Tajima’s D test (0.923). The Tajima’s D value for the total region of RSUS3 excluding intron was lower than that for the entire length. Separate Tajima’s D tests for each region (upstream, coding, and noncoding region) revealed positive and nonsignificant departures from the neutral expectation, with the exception of the 3’ downstream NTR, which had a negative Tajima’s D value (D = -0.326). Using the coalescent process to test the neutrality of the mutations in the entire gene sequence, similar positive values were obtained, but significant deviation from the neutral expectation (P <0.02) occurred with the Fu and Li D* (1.959) and F* (1.894) tests. A summary of this neutrality test is presented in picture 11.

===Recombination===
Puji Lestari <ref name="ref3" /> used the algorithm of Hudson and Kaplan to determine that at least 11 recombination events were responsible for the polymorphism pattern identified in the RSUS3 gene. The recombinations were detected in the informative sites of the 3 regions: a minimum of 3 recombinations in the 5’ NTR (-1639 to -1630, -1594 to -1588, and -679 to -600), 4 in the transcribed region (1072–2734, 2734–3305, 4117–4148, and 4148–4572), 1 in the position between the transcribed region and the downstream region (4572–5627), and 3 in the 3’ NTR (5627–5923, 6041–6050, and 6050–6055). A total of 48 polymorphic sites in the entire region without intron were analyzed for evidence of recombination.

===Evolution===
Sequence analysis revealed that RSUS2 and RSUS3 may have evolved from the same ancestor after the divergence of RSUS1.

==Labs working on this gene==
* National Agricultural Research Center,1-2-1 Inada, Joetsu, Niigata 943-0193, Japan
* CSIRO Plant Industry, GPO Box 1600, Canberra, ACT 2601, Australia
* Department of Agricultural Chemistry, National Taiwan University, Taipei, Taiwan 106, R.O.C.
* Department of Agronomy, National Taiwan University, Taipei, Taiwan 106, R.O.C.
* The Department of Plant Science, Plant Genomics and Breeding Institute, and Research Institute of Agriculture and Life Sciences, Seoul National University, Seoul 151-921, Korea
* The National Academy of Agricultural Sciences, Rural Development Administration, Suwon, Korea
* The Indonesian Center for Agricultural Biotechnology and Genetic Resources Research and Development, Bogor, Indonesia

==References==
<references>
* <ref name="ref1">
Hirose T, Scofield GN, Terao T. An expression analysis profile for the entire sucrose synthase gene family in rice[J]. Plant Sci, 2008, 174:534–543.</ref>
* <ref name="ref2">
Puji Lestari, Gian Lee, Tae-Ho Ham, Reflinur, Mi-Ok Woo, Rihua Piao, Wemzhu Jiang, Sang Ho Chu, Joohyun Lee, Hee-Jong Koh. Single Nucleotide Polymorphisms and Haplotype Diversity in RiceSucrose Synthase 3[J]. Journal of Heredity, 2011, 102:735-746.</ref>
* <ref name="ref3">
Ai-Yu <Wang, Mau-Han Kao, Wei-Horng Yang, Yiyang Sayion, Li-fei Liu, Ping-Du Lee, Jong-Ching Su. Differentially and developmentally regulated expression of three rice sucrose synthase genes[J]. Plant Cell Phyisol, 1999, 40:800–807.</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

Os07g0616800

2017-03-08T06:28:31Z

Xysj1981:

Please input one-sentence summary here.
===characteristic===
The current work <ref name="ref1" /> confirms that six genes comprise the entire rice Sucrose synthase (SUS) gene family. [[File:picture1 The Sus gene family in rice.jpg|right|thumb|150px|''picture1. Rice Sus gene family is comprised of six genes (from reference <ref name="ref1" />).'']] It is obvious to note that each of the SUS genes is present on a separate chromosome, except SUS1 and 4 which are both located on chromosome. SUS3 is situated on chromosome 7.
Analysis of gene structure for the six rice Sus genes [[File:picture2 Gene structure of the six SUS genes.jpg|right|thumb|150px|''picture2. Analysis of gene structure for the six rice Sus genes (from reference <ref name="ref1" />).'']] revealed that the genes typically consist of 14 or 15 exons. SUS3 is consisted of 15 exons similar to SUS2 and SUS4.
Properties of the six predicted rice Sus proteins are shown in picture3. [[File:Comparison of the predicted rice Sus proteins as deduced from their cDNA sequences.jpg|right|thumb|150px|''picture3. Properties of the six predicted rice Sus proteins (from reference <ref name="ref1" />).'']] A multiple sequence alignment analysis of the six rice sequences with Sus peptide sequences from other plant species revealed that the six rice Sus peptides can be classified into the three groups as suggested by Komatsu et al., namely Sus1 group (SUS1, 2 and 3), SusA group (SUS4), New Group (NG;SUS5 and 6). The predicted molecular weights of the six polypeptides are very close ranging from 92.1 to 96.5 kDa, with SUS3 being 93.2kDa. High levels of similarity exist between the predicted amino acid sequences of SUS1-4, ranging between 89 and 68%. The similarity between SUS3 and SUS1, SUS2, SUS4, SUS5 SUS6 are 89%, 79%, 68%, 53%, 52%, respectively. The predicted isoelectric point of SUS3 is somewhat lower (pI 5.94) than those of the other family members which range from 6.03 (SUS6) to 7.73 (SUS5) except indistinguishably with SUS2 (pI 5.93).

===Function===
In higher plants sucrose is the major form in which carbohydrate is transported from photosynthetic source tissues to sink tissues, and its subsequent cleavage in the sink tissues is the first step for utilization of the photoassimilate in various metabolic pathways. Sucrose synthase (Sus) plays a major role(s) in sucrose metabolism in a number of different growth processes within a variety of sink tissues. Sus catalyzes a reaction of sucrose and UDP to form fructose and UDPG, the latter being a precursor of complex saccharide biosynthesis. Sus is also proposed to supply UDP-glucose for cellulose synthesis in the cell wall, and in cotton fiber which is supported by experimental evidence from antisense suppression of the enzyme. In addition to these major roles in sink tissue metabolism, Sus gene expression has also been reported to be induced in response to environmental stresses such as hypoxia and cold. Further roles for Sus were proposed in other important metabolic processes including nitrogen fixation in legume nodules and phloem loading and/or unloading.
Specially, rice sucrose synthase 3(RSUS3) has its own role in sucrose metabolism. First, Tatsuro Hirose et al <ref name="ref1" /> and Wang et al <ref name="ref2" /> suggest that SUS3 play a catalyzed reaction when the RSUS1 which is rich in the phloem and aleurone layers of the seeds, transport sugar into the endosperm cells. Second, RSUS3 is expressed predominantly in rice seed endosperm and is thought to play an important role in starch filling during the milky stage of rice seed ripening <ref name="ref3" />. Third, SUS3 and SUS4 were predominantly expressed in the caryopsis, indicating potential roles in carbon allocation within the filling grain and participated in the cleavage of sucrose, taken up by aleurone, thus providing the precursors for starch synthesis. <ref name="ref1" />

===Expression===
Wang et al <ref name="ref2" /> used the mono-specific antibodies for three RSuS isoforms and found differentially and developmentally regulated expression of three rice sucroce synthase genes. The expression of RSuS3 could only be detected in the seeds in etiolated seedlings.[[File:picture. 4 Distribution of RSuS isozymes in various rice tissues.jpg|right|thumb|150px|''picture 4. Distribution of RSuS isozymes in various rice tissues (from reference <ref name="ref2" />).'']] However, researchers found temporal expression of RSus3 genes in developing seeds. RSuS3 was barely detectable before 3 DAP and reached a plateau from 6 to 12 DAP, or the milky stage in which the starch filling in the endosperm was the most active.[[File:picture.5 Temporal expression of RSuS in seeds at various maturation stages.jpg|right|thumb|150px|''picture 5. Temporal expression of RSuS in seeds at various maturation stages (from reference <ref name="ref2" />).'']]
Tatsuro Hirose et al <ref name="ref1" /> used Real-time RT-PCR to determine the expression profile for each member of the Sus gene family in various tissues of rice and found tissue-specific expression of each member of the Sus gene family. The transcript of SUS3 was most abundant in either the panicles at the grain filling stage of development or dry seeds respectively, and was absent from or expressed only at very low levels in the other tissues examined.[[File:picture.6A The transcript levels of the SUS genes in various rice tissues.jpg|right|thumb|150px|''picture 6A. The transcript levels of the SUS genes in various rice tissues (from reference <ref name="ref1" />).'']] Furthermore, to investigate the response of the SUS genes to submergence, their transcript levels were determined in the shoots of seedlings, germinated under submerged conditions, during a developmental time-course from 3 to 7 days after imbibition (DAI). The SUS3 transcript was not detectable in both control and submerged samples.[[File:picture.9 Sus activity and transcript levels of four of the rice SUS genes in germinating shoots in response to submergence.jpg|right|thumb|150px|''picture 9.Sus activity and transcript levels of four of the rice SUS genes in germinating shoots in response to submergence <ref name="ref1" />).'']]

===Nucleotide Polymorphisms===
Nucleotide changes and indels at the RSUS3 locus were identified, and the results are summarized in picture 10. [[File: picture 10. Summary of the frequency of polymorphisms.jpg|right|thumb|150px|''picture10. Summary of the frequency of polymorphisms (from reference <ref name="ref3" />).'']] Puji Lestari <ref name="ref3" /> analyzed the full sequence of RSUS3 from 43 rice varieties consisting of 13 indica varieties, 22 japonica varieties, and 8 wild rice accessions( Oryza rufipogon) to examine the distribution of DNA polymorphisms, revealed allelic diversity at the RSUS3 locus. Sequence polymorphisms were detected across the length of 7733 bp, which covers a 1652 bp upstream region, a 2815 bp coding region, a 2724 bp noncoding region, and a 542 bp downstream region. No triallelic SNPs were found in any of the defined regions. The frequency of SNPs/indels was highest in the promoter region. The 3’ NTR contained abundant nucleotide and length polymorphisms (frequency of total variants 50.041). However, the overall indel frequency in the transcribed region was higher than the nucleotide substitution frequency in the region. The SNP frequency in the coding region was less than the average of SNP frequency in the entire transcribed region; one SNP occurred every 216.5 bp in the coding region. The frequency of nucleotide substitutions was about 1.6 times higher in the noncoding region than in the coding region, and both nucleotide changes and indels were more frequent in the noncoding region than in the coding region. The differences in the distribution of the differences in the lengths of the indels in all regions varied in size from 1 to 32 bp, with an average indel length of 2.87 bp. The distribution of SNP and indel sites was not significantly different (when degrees of freedom =2, SNPs χ2=0.228; indels χ2=0.377) across the entire region excluding intron (5’ NTR-transcript-3’ NTR).

===Allele Distribution===
Puji Lestari <ref name="ref3" /> adopted Tajima’s D test and Fu and Li’s D* and F* tests to evaluate the allele distribution in the germplasm used in this study and assess the neutrality of the mutations. The frequency spectrum of polymorphic sites for the total length was skewed toward a deficit of low-frequency alleles relative to expectations based on a positive outcome by Tajima’s D test (0.923). The Tajima’s D value for the total region of RSUS3 excluding intron was lower than that for the entire length. Separate Tajima’s D tests for each region (upstream, coding, and noncoding region) revealed positive and nonsignificant departures from the neutral expectation, with the exception of the 3’ downstream NTR, which had a negative Tajima’s D value (D = -0.326). Using the coalescent process to test the neutrality of the mutations in the entire gene sequence, similar positive values were obtained, but significant deviation from the neutral expectation (P <0.02) occurred with the Fu and Li D* (1.959) and F* (1.894) tests. A summary of this neutrality test is presented in picture 11. [[File: picture 11. Nucleotide diversity and divergence in each region of the RSUS3 gene.jpg|right|thumb|150px|''picture11. Nucleotide diversity and divergence in each region of theRSUS3gene (from reference <ref name="ref3" />).'']]

===Haplotype Diversity===
Some researchers predicted initially the number of haplotypes of RSUS3 using the coalescent theory. The predicted haplotype numbers for each functional part of the promoter, transcript, and downstream region were 17, 12, and 12, respectively. The highest haplotype diversity (Hd: 0.866) was observed in the promoter region, and the lowest Hd (0.828) was observed in the downstream region. Puji Lestari <ref name="ref3" /> analyzed the entire region excluding intron revealed that the nucleotide diversity ranged from 1.645 to 1.801, and the estimated haplotype number was from 10 to 22. Finally, using bootstrap analysis, the genealogy of the sequences containing 11 major highly differentiated haplotypes groups across the region of 5’ NTR-transcript-3’ NTR was successfully assembled. They constructed a neighbor joining tree to illustrate the phylogenetic branching order between the 5’ NTR transcript-3’ NTR and to elucidate the evolutionary history(picture 12).[[File:picture 12 Neighbor joining tree representing the RSUS3 haplotype relationships based on the entire region excluding intron (upstream, transcript, and 3' downstream NTR sequence).jpg|right|thumb|150px|''picture 12. Neighbor joining tree representing the RSUS3 haplotype relationships based on the entire region excluding intron (upstream, transcript, and 3' downstream NTR sequence) (from reference <ref name="ref3" />).'']]

===Recombination===
Puji Lestari <ref name="ref3" /> used the algorithm of Hudson and Kaplan to determine that at least 11 recombination events were responsible for the polymorphism pattern identified in the RSUS3 gene. The recombinations were detected in the informative sites of the 3 regions: a minimum of 3 recombinations in the 5’ NTR (-1639 to -1630, -1594 to -1588, and -679 to -600), 4 in the transcribed region (1072–2734, 2734–3305, 4117–4148, and 4148–4572), 1 in the position between the transcribed region and the downstream region (4572–5627), and 3 in the 3’ NTR (5627–5923, 6041–6050, and 6050–6055). A total of 48 polymorphic sites in the entire region without intron were analyzed for evidence of recombination.

===Evolution===
Sequence analysis revealed that RSUS2 and RSUS3 may have evolved from the same ancestor after the divergence of RSUS1.

==Labs working on this gene==
* National Agricultural Research Center,1-2-1 Inada, Joetsu, Niigata 943-0193, Japan
* CSIRO Plant Industry, GPO Box 1600, Canberra, ACT 2601, Australia
* Department of Agricultural Chemistry, National Taiwan University, Taipei, Taiwan 106, R.O.C.
* Department of Agronomy, National Taiwan University, Taipei, Taiwan 106, R.O.C.
* The Department of Plant Science, Plant Genomics and Breeding Institute, and Research Institute of Agriculture and Life Sciences, Seoul National University, Seoul 151-921, Korea
* The National Academy of Agricultural Sciences, Rural Development Administration, Suwon, Korea
* The Indonesian Center for Agricultural Biotechnology and Genetic Resources Research and Development, Bogor, Indonesia

==References==
<references>
* <ref name="ref1">
Hirose T, Scofield GN, Terao T. An expression analysis profile for the entire sucrose synthase gene family in rice[J]. Plant Sci, 2008, 174:534–543.</ref>
* <ref name="ref2">
Puji Lestari, Gian Lee, Tae-Ho Ham, Reflinur, Mi-Ok Woo, Rihua Piao, Wemzhu Jiang, Sang Ho Chu, Joohyun Lee, Hee-Jong Koh. Single Nucleotide Polymorphisms and Haplotype Diversity in RiceSucrose Synthase 3[J]. Journal of Heredity, 2011, 102:735-746.</ref>
* <ref name="ref3">
Ai-Yu <Wang, Mau-Han Kao, Wei-Horng Yang, Yiyang Sayion, Li-fei Liu, Ping-Du Lee, Jong-Ching Su. Differentially and developmentally regulated expression of three rice sucrose synthase genes[J]. Plant Cell Phyisol, 1999, 40:800–807.</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

RiceWiki:Curated Genes

2017-03-08T06:27:37Z

Xysj1981:

{|class="wikitable sortable" style="width:90%;text-align:center"
|-
!'''Gene Symbol'''
!'''RAP-DB-ID'''
!'''Total Contribution Score'''
!'''Summed Edit Quantity'''
!'''Averaged Edit Quality'''
!'''Contributor Count'''
!'''Edit Count*'''
!'''Last Edit Time'''
|-
|[[Os09g0114500|'''''BC12''''']]
|[[Os09g0114500]]
| 14.854
| 23746
| 0.626
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os10g0405500|'''''PAIR3''''']]
|[[Os10g0405500]]
| 10.742
| 10877
| 0.988
| 3
| 3
| 2014/6/8 23:39
|-
|[[Os09g0286400|'''''OsNHX5''''']]
|[[Os09g0286400]]
| 12.133
| 24113
| 0.503
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0306400|'''''OsbZIP71''''']]
|[[Os09g0306400]]
| 7.71
| 12551
| 0.614
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0417600|'''''OsWRKY76''''']]
|[[Os09g0417600]]
| 5.713
| 10209
| 0.56
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os09g0434200|'''''OsDSG1''''']]
|[[Os09g0434200]]
| 5.792
| 11879
| 0.488
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os10g0553300|'''''OsTPP2''''']]
|[[Os10g0553300]]
| 8.403
| 35721
| 0.235
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os10g0563600|'''''OsMSRA4.1''''']]
|[[Os10g0563600]]
| 7.778
| 13380
| 0.581
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0127600|'''''ONAC045''''']]
|[[Os11g0127600]]
| 7.065
| 12576
| 0.562
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os11g0648000|'''''OsNHX3''''']]
|[[Os11g0648000]]
| 7.638
| 15767
| 0.484
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os12g0569700|'''''OsHsp23.7''''']]
|[[Os12g0569700]]
| 6.412
| 13859
| 0.463
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os12g0583700|'''''ZFP252''''']]
|[[Os12g0583700]]
| 8.489
| 12862
| 0.66
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os08g0139000|'''''OsDEG10''''']]
|[[Os08g0139000]]
| 4.811
| 9008
| 0.534
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os08g0323700|'''''OsCCC1''''']]
|[[Os08g0323700]]
| 6.709
| 11315
| 0.593
| 2
| 2
| 2015/6/12 17:29
|-
|[[Os08g0441100|'''''OsCIPK06''''']]
|[[Os08g0441100]]
| 3.819
| 7418
| 0.515
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os08g0504700|'''''OsSAP11''''']]
|[[Os08g0504700]]
| 7.149
| 10763
| 0.664
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0540400|'''''OsCPK21''''']]
|[[Os08g0540400]]
| 10.561
| 19732
| 0.535
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os08g0546800|'''''OsHsfB2b''''']]
|[[Os08g0546800]]
| 12.399
| 23039
| 0.538
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os07g0186000|'''''OsTRXh1''''']]
|[[Os07g0186000]]
| 7.817
| 12275
| 0.637
| 2
| 2
| 2015/6/12 16:34
|-
|[[Os07g0556800|'''''OSRIP18''''']]
|[[Os07g0556800]]
| 8.473
| 12924
| 0.656
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os07g0666900|'''''OsNHX1''''']]
|[[Os07g0666900]]
| 11.455
| 21522
| 0.532
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0678600|'''''OsCIPK2''''']]
|[[Os07g0678600]]
| 5.575
| 11240
| 0.496
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0693800|'''''OsFAD8''''']]
|[[Os07g0693800]]
| 5.613
| 11290
| 0.497
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os06g0130100|'''''OsSIK1''''']]
|[[Os06g0130100]]
| 11.48
| 22964
| 0.5
| 2
| 2
| 2015/6/12 16:04
|-
|[[Os06g0472000|'''''OsMSRB1.1''''']]
|[[Os06g0472000]]
| 6.592
| 12098
| 0.545
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os06g0561000|'''''OsMIOX''''']]
|[[Os06g0561000]]
| 6.249
| 12468
| 0.501
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os06g0603600|'''''OsSPX1''''']]
|[[Os06g0603600]]
| 7.774
| 15383
| 0.505
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os06g0612800|'''''OsiSAP8''''']]
|[[Os06g0612800]]
| 8.934
| 14002
| 0.638
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0644200|'''''OVP1''''']]
|[[Os06g0644200]]
| 10.007
| 15443
| 0.648
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0651100|'''''YK1''''']]
|[[Os06g0651100]]
| 8.803
| 18547
| 0.475
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0662200|'''''OsbZIP52''''']]
|[[Os06g0662200]]
| 6.942
| 12388
| 0.56
| 2
| 2
| 2015/6/12 16:22
|-
|[[Os06g0727200|'''''OsCATB''''']]
|[[Os06g0727200]]
| 6.864
| 13184
| 0.521
| 2
| 2
| 2015/6/12 16:27
|-
|[[Os03g0117900|'''''HYR''''']]
|[[Os03g0117900]]
| 5.381
| 8815
| 0.61
| 2
| 2
| 2015/6/12 12:59
|-
|[[Os09g0457900|'''''OsEATB''''']]
|[[Os09g0457900]]
| 42.219
| 42219
| 1
| 1
| 1
| 2014/6/6 14:12
|-
|[[Os06g0208800|'''''LYP6''''']]
|[[Os06g0208800]]
| 35.205
| 40853
| 0.862
| 2
| 2
| 2015/6/12 16:09
|-
|'''''[[GW5]]'''''
|
| 31.812
| 31817
| 1
| 2
| 2
| 2014/6/8 22:47
|-
|[[Os03g0122600|'''''OsMADS50''''']]
|[[Os03g0122600]]
| 31.778
| 36672
| 0.867
| 2
| 2
| 2015/6/12 13:00
|-
|'''''[[Du1]]'''''
|
| 26.789
| 26797
| 1
| 2
| 2
| 2014/6/5 11:51
|-
|[[Os01g0771200|'''''XB24''''']]
|[[Os01g0771200]]
| 25.112
| 106499
| 0.236
| 3
| 14
| 2015/5/13 15:32
|-
|'''''[[IPA1]]'''''
|
| 22.636
| 22636
| 1
| 1
| 1
| 2014/6/1 14:57
|-
|'''''[[AB013448]]'''''
|
| 21.65
| 21650
| 1
| 1
| 1
| 2014/6/8 17:24
|-
|[[Os10g0542100|'''''MT''''']]
|[[Os10g0542100]]
| 21.515
| 25382
| 0.848
| 3
| 3
| 2015/6/13 16:56
|-
|'''''[[MADS]]'''''
|
| 21.305
| 21310
| 1
| 3
| 3
| 2014/6/7 19:11
|-
|'''''[[MYB]]'''''
|
| 21.082
| 21418
| 0.984
| 2
| 2
| 2013/7/16 10:48
|-
|[[Os09g0272900|'''''PB''''']]
|[[Os09g0272900]]
| 21.033
| 24405
| 0.862
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os01g0848400|'''''qSH1''''']]
|[[Os01g0848400]]
| 20.688
| 31733
| 0.652
| 2
| 2
| 2015/5/13 15:40
|-
|[[Os09g0441900|'''''OsDEP1''''']]
|[[Os09g0441900]]
| 18.815
| 18855
| 0.998
| 5
| 5
| 2014/6/11 0:23
|-
|[[Os09g0240200|'''''CONSTANS''''']]
|[[Os09g0240200]]
| 18.077
| 26433
| 0.684
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os04g0271200|'''''SRT701''''']]
|[[Os04g0271200]]
| 18.041
| 18413
| 0.98
| 5
| 9
| 2014/6/10 16:01
|-
|[[Os01g0678500|'''''OsTPC1''''']]
|[[Os01g0678500]]
| 17.989
| 29118
| 0.618
| 6
| 7
| 2015/5/13 15:24
|-
|[[Os03g0332400|'''''OsGLYII-2''''']]
|[[Os03g0332400]]
| 17.603
| 17603
| 1
| 1
| 1
| 2014/12/27 21:46
|-
|[[Os06g0196700|'''''OsARF16'''''']]
|[[Os06g0196700]]
| 17.411
| 28849
| 0.604
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os07g0261200|'''''Ghd7''''']]
|[[Os07g0261200]]
| 17.077
| 17414
| 0.981
| 2
| 2
| 2014/6/1 17:56
|-
|'''''[[Xa7]]'''''
|
| 16.58
| 16580
| 1
| 1
| 1
| 2014/5/30 14:34
|-
|[[Os03g0227700|'''''OsDWARF4''''']]
|[[Os03g0227700]]
| 16.238
| 28577
| 0.568
| 4
| 6
| 2015/6/12 13:36
|-
|'''''[[Pb1]]'''''
|
| 15.987
| 15987
| 1
| 1
| 1
| 2014/6/3 15:06
|-
|[[Os12g0597000|'''''CBL''''']]
|[[Os12g0597000]]
| 15.897
| 25737
| 0.618
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os01g0841500|'''''OsMYB3R2''''']]
|[[Os01g0841500]]
| 15.635
| 27885
| 0.561
| 3
| 4
| 2015/5/13 15:39
|-
|[[Os01g0182600|'''''GI''''']]
|[[Os01g0182600]]
| 14.75
| 22705
| 0.65
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os08g0162100|'''''ASP1''''']]
|[[Os08g0162100]]
| 14.743
| 14743
| 1
| 1
| 1
| 2015/6/12 17:26
|-
|[[Os02g0738900|'''''OsDRP2B''''']]
|[[Os02g0738900]]
| 14.365
| 21439
| 0.67
| 2
| 2
| 2015/5/14 13:58
|-
|[[Os01g57340|'''''Npi37''''']]
|[[Os01g57340]]
| 14.08
| 14080
| 1
| 1
| 1
| 2014/5/27 20:22
|-
|[[Os01g0718300|'''''OsBRI1''''']]
|[[Os01g0718300]]
| 14.008
| 25923
| 0.54
| 3
| 3
| 2015/5/13 15:26
|-
|'''''[[Du2]]'''''
|
| 13.964
| 13964
| 1
| 2
| 2
| 2014/6/5 11:53
|-
|'''''[[OsMYB103L]]'''''
|
| 13.96
| 13960
| 1
| 1
| 1
| 2014/6/11 16:14
|-
|[[Os01g0782100|''''' Pi-sh''''']]
|[[Os01g0782100]]
| 13.897
| 27151
| 0.512
| 3
| 3
| 2015/5/13 15:34

|-
|[[Os06g0706400|'''''OsPTR9''''']]
|[[Os06g0706400]]
| 13.739
| 20020
| 0.686
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os08g0398400|'''''OsHIR1''''']]
|[[Os08g0398400]]
| 13.721
| 13748
| 0.998
| 3
| 6
| 2014/6/3 16:40
|-
|[[Os02g0141300|'''''CAP1''''']]
|[[Os02g0141300]]
| 13.71
| 28137
| 0.487
| 5
| 10
| 2015/5/14 13:21
|-
|[[Os07g0214100|'''''RAG1''''']]
|[[Os07g0214100]]
| 13.62
| 31302
| 0.435
| 2
| 2
| 2015/6/12 16:36
|-
|'''''[[DWT1]]'''''
|
| 13.275
| 13275
| 1
| 1
| 1
| 2014/5/31 12:55
|-
|[[Os01g0797600|'''''OsERF3''''']]
|[[Os01g0797600]]
| 13.247
| 13247
| 1
| 1
| 1
| 2014/5/25 15:17
|-
|[[Os01g0883800|'''''semidwarf-1''''']]
|[[Os01g0883800]]
| 13.17
| 24896
| 0.529
| 16
| 41
| 2016/6/17 17:22
|-
|[[Os08g0524100|'''''OsSRT1''''']]
|[[Os08g0524100]]
| 13.001
| 18711
| 0.695
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os08g0559300|'''''SPINDLY''''']]
|[[Os08g0559300]]
| 12.718
| 21018
| 0.605
| 3
| 6
| 2015/6/12 17:35
|-
|[[Os11g0225300|'''''PAMP''''']]
|[[Os11g0225300]]
| 12.691
| 23520
| 0.54
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os07g0155600|'''''OsEIN2''''']]
|[[Os07g0155600]]
| 12.605
| 18316
| 0.688
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os01g0607200|'''''OsBAT1''''']]
|[[Os01g0607200]]
| 12.553
| 19986
| 0.628
| 2
| 2
| 2015/5/13 15:17
|-
|[[Os07g0616800|'''''SUS''''']]
|[[Os07g0616800]]
| 12.42
| 26693
| 0.465
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os12g0102400|'''''OsRINGC2-2''''']]
|[[Os12g0102400]]
| 12.278
| 17739
| 0.692
| 3
| 3
| 2015/6/13 17:13
|-
|'''''[[WRKY]]'''''
|
| 12.226
| 12233
| 0.999
| 2
| 2
| 2014/5/31 12:44
|-
|[[Os10g0536100|'''''OsMADS50''''']]
|[[Os10g0536100]]
| 11.96
| 19080
| 0.627
| 3
| 3
| 2015/6/13 16:52
|-
|[[Os02g0725900|'''''HAP3''''']]
|[[Os02g0725900]]
| 11.931
| 16469
| 0.724
| 2
| 2
| 2015/5/14 13:55
|-
|[[Os01g0626400|'''''OsWRKY11''''']]
|[[Os01g0626400]]
| 11.902
| 18881
| 0.63
| 2
| 2
| 2015/5/13 15:20
|-
|[[Os01g0726400|'''''CFO1''''']]
|[[Os01g0726400]]
| 11.891
| 17625
| 0.675
| 2
| 2
| 2015/5/13 15:27
|-
|[[Os09g0422500|'''''OsCESA9''''']]
|[[Os09g0422500]]
| 11.747
| 23511
| 0.5
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os09g0250700|'''''OsABC1-12''''']]
|[[Os09g0250700]]
| 11.742
| 15681
| 0.749
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os06g0701300|'''''OsABC1-8''''']]
|[[Os06g0701300]]
| 11.604
| 15691
| 0.74
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0126400|'''''OsCPK4''''']]
|[[Os02g0126400]]
| 11.6
| 22962
| 0.505
| 2
| 2
| 2015/5/14 13:20
|-
|[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]
|[[Os06g0570100]]
| 11.586
| 15710
| 0.737
| 3
| 3
| 2015/6/12 16:16
|-
|[[Os03g0793500|'''''Hd16''''']]
|[[Os03g0793500]]
| 11.531
| 15843
| 0.728
| 2
| 2
| 2015/5/15 13:43
|-
|[[Os01g0536000|'''''OsCIPK08''''']]
|[[Os01g0536000]]
| 11.52
| 15150
| 0.76
| 2
| 2
| 2015/5/13 15:15
|-
|[[Os03g0848700|'''''Bph14''''']]
|[[Os03g0848700]]
| 11.486
| 21573
| 0.532
| 4
| 4
| 2015/5/15 13:41
|-
|[[Os01g0907900|'''''PLA2''''']]
|[[Os01g0907900]]
| 11.483
| 11485
| 1
| 2
| 2
| 2014/6/2 17:56
|-
|[[Os07g0459200|'''''OsABC1-10''''']]
|[[Os07g0459200]]
| 11.449
| 15381
| 0.744
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os07g0102300|'''''SRL1''''']]
|[[Os07g0102300]]
| 11.423
| 22326
| 0.512
| 3
| 3
| 2015/6/12 16:30
|-
|[[Os07g0186200|'''''OsSIK2''''']]
|[[Os07g0186200]]
| 11.413
| 20165
| 0.566
| 3
| 3
| 2015/6/12 16:34
|-
|[[Os03g0226800|'''''CMT3''''']]
|[[Os03g0226800]]
| 11.245
| 21415
| 0.525
| 3
| 3
| 2015/6/12 13:36
|-
|[[Os08g0114200|'''''OsGLU3''''']]
|[[Os08g0114200]]
| 11.137
| 17754
| 0.627
| 2
| 2
| 2015/6/12 17:23
|-
|[[Os07g0596300|'''''FH5''''']]
|[[Os07g0596300]]
| 11.085
| 15490
| 0.716
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os02g0178800|'''''OsGL1-2''''']]
|[[Os02g0178800]]
| 11.079
| 14720
| 0.753
| 2
| 2
| 2015/5/14 13:23
|-
|[[Os03g0811100|''''' Chl1''''']]
|[[Os03g0811100]]
| 11.068
| 14957
| 0.74
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os09g0395300|'''''SLL1''''']]
|[[Os09g0395300]]
| 11.063
| 16461
| 0.672
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g03150|'''''TAD1''''']]
|[[Os03g03150]]
| 10.972
| 10972
| 1
| 1
| 1
| 2014/6/9 12:35
|-
|[[Os12g0189500|'''''OsYUC11''''']]
|[[Os12g0189500]]
| 10.931
| 20645
| 0.529
| 7
| 7
| 2015/6/13 17:16
|-
|[[Os06g0211200|'''''OsAREB1''''']]
|[[Os06g0211200]]
| 10.925
| 19995
| 0.546
| 5
| 6
| 2015/6/12 16:09
|-
|[[Os02g0100200|'''''HSP''''']]
|[[Os02g0100200]]
| 10.917
| 21797
| 0.501
| 2
| 2
| 2015/5/14 13:17
|-
|'''''[[BHLH]]'''''
|
| 10.829
| 10829
| 1
| 1
| 1
| 2013/7/21 20:47
|-
|[[Os11g0703900|'''''Hsp70''''']]
|[[Os11g0703900]]
| 10.813
| 10898
| 0.992
| 4
| 5
| 2014/6/9 23:54
|-
|[[Os01g44260|'''''OsDfr''''']]
|[[Os01g44260]]
| 10.787
| 10787
| 1
| 1
| 1
| 2014/6/9 21:48
|-
|[[Os03g0815100|'''''SNAC1''''']]
|[[Os03g0815100]]
| 10.722
| 15783
| 0.679
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os10g0561400|'''''OsMYBS3''''']]
|[[Os10g0561400]]
| 10.656
| 22236
| 0.479
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0523800|'''''OsARF1''''']]
|[[Os11g0523800]]
| 10.633
| 21943
| 0.485
| 6
| 6
| 2015/6/13 17:08
|-
|[[Os07g0257200|'''''OsNRAMP5''''']]
|[[Os07g0257200]]
| 10.556
| 10556
| 1
| 1
| 1
| 2015/6/12 16:38
|-
|[[Os02g0661100|'''''OsTPP1''''']]
|[[Os02g0661100]]
| 10.544
| 18837
| 0.56
| 2
| 2
| 2015/5/14 13:51
|-
|[[Os07g0164000|'''''WAF1''''']]
|[[Os07g0164000]]
| 10.534
| 11864
| 0.888
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os12g0476200|'''''Xa25''''']]
|[[Os12g0476200]]
| 10.44
| 17073
| 0.611
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os10g0497300|'''''Rf1a''''']]
|[[Os10g0497300]]
| 10.431
| 18232
| 0.572
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os07g0108900|'''''OsMADS15''''']]
|[[Os07g0108900]]
| 10.425
| 20545
| 0.507
| 4
| 5
| 2015/6/12 16:31
|-
|[[Os03g0215400|'''''MADS1''''']]
|[[Os03g0215400]]
| 10.412
| 14715
| 0.708
| 2
| 2
| 2015/6/12 13:34
|-
|[[Os08g0174700|'''''OsSERK1''''']]
|[[Os08g0174700]]
| 10.335
| 21519
| 0.48
| 2
| 2
| 2015/6/12 17:28
|-
|[[Os01g0121700|'''''OsWBC1''''']]
|[[Os01g0121700]]
| 10.278
| 14300
| 0.719
| 2
| 2
| 2015/5/13 14:49
|-
|[[Os01g0201700|'''''OsMADS3''''']]
|[[Os01g0201700]]
| 10.276
| 20440
| 0.503
| 2
| 2
| 2015/5/13 15:03
|-
|[[Os10g0577600|'''''JMJ706''''']]
|[[Os10g0577600]]
| 10.16
| 18081
| 0.562
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0839100|'''''ZFP179''''']]
|[[Os01g0839100]]
| 10.128
| 13298
| 0.762
| 2
| 2
| 2015/5/13 15:38
|-
|[[Os03g0237250|'''''LPA1''''']]
|[[Os03g0237250]]
| 10.125
| 14184
| 0.714
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0133000|'''''Waxy''''']]
|[[Os06g0133000]]
| 10.084
| 22204
| 0.454
| 3
| 3
| 2015/6/12 16:04
|-
|[[Os03g0805100|'''''SQS''']]
|[[Os03g0805100]]
| 10.051
| 13542
| 0.742
| 2
| 2
| 2015/5/15 13:42
|-
|'''''[[AB013449]]'''''
|
| 10.03
| 10030
| 1
| 1
| 1
| 2014/6/10 22:14
|-
|[[Os07g0605200|'''''OsMADS18''''']]
|[[Os07g0605200]]
| 10.027
| 19041
| 0.527
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os06g0194900|'''''Sus''''']]
|[[Os06g0194900]]
| 10.026
| 20580
| 0.487
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os01g0764800|'''''GH3''''']]
|[[Os01g0764800]]
| 10.024
| 18674
| 0.537
| 2
| 2
| 2015/5/13 15:32
|-
|[[Os03g0111300|'''''NsLTPs''''']]
|[[Os03g0111300]]
| 10.013
| 12909
| 0.776
| 4
| 4
| 2015/6/12 12:57
|-
|[[Os10g0127900|'''''OsFbx352''''']]
|[[Os10g0127900]]
| 10.013
| 20618
| 0.486
| 4
| 8
| 2015/6/13 16:43
|-
|[[Os06g0662000|'''''OsVHA-A''''']]
|[[Os06g0662000]]
| 9.949
| 19796
| 0.503
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0254600|'''''CALEOSIN''''']]
|[[Os06g0254600]]
| 9.94
| 12129
| 0.82
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os06g0603000|'''''SE5''''']]
|[[Os06g0603000]]
| 9.889
| 9889
| 1
| 1
| 1
| 2014/6/9 17:03
|-
|[[Os08g0535200|'''''xa13''''']]
|[[Os08g0535200]]
| 9.858
| 18774
| 0.525
| 3
| 3
| 2015/6/12 17:34
|-
|[[Os12g0281300|'''''Pi-ta''''']]
|[[Os12g0281300]]
| 9.857
| 21855
| 0.451
| 4
| 4
| 2015/6/13 17:16
|-
|[[Os01g0919400|'''''SPS''''']]
|[[Os01g0919400]]
| 9.837
| 9837
| 1
| 1
| 1
| 2016/6/6 17:48
|-
|[[Os10g0573900|'''''OsNMD3''''']]
|[[Os10g0573900]]
| 9.818
| 16399
| 0.599
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0197100|'''''dwarf2''''']]
|[[Os01g0197100]]
| 9.81
| 19279
| 0.509
| 5
| 6
| 2015/5/13 14:59
|-
|[[Os11g0216300|'''''OsABC1-13''''']]
|[[Os11g0216300]]
| 9.795
| 13761
| 0.712
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os01g0102900|'''''Os-LIR1''''']]
|[[Os01g0102900]]
| 9.726
| 9726
| 1
| 1
| 1
| 2016/6/12 14:04
|-
|[[Os11g0249000|'''''NLS1''''']]
|[[Os11g0249000]]
| 9.718
| 17393
| 0.559
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os10g0467800|'''''OsCesA7''''']]
|[[Os10g0467800]]
| 9.68
| 22133
| 0.437
| 5
| 6
| 2015/6/13 16:48
|-
|[[Os02g0682200|'''''MADS6''''']]
|[[Os02g0682200]]
| 9.577
| 17192
| 0.557
| 3
| 13
| 2015/5/14 13:53
|-
|[[Os06g0569500|'''''GAs''''']]
|[[Os06g0569500]]
| 9.526
| 18834
| 0.506
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os09g0456800|'''''OsHsfs''''']]
|[[Os09g0456800]]
| 9.468
| 13735
| 0.689
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0274900|'''''OsGMST1''''']]
|[[Os02g0274900]]
| 9.449
| 18241
| 0.518
| 2
| 2
| 2015/5/14 13:38
|-
|[[Os06g0724900|'''''ILA1''''']]
|[[Os06g0724900]]
| 9.361
| 19950
| 0.469
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os01g0611100|'''''OsRAN1''''']]
|[[Os01g0611100]]
| 9.349
| 15330
| 0.61
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os08g0509600|'''''OsSPL14''''']]
|[[Os08g0509600]]
| 9.346
| 17625
| 0.53
| 3
| 4
| 2015/6/12 17:32
|-
|[[Os07g0558000|'''''OsABC1-11''''']]
|[[Os07g0558000]]
| 9.337
| 13289
| 0.703
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0449000|'''''PTC1''''']]
|[[Os09g0449000]]
| 9.33
| 16966
| 0.55
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os04g0415000|'''''BY240''''']]
|[[Os04g0415000]]
| 9.31
| 9310
| 1
| 1
| 1
| 2014/6/6 19:55
|-
|[[Os07g0471000|'''''OsIRE1''''']]
|[[Os07g0471000]]
| 9.278
| 18586
| 0.499
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os03g0170900|'''''OsSUT1''''']]
|[[Os03g0170900]]
| 9.272
| 19337
| 0.479
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os06g0610300|'''''MOC1''''']]
|[[Os06g0610300]]
| 9.171
| 11979
| 0.766
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0583400|'''''OsHDAC702''''']]
|[[Os06g0583400]]
| 9.15
| 11481
| 0.797
| 2
| 2
| 2015/6/12 16:16
|-
|[[Os02g0622100|'''''LTG1''''']]
|[[Os02g0622100]]
| 9.147
| 12303
| 0.743
| 2
| 2
| 2015/5/14 13:47
|-
|[[Os03g0203200|'''''HTD2''''']]
|[[Os03g0203200]]
| 9.128
| 17233
| 0.53
| 4
| 4
| 2015/6/12 13:06
|-
|[[Os06g0660200|'''''OsPIN2''''']]
|[[Os06g0660200]]
| 9.119
| 20530
| 0.444
| 5
| 6
| 2015/6/12 16:21
|-
|[[Os10g0403000|'''''PLA1 ''''']]
|[[Os10g0403000]]
| 9.104
| 15463
| 0.589
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os03g0112700|'''''Ehd4''''']]
|[[Os03g0112700]]
| 9.094
| 17122
| 0.531
| 3
| 3
| 2015/6/12 12:58
|-
|[[Os02g0799100|'''''Ossgo1''''']]
|[[Os02g0799100]]
| 9.068
| 16095
| 0.563
| 3
| 6
| 2015/5/14 14:02
|-
|[[Os09g0307800|'''''SDG724''''']]
|[[Os09g0307800]]
| 9.029
| 11279
| 0.801
| 4
| 15
| 2014/6/6 8:56
|-
|[[Os08g0424500|'''''Badh2''''']]
|[[Os08g0424500]]
| 9.021
| 17768
| 0.508
| 3
| 3
| 2015/6/12 17:30
|-
|[[Os11g0184900|'''''OsNAC5''''']]
|[[Os11g0184900]]
| 9.016
| 15182
| 0.594
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0203700|'''''SRZ1''''']]
|[[Os02g0203700]]
| 9.003
| 12324
| 0.731
| 2
| 2
| 2015/5/14 13:26
|-
|[[Os06g0125000|'''''RPM1''''']]
|[[Os06g0125000]]
| 8.97
| 12695
| 0.707
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os03g0128700|'''''OsCDPK13''''']]
|[[Os03g0128700]]
| 8.928
| 17882
| 0.499
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os03g0215200|'''''DL''''']]
|[[Os03g0215200]]
| 8.927
| 14196
| 0.629
| 3
| 3
| 2015/6/12 13:07
|-
|[[Os01g0952800|'''''OsIRO2''''']]
|[[Os01g0952800]]
| 8.922
| 8922
| 1
| 1
| 1
| 2014/6/10 21:52
|-
|[[Os06g0494100|'''''Pi-d2''''']]
|[[Os06g0494100]]
| 8.906
| 12742
| 0.699
| 3
| 3
| 2015/6/12 16:14
|-
|[[Os03g0149100|'''''OsCrl1''''']]
|[[Os03g0149100]]
| 8.897
| 13456
| 0.661
| 3
| 4
| 2015/6/12 11:15
|-
|'''''[[BZIP]]'''''
|
| 8.894
| 8924
| 0.997
| 2
| 2
| 2013/7/21 21:01
|-
|[[Os06g0625900|'''''OsHAK10''''']]
|[[Os06g0625900]]
| 8.872
| 13033
| 0.681
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0229800|'''''ALK''''']]
|[[Os06g0229800]]
| 8.835
| 16807
| 0.526
| 2
| 2
| 2015/6/12 16:11
|-
|[[Os07g0232900|'''''OsHMA3''''']]
|[[Os07g0232900]]
| 8.79
| 18004
| 0.488
| 3
| 8
| 2015/6/12 16:37
|-
|[[Os07g0129700|'''''OSH15''''']]
|[[Os07g0129700]]
| 8.789
| 18504
| 0.475
| 3
| 3
| 2015/6/12 16:32
|-
|[[Os12g0641400|'''''OsSUT2''''']]
|[[Os12g0641400]]
| 8.735
| 8735
| 1
| 1
| 1
| 2016/6/12 13:56
|-
|[[Os08g0137100|'''''OsFIE2''''']]
|[[Os08g0137100]]
| 8.717
| 8717
| 1
| 1
| 1
| 2015/6/12 17:25
|-
|'''''[[Htd1]]'''''
|
| 8.705
| 8705
| 1
| 1
| 1
| 2014/6/10 14:14
|-
|[[Os03g0707600|'''''GAI''''']]
|[[Os03g0707600]]
| 8.666
| 16659
| 0.52
| 2
| 5
| 2014/5/28 0:43
|-
|'''''[[Xa23]]'''''
|
| 8.641
| 8641
| 1
| 1
| 1
| 2014/5/31 21:49
|-
|[[Os11g0235200|'''''SP1''''']]
|[[Os11g0235200]]
| 8.563
| 17156
| 0.499
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os07g0100600|'''''OsPTR1''''']]
|[[Os07g0100600]]
| 8.559
| 15027
| 0.57
| 2
| 2
| 2015/6/12 16:30
|-
|[[Os06g0597000|'''''OsIAA23''''']]
|[[Os06g0597000]]
| 8.509
| 16209
| 0.525
| 4
| 11
| 2014/5/19 22:42
|-
|[[Os02g0232100|'''''HEI10''''']]
|[[Os02g0232100]]
| 8.485
| 15567
| 0.545
| 2
| 2
| 2015/5/14 13:36
|-
|[[Os04g0452500|'''''ZEP1''''']]
|[[Os04g0452500]]
| 8.484
| 8484
| 1
| 1
| 1
| 2014/5/31 16:56
|-
|[[Os09g0363900|'''''ONI3''''']]
|[[Os09g0363900]]
| 8.473
| 12412
| 0.683
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os09g0426800|'''''WSL2''''']]
|[[Os09g0426800]]
| 8.447
| 9634
| 0.877
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0253300|'''''alpha-1a''''']]
|[[Os01g0253300]]
| 8.439
| 17745
| 0.476
| 5
| 5
| 2015/5/13 15:07
|-
|[[Os06g0683400|'''''OsCCD1''''']]
|[[Os06g0683400]]
| 8.438
| 8438
| 1
| 1
| 1
| 2016/6/12 14:00
|-
|[[Os09g0522000|'''''OsDREB''''']]
|[[Os09g0522000]]
| 8.335
| 8335
| 1
| 1
| 1
| 2014/5/24 21:12
|-
|[[Os02g0580300|'''''GID2''''']]
|[[Os02g0580300]]
| 8.329
| 15752
| 0.529
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os08g0499300|'''''OsWRKY30''''']]
|[[Os08g0499300]]
| 8.324
| 17032
| 0.489
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0445700|'''''TPS''''']]
|[[Os08g0445700]]
| 8.317
| 10922
| 0.761
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os10g0505700|'''''LTPs''''']]
|[[Os10g0505700]]
| 8.312
| 16220
| 0.512
| 5
| 6
| 2015/6/13 16:46
|-
|[[Os11g0559200|'''''OsXa21''''']]
|[[Os11g0559200]]
| 8.294
| 15586
| 0.532
| 6
| 9
| 2015/6/13 17:08
|-
|[[Os03g0179400|'''''GUDK''''']]
|[[Os03g0179400]]
| 8.292
| 14840
| 0.559
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os02g0553200|'''''OsAPx8''''']]
|[[Os02g0553200]]
| 8.204
| 8204
| 1
| 1
| 1
| 2014/6/8 16:03
|-
|[[Os01g0571300|'''''OsHsfA7''''']]
|[[Os01g0571300]]
| 8.184
| 14946
| 0.548
| 2
| 2
| 2015/5/13 15:16
|-
|[[Os09g0401100|'''''STR1''''']]
|[[Os09g0401100]]
| 8.183
| 17216
| 0.475
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os02g0181300|'''''WRKY''''']]
|[[Os02g0181300]]
| 8.174
| 13252
| 0.617
| 2
| 2
| 2015/5/14 13:24
|-
|[[Os05g0346200|'''''OsDREB2B2''''']]
|[[Os05g0346200]]
| 8.14
| 8233
| 0.989
| 2
| 3
| 2014/6/5 17:14
|-
|[[Os09g0502100|'''''LGD1''''']]
|[[Os09g0502100]]
| 8.139
| 15501
| 0.525
| 2
| 2
| 2015/6/12 22:35
|-
|[[Os03g0820300|'''''ZFP182''''']]
|[[Os03g0820300]]
| 8.137
| 11604
| 0.701
| 2
| 2
| 2015/5/15 13:41
|-
|[[Os03g0230300|'''''OsSRO1c''''']]
|[[Os03g0230300]]
| 8.029
| 15193
| 0.528
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os07g0438800|'''''OsPHR2''''']]
|[[Os07g0438800]]
| 8.026
| 15610
| 0.514
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os02g0534400|'''''OsCIN1''''']]
|[[Os02g0534400]]
| 7.997
| 16635
| 0.481
| 2
| 2
| 2015/5/14 13:41
|-
|[[Os06g0165600|'''''OsDREB1D''''']]
|[[Os06g0165600]]
| 7.982
| 11937
| 0.669
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os11g0490600|'''''LAZY1''''']]
|[[Os11g0490600]]
| 7.98
| 16603
| 0.481
| 4
| 5
| 2015/6/13 17:07
|-
|[[Os07g0585700|'''''Sdr4''''']]
|[[Os07g0585700]]
| 7.966
| 7966
| 1
| 1
| 1
| 2014/6/9 23:14
|-
|[[Os01g0194300|'''''OsNPR1''''']]
|[[Os01g0194300]]
| 7.966
| 11111
| 0.717
| 2
| 2
| 2015/5/13 14:59
|-
|[[Os01g0869900|'''''SNF1''''']]
|[[Os01g0869900]]
| 7.964
| 16289
| 0.489
| 2
| 2
| 2015/5/13 15:42
|-
|[[Os06g0160700|'''''SSSl''''']]
|[[Os06g0160700]]
| 7.962
| 15027
| 0.53
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os09g0451500|'''''PDI''''']]
|[[Os09g0451500]]
| 7.903
| 10040
| 0.787
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os01g0759400|'''''OsCIPK12''''']]
|[[Os01g0759400]]
| 7.902
| 15742
| 0.502
| 2
| 2
| 2015/5/13 15:30
|-
|[[Os06g0205100|'''''OsC1-Myb''''']]
|[[Os06g0205100]]
| 7.891
| 12914
| 0.611
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os09g0244900|'''''Ypt1p''''']]
|[[Os09g0244900]]
| 7.89
| 11371
| 0.694
| 2
| 2
| 2015/6/12 17:38
|-
|'''''[[HTD2]]'''''
|
| 7.887
| 7887
| 1
| 1
| 1
| 2014/6/4 22:20
|-
|[[Os09g0482400|'''''HSP82''''']]
|[[Os09g0482400]]
| 7.873
| 11843
| 0.665
| 2
| 2
| 2015/6/12 17:47
|-
|[[Os10g0478000|'''''TAW1''''']]
|[[Os10g0478000]]
| 7.871
| 12275
| 0.641
| 4
| 5
| 2015/6/13 16:47
|-
|[[Os07g0258400|'''''OsNRAMP1''''']]
|[[Os07g0258400]]
| 7.866
| 13708
| 0.574
| 2
| 2
| 2015/6/12 16:38
|-
|[[Os10g0445400|'''''OsHCI1''''']]
|[[Os10g0445400]]
| 7.848
| 15652
| 0.501
| 6
| 15
| 2015/6/13 16:48
|-
|[[Os01g0273800|'''''OsYUC9''''']]
|[[Os01g0273800]]
| 7.843
| 9988
| 0.785
| 2
| 2
| 2015/5/13 15:10
|-
|[[Os01g0643300|'''''OsPIN10a''''']]
|[[Os01g0643300]]
| 7.839
| 16276
| 0.482
| 3
| 3
| 2015/5/13 15:22
|-
|[[Os06g0286700|'''''Pi9''''']]
|[[Os06g0286700]]
| 7.816
| 16653
| 0.469
| 6
| 9
| 2015/6/12 16:13
|-
|[[Os11g0104300|'''''DWARF53''''']]
|[[Os11g0104300]]
| 7.791
| 11682
| 0.667
| 4
| 4
| 2015/6/13 17:00
|-
|[[Os07g0150700|'''''Os-AKT1''''']]
|[[Os07g0150700]]
| 7.79
| 15994
| 0.487
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os09g0494200|'''''BC15''''']]
|[[Os09g0494200]]
| 7.776
| 7776
| 1
| 1
| 1
| 2014/6/3 23:51
|-
|[[Os03g0181500|'''''ONI1''''']]
|[[Os03g0181500]]
| 7.751
| 12230
| 0.634
| 3
| 4
| 2015/6/12 13:05
|-
|[[Os02g0814200|'''''OsGL1-6''''']]
|[[Os02g0814200]]
| 7.743
| 13379
| 0.579
| 2
| 2
| 2015/5/14 14:03
|-
|[[Os02g0103800|'''''OsLFNR1''''']]
|[[Os02g0103800]]
| 7.686
| 7686
| 1
| 1
| 1
| 2016/6/12 14:12
|-
|[[Os11g0225100|'''''Pia''''']]
|[[Os11g0225100]]
| 7.669
| 12296
| 0.624
| 3
| 3
| 2015/6/13 17:04
|-
|'''''[[Pi1]]'''''
|
| 7.644
| 7644
| 1
| 1
| 1
| 2014/6/5 17:02
|-
|[[Os01g0307500|'''''SKC1''''']]
|[[Os01g0307500]]
| 7.639
| 7639
| 1
| 1
| 1
| 2014/6/7 21:57
|-
|'''''[[Chalk5]]'''''
|
| 7.635
| 7635
| 1
| 1
| 1
| 2014/5/29 11:10
|-
|[[Os08g0140300|'''''TDC''''']]
|[[Os08g0140300]]
| 7.633
| 13769
| 0.554
| 2
| 2
| 2015/6/12 17:26
|-
|[[Os07g0622900|'''''DTM1''''']]
|[[Os07g0622900]]
| 7.632
| 14288
| 0.534
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os01g0292200|'''''OsCIPK1''''']]
|[[Os01g0292200]]
| 7.626
| 12859
| 0.593
| 2
| 2
| 2015/5/13 15:11
|-
|[[Os03g0230500|'''''DSM3''''']]
|[[Os03g0230500]]
| 7.618
| 14126
| 0.539
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os12g0472500|'''''OsTDL1A''''']]
|[[Os12g0472500]]
| 7.581
| 13819
| 0.549
| 4
| 4
| 2015/6/13 17:17
|-
|[[Os03g0262900|'''''glup6''''']]
|[[Os03g0262900]]
| 7.571
| 15719
| 0.482
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0107700|'''''OsLFNR2''''']]
|[[Os06g0107700]]
| 7.533
| 7533
| 1
| 1
| 1
| 2016/6/6 9:33
|-
|[[Os02g57310|'''''Pib''''']]
|[[Os02g57310]]
| 7.531
| 7531
| 1
| 1
| 1
| 2014/6/6 14:27
|-
|[[Os09g0104200|'''''OsRAD51D''''']]
|[[Os09g0104200]]
| 7.502
| 15399
| 0.487
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os06g0142600|'''''Hd17''''']]
|[[Os06g0142600]]
| 7.492
| 11545
| 0.649
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os03g0788500|'''''OsCPK10''''']]
|[[Os03g0788500]]
| 7.454
| 10159
| 0.734
| 2
| 2
| 2015/5/15 13:44
|-
|[[Os06g0139000|'''''F-box''''']]
|[[Os06g0139000]]
| 7.443
| 15282
| 0.487
| 3
| 4
| 2015/6/12 16:05
|-
|[[Os03g0168600|'''''CYP704B2''''']]
|[[Os03g0168600]]
| 7.43
| 12348
| 0.602
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os11g0117400|'''''OsWRKY89''''']]
|[[Os11g0117400]]
| 7.353
| 11607
| 0.633
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os03g0223400|'''''OsGLN1_2''''']]
|[[Os03g0223400]]
| 7.313
| 14417
| 0.507
| 3
| 3
| 2015/6/12 13:35
|-
|[[Os02g0731200|'''''MADS57''''']]
|[[Os02g0731200]]
| 7.311
| 14927
| 0.49
| 2
| 2
| 2015/5/14 13:56
|-
|[[Os09g02650|'''''BC12''''']]
|[[Os09g02650]]
| 7.302
| 7302
| 1
| 1
| 1
| 2014/6/1 19:01
|-
|[[Os01g0859300|'''''OsABI5''''']]
|[[Os01g0859300]]
| 7.265
| 12246
| 0.593
| 2
| 2
| 2015/5/13 15:41
|-
|[[Os08g0105000|'''''Ghd7''''']]
|[[Os08g0105000]]
| 7.237
| 15311
| 0.473
| 4
| 4
| 2015/6/12 17:23
|-
|[[Os03g0110800|'''''OsDRM2''''']]
|[[Os03g0110800]]
| 7.203
| 14838
| 0.485
| 2
| 2
| 2015/6/12 12:57
|-
|[[Os01g0367100|'''''PHD1''''']]
|[[Os01g0367100]]
| 7.2
| 12561
| 0.573
| 3
| 3
| 2015/6/9 9:53
|-
|[[Os02g0191600|'''''OsbZIP16''''']]
|[[Os02g0191600]]
| 7.2
| 13785
| 0.522
| 2
| 2
| 2015/5/14 13:25
|-
|[[Os08g0137250|'''''FIE1''''']]
|[[Os08g0137250]]
| 7.185
| 14660
| 0.49
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os02g0220400|'''''Cga1''''']]
|[[Os02g0220400]]
| 7.158
| 17791
| 0.402
| 6
| 8
| 2015/5/14 13:36
|-
|[[Os10g0404500|'''''SUTs''''']]
|[[Os10g0404500]]
| 7.151
| 7164
| 0.998
| 2
| 2
| 2014/6/7 23:34
|-
|[[Os10g0177200|'''''OsDSR-1''''']]
|[[Os10g0177200]]
| 7.15
| 9017
| 0.793
| 3
| 3
| 2015/6/13 16:45
|-
|[[Os10g0496900|'''''OsPORB''''']]
|[[Os10g0496900]]
| 7.143
| 14022
| 0.509
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os02g0313400|'''''API5''''']]
|[[Os02g0313400]]
| 7.12
| 14554
| 0.489
| 2
| 2
| 2015/5/14 13:39
|-
|[[Os08g0117000|'''''PSS1''''']]
|[[Os08g0117000]]
| 7.092
| 8202
| 0.865
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os08g0531700|'''''MADS-box''''']]
|[[Os08g0531700]]
| 7.054
| 13276
| 0.531
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os06g0499500|'''''GH3''''']]
|[[Os06g0499500]]
| 7.051
| 12958
| 0.544
| 3
| 4
| 2015/6/12 16:15
|-
|[[Os03g0188400|'''''OsSRT1''''']]
|[[Os03g0188400]]
| 7.05
| 12067
| 0.584
| 2
| 2
| 2015/6/12 13:06
|-
|[[Os02g0649900|'''''OsYSL2''''']]
|[[Os02g0649900]]
| 7.031
| 12503
| 0.562
| 2
| 2
| 2015/5/14 13:48
|-
|[[Os09g0442700|'''''OsDDM1''''']]
|[[Os09g0442700]]
| 7.028
| 10589
| 0.664
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os12g0438600|'''''AtCLC-a''''']]
|[[Os12g0438600]]
| 7.022
| 14835
| 0.473
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os07g0124700|'''''CRL5''''']]
|[[Os07g0124700]]
| 6.998
| 14469
| 0.484
| 2
| 2
| 2015/6/12 16:31
|-
|[[Os11g0639100|'''''Pi54''''']]
|[[Os11g0639100]]
| 6.934
| 11269
| 0.615
| 4
| 4
| 2015/6/13 17:09
|-
|[[Os01g0615050|'''''OCPI1''''']]
|[[Os01g0615050]]
| 6.92
| 9869
| 0.701
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os12g0610200|'''''OsPIL11''''']]
|[[Os12g0610200]]
| 6.911
| 12604
| 0.548
| 4
| 4
| 2015/6/13 17:18
|-
|[[Os03g0123300|'''''TAD1''''']]
|[[Os03g0123300]]
| 6.87
| 15272
| 0.45
| 4
| 8
| 2015/6/12 13:00
|-
|[[Os07g0682800|'''''rth1''''']]
|[[Os07g0682800]]
| 6.853
| 13550
| 0.506
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os11g0446000|'''''RSS3''''']]
|[[Os11g0446000]]
| 6.838
| 13942
| 0.49
| 5
| 5
| 2015/6/13 17:07
|-
|[[Os07g0182900|'''''OsMET1a''''']]
|[[Os07g0182900]]
| 6.821
| 13295
| 0.513
| 5
| 11
| 2015/6/12 16:33
|-
|[[Os01g0205700|'''''OsGSK1''''']]
|[[Os01g0205700]]
| 6.813
| 12490
| 0.545
| 2
| 2
| 2015/5/13 15:04
|-
|[[Os05g0333200|'''''GPA1''''']]
|[[Os05g0333200]]
| 6.778
| 8703
| 0.779
| 2
| 2
| 2014/6/9 9:17
|-
|[[Os10g0167600|'''''OsCPDP''''']]
|[[Os10g0167600]]
| 6.756
| 14570
| 0.464
| 4
| 4
| 2015/6/13 16:45
|-
|[[Os07g0227800|'''''OsABC1-9''''']]
|[[Os07g0227800]]
| 6.744
| 10826
| 0.623
| 2
| 2
| 2015/6/12 16:37
|-
|[[Os10g0567400|'''''OsCAO1''''']]
|[[Os10g0567400]]
| 6.732
| 13437
| 0.501
| 3
| 3
| 2015/6/13 16:58
|-
|'''''[[DEP2]]'''''
|
| 6.724
| 6763
| 0.994
| 3
| 7
| 2014/6/10 22:30
|-
|[[Os07g0592600|'''''OsMGH3''''']]
|[[Os07g0592600]]
| 6.72
| 15320
| 0.439
| 5
| 11
| 2015/6/12 16:46
|-
|[[Os11g0126900|'''''OsNAC10''''']]
|[[Os11g0126900]]
| 6.705
| 6705
| 1
| 1
| 1
| 2014/5/24 12:41
|-
|[[Os09g0561600|'''''OsDEES1''''']]
|[[Os09g0561600]]
| 6.699
| 11352
| 0.59
| 2
| 2
| 2015/6/13 16:42
|-
|'''''[[Sub1A]]'''''
|
| 6.679
| 6679
| 1
| 1
| 1
| 2014/6/4 16:03
|-
|[[Os08g0126300|'''''OsGAPDH''''']]
|[[Os08g0126300]]
| 6.658
| 13730
| 0.485
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os10g0533600|'''''OsMPK6''''']]
|[[Os10g0533600]]
| 6.522
| 8207
| 0.795
| 3
| 3
| 2015/6/13 16:46
|-
|[[Os10g0397400|'''''dwarf2''''']]
|[[Os10g0397400]]
| 6.52
| 11105
| 0.587
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os06g0712700|'''''OsMADS16''''']]
|[[Os06g0712700]]
| 6.51
| 7624
| 0.854
| 2
| 2
| 2014/6/9 16:43
|-
|[[Os08g0237000|'''''OsXTH8''''']]
|[[Os08g0237000]]
| 6.46
| 6460
| 1
| 1
| 1
| 2014/6/9 18:44
|-
|[[Os02g0811000|'''''TH1''''']]
|[[Os02g0811000]]
| 6.453
| 11487
| 0.562
| 2
| 2
| 2015/5/14 14:02
|-
|[[Os07g0505200|'''''OsSPL13''''']]
|[[Os07g0505200]]
| 6.444
| 6444
| 1
| 1
| 1
| 2016/6/13 9:49
|-
|[[Os11g0247300|'''''Srs5''''']]
|[[Os11g0247300]]
| 6.442
| 13081
| 0.492
| 4
| 4
| 2015/6/13 17:05
|-
|[[AY986492|'''''Xa27''''']]
|[[AY986492]]
| 6.408
| 6408
| 1
| 2
| 2
| 2014/6/10 21:12
|-
|[[Os06g0700700|'''''OsHMA2''''']]
|[[Os06g0700700]]
| 6.404
| 6404
| 1
| 1
| 1
| 2014/6/3 20:16
|-
|[[Os02g0771400|'''''OsPFA-DSP2''''']]
|[[Os02g0771400]]
| 6.399
| 6702
| 0.955
| 2
| 3
| 2014/5/12 16:03
|-
|[[Os06g0127800|'''''DLT''''']]
|[[Os06g0127800]]
| 6.393
| 10797
| 0.592
| 2
| 2
| 2015/6/12 16:03
|-
|[[Os02g0120500|'''''OsTDR''''']]
|[[Os02g0120500]]
| 6.372
| 6372
| 1
| 1
| 1
| 2015/5/14 13:19
|-
|[[Os03g0854500|'''''OsHsfs''''']]
|[[Os03g0854500]]
| 6.367
| 10086
| 0.631
| 2
| 2
| 2015/5/15 13:40
|-
|[[Os06g0275000|'''''Hd1''''']]
|[[Os06g0275000]]
| 6.307
| 11994
| 0.526
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os02g0759800|'''''OsSKIPa''''']]
|[[Os02g0759800]]
| 6.249
| 12883
| 0.485
| 2
| 2
| 2015/5/14 14:00
|-
|[[Os08g0101000|'''''IDEF1''''']]
|[[Os08g0101000]]
| 6.239
| 10862
| 0.574
| 2
| 2
| 2015/6/12 17:22
|-
|[[Os09g0456200|'''''OsbZIP72''''']]
|[[Os09g0456200]]
| 6.23
| 10901
| 0.572
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os12g0101600|'''''leaf2''''']]
|[[Os12g0101600]]
| 6.221
| 35095
| 0.177
| 2
| 3
| 2014/5/31 21:22
|-
|[[Os06g0695800|'''''STAR1''''']]
|[[Os06g0695800]]
| 6.213
| 8582
| 0.724
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0606700|'''''RSS1''''']]
|[[Os02g0606700]]
| 6.198
| 12432
| 0.499
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os11g0210300|'''''Adh1''''']]
|[[Os11g0210300]]
| 6.196
| 12384
| 0.5
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0736400|'''''OsDHODH''''']]
|[[Os02g0736400]]
| 6.183
| 11839
| 0.522
| 2
| 2
| 2015/5/14 13:57
|-
|[[Os08g0549100|'''''OsAPx4''''']]
|[[Os08g0549100]]
| 6.175
| 10093
| 0.612
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os09g0452200|'''''LYP4''''']]
|[[Os09g0452200]]
| 6.171
| 11987
| 0.515
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0170300|'''''OsMADS29''''']]
|[[Os02g0170300]]
| 6.166
| 12582
| 0.49
| 3
| 4
| 2015/5/14 13:23
|-
|[[Os03g0224700|'''''Hsfs''''']]
|[[Os03g0224700]]
| 6.166
| 11925
| 0.517
| 4
| 4
| 2015/6/12 13:35
|-
|[[Os07g0558500|'''''THF1''''']]
|[[Os07g0558500]]
| 6.078
| 12744
| 0.477
| 5
| 9
| 2015/6/12 16:45
|-
|[[Os09g0511000|'''''OsCERK1''''']]
|[[Os09g0511000]]
| 6.076
| 12097
| 0.502
| 2
| 2
| 2015/6/12 22:35
|-
|'''''[[OsWRKY13]]'''''
|
| 6.069
| 6101
| 0.995
| 2
| 3
| 2014/6/4 20:18
|-
|[[Os06g0308100|'''''OsIBR5''''']]
|[[Os06g0308100]]
| 6.062
| 12455
| 0.487
| 2
| 2
| 2015/6/12 16:13
|-
|[[Os11g0113700|'''''OsCIPK15''''']]
|[[Os11g0113700]]
| 5.961
| 12261
| 0.486
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os02g0656600|'''''GPA3''''']]
|[[Os02g0656600]]
| 5.915
| 10022
| 0.59
| 2
| 2
| 2015/5/14 13:50
|-
|[[Os01g0733200|'''''OsHsfC1b''''']]
|[[Os01g0733200]]
| 5.889
| 5889
| 1
| 1
| 1
| 2014/5/31 11:56
|-
|[[Os01g0785400|'''''GH3''''']]
|[[Os01g0785400]]
| 5.864
| 10600
| 0.553
| 2
| 2
| 2015/5/13 15:34
|-
|[[Os04g0541700|'''''Oshox22''''']]
|[[Os04g0541700]]
| 5.857
| 6037
| 0.97
| 2
| 3
| 2014/6/8 16:10
|-
|[[Os08g0140500|'''''TDC-3''''']]
|[[Os08g0140500]]
| 5.829
| 11343
| 0.514
| 2
| 2
| 2015/6/12 17:26
|-
|'''''[[IPK1]]'''''
|
| 5.803
| 5803
| 1
| 1
| 1
| 2014/6/8 16:55
|-
|[[Os09g0522100|'''''CBF''''']]
|[[Os09g0522100]]
| 5.713
| 9270
| 0.616
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os01g0177900|'''''OsABCG31''''']]
|[[Os01g0177900]]
| 5.693
| 11327
| 0.503
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os02g0149800|'''''OsPP18''''']]
|[[Os02g0149800]]
| 5.681
| 11452
| 0.496
| 2
| 2
| 2015/5/14 13:22
|-
|[[Os01g0831000|'''''LAX''''']]
|[[Os01g0831000]]
| 5.68
| 9517
| 0.597
| 2
| 2
| 2015/5/13 15:37
|-
|[[Os05g0580500|'''''OsRAD21-4''''']]
|[[Os05g0580500]]
| 5.66
| 5660
| 1
| 1
| 1
| 2014/5/23 11:03
|-
|'''''[[OsCERK1]]'''''
|
| 5.61
| 5610
| 1
| 1
| 1
| 2014/6/1 18:31
|-
|[[Os11g0116200|'''''LTPs''''']]
|[[Os11g0116200]]
| 5.602
| 7206
| 0.777
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os09g0567800|'''''Lipase''''']]
|[[Os09g0567800]]
| 5.558
| 5558
| 1
| 1
| 1
| 2014/6/6 16:24
|-
|[[Os06g0610350|'''''OsMOC1''''']]
|[[Os06g0610350]]
| 5.547
| 5547
| 1
| 1
| 1
| 2016/6/12 13:57
|-
|[[Os02g0657000|'''''ARAG1''''']]
|[[Os02g0657000]]
| 5.536
| 9210
| 0.601
| 2
| 2
| 2015/5/14 13:51
|-
|'''''[[Wbph8]]'''''
|
| 5.531
| 5531
| 1
| 1
| 1
| 2014/6/10 18:50
|-
|[[Os07g0563300|'''''GD1''''']]
|[[Os07g0563300]]
| 5.487
| 11105
| 0.494
| 2
| 2
| 2015/6/12 16:45
|-
|[[Os06g0701700|'''''OsHKT2;1''''']]
|[[Os06g0701700]]
| 5.432
| 8295
| 0.655
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os10g0419200|'''''RID1''''']]
|[[Os10g0419200]]
| 5.432
| 9118
| 0.596
| 3
| 3
| 2015/6/13 16:44
|-
|'''''[[OsCEBiP]]'''''
|
| 5.419
| 5419
| 1
| 1
| 1
| 2014/6/8 12:32
|-
|'''''[[Xa10]]'''''
|
| 5.416
| 5416
| 1
| 1
| 1
| 2014/6/1 16:52
|-
|[[Os03g0272300|'''''OsSDIR1''''']]
|[[Os03g0272300]]
| 5.41
| 9862
| 0.549
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os10g0528300|'''''GSTs''''']]
|[[Os10g0528300]]
| 5.364
| 9566
| 0.561
| 3
| 3
| 2015/6/13 16:46
|-
|'''''[[Badh2]]'''''
|
| 5.363
| 5363
| 1
| 1
| 1
| 2014/6/8 19:38
|-
|[[Os03g0233900|'''''Hbs''''']]
|[[Os03g0233900]]
| 5.348
| 9011
| 0.593
| 2
| 2
| 2015/6/12 13:38
|-
|'''''[[Xa21]]'''''
|
| 5.345
| 5345
| 1
| 1
| 1
| 2014/6/1 13:37
|-
|'''''[[Bls1]]'''''
|
| 5.308
| 5308
| 1
| 1
| 1
| 2014/5/24 15:17
|-
|[[Os06g0157700|'''''Hd3''''']]
|[[Os06g0157700]]
| 5.304
| 10277
| 0.516
| 2
| 2
| 2015/6/12 16:06
|-
|[[Os02g0260200|'''''LP''''']]
|[[Os02g0260200]]
| 5.302
| 7745
| 0.685
| 2
| 2
| 2015/5/14 13:37
|-
|[[Os03g0232600|'''''TUD1''''']]
|[[Os03g0232600]]
| 5.249
| 10595
| 0.495
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os03g0125100|'''''OsHYD3''''']]
|[[Os03g0125100]]
| 5.183
| 10331
| 0.502
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os06g0212900|'''''ORF3''''']]
|[[Os06g0212900]]
| 5.175
| 6651
| 0.778
| 3
| 3
| 2015/6/12 16:09
|-
|[[Os02g0491300|'''''MTR1''''']]
|[[Os02g0491300]]
| 5.166
| 10047
| 0.514
| 2
| 2
| 2015/5/14 13:40
|-
|[[Os09g0470500|'''''Oshox4''''']]
|[[Os09g0470500]]
| 5.144
| 9661
| 0.532
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os09g0439800|'''''DRO1''''']]
|[[Os09g0439800]]
| 5.122
| 8022
| 0.638
| 3
| 4
| 2015/6/12 17:43
|-
|[[Os12g0555500|'''''PBZ1''''']]
|[[Os12g0555500]]
| 5.108
| 8929
| 0.572
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os11g0508600|'''''Os-11N3''''']]
|[[Os11g0508600]]
| 5.066
| 7754
| 0.653
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os08g0174500|'''''OsDTH8''''']]
|[[Os08g0174500]]
| 5.017
| 9397
| 0.534
| 3
| 3
| 2015/6/12 17:28
|-
|[[Os03g0267200|'''''sHSP17.7''''']]
|[[Os03g0267200]]
| 5.008
| 7991
| 0.627
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os06g0622700|'''''OsbZIP50 ''''']]
|[[Os06g0622700]]
| 5
| 9868
| 0.507
| 2
| 2
| 2015/6/12 16:19
|-
|'''''[[SBP]]'''''
|
| 4.997
| 4997
| 1
| 1
| 1
| 2013/7/21 18:43
|-
|[[Os05g0465800|'''''PI3K''''']]
|[[Os05g0465800]]
| 4.939
| 4939
| 1
| 1
| 1
| 2014/6/6 16:19
|-
|[[Os10g0491000|'''''BSP''''']]
|[[Os10g0491000]]
| 4.912
| 8991
| 0.546
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os01g0206700|'''''OsCIPK05''''']]
|[[Os01g0206700]]
| 4.909
| 9664
| 0.508
| 2
| 2
| 2015/5/13 15:05
|-
|[[Os06g0643300|'''''RISBZ1''''']]
|[[Os06g0643300]]
| 4.869
| 7953
| 0.612
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os03g0180800|'''''OsTIFY11a''''']]
|[[Os03g0180800]]
| 4.859
| 8158
| 0.596
| 2
| 2
| 2015/6/12 13:04
|-
|'''''[[BPH_gene]]'''''
|
| 4.857
| 4857
| 1
| 2
| 2
| 2014/6/11 11:14
|-
|[[Os01g0805600|'''''CycB1''''']]
|[[Os01g0805600]]
| 4.842
| 4842
| 1
| 1
| 1
| 2014/6/5 18:11
|-
|[[Os06g0701600|'''''HKT''''']]
|[[Os06g0701600]]
| 4.831
| 7482
| 0.646
| 2
| 2
| 2015/6/12 16:25
|-
|[[Os08g0531600|'''''OsSPL16''''']]
|[[Os08g0531600]]
| 4.818
| 4825
| 0.999
| 2
| 2
| 2014/5/27 23:11
|-
|[[Os06g0254700|'''''OsCLO-6''''']]
|[[Os06g0254700]]
| 4.802
| 7514
| 0.639
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os01g0615100|'''''OCPI2''''']]
|[[Os01g0615100]]
| 4.794
| 7379
| 0.65
| 2
| 2
| 2015/5/13 15:19
|-
|'''''[[HSF]]'''''
|
| 4.772
| 4781
| 0.998
| 2
| 2
| 2013/7/21 20:57
|-
|[[Os06g0125800|'''''OsBBI1''''']]
|[[Os06g0125800]]
| 4.629
| 9410
| 0.492
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os07g0628500|'''''OsbHLH1''''']]
|[[Os07g0628500]]
| 4.606
| 8573
| 0.537
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os07g0694700|'''''APX''''']]
|[[Os07g0694700]]
| 4.569
| 8480
| 0.539
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os01g0293100|'''''TIP2''''']]
|[[Os01g0293100]]
| 4.568
| 8480
| 0.539
| 2
| 2
| 2015/5/13 15:12
|-
|'''''[[Rl14]]'''''
|
| 4.564
| 4764
| 0.958
| 2
| 2
| 2014/6/10 11:19
|-
|'''''[[OsRPA2]]'''''
|
| 4.552
| 4552
| 1
| 1
| 1
| 2014/6/6 9:13
|-
|[[Os06g0604000|'''''OsWR2''''']]
|[[Os06g0604000]]
| 4.53
| 8229
| 0.55
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os01g0192000|'''''OsDOS''''']]
|[[Os01g0192000]]
| 4.527
| 4527
| 1
| 1
| 1
| 2015/7/30 23:13
|-
|[[Os01g0922800|'''''OsMADS51''''']]
|[[Os01g0922800]]
| 4.506
| 4506
| 1
| 1
| 1
| 2014/5/24 18:45
|-
|[[Os02g0787300|'''''OsRac1''''']]
|[[Os02g0787300]]
| 4.483
| 6886
| 0.651
| 2
| 2
| 2015/5/14 14:01
|-
|[[Os09g0439200|'''''OsJAZ8''''']]
|[[Os09g0439200]]
| 4.477
| 8745
| 0.512
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0822900|'''''Dwarf1''''']]
|[[Os01g0822900]]
| 4.447
| 7550
| 0.589
| 3
| 4
| 2015/5/13 15:36
|-
|[[Os08g0167500|'''''CRR6''''']]
|[[Os08g0167500]]
| 4.432
| 8906
| 0.498
| 2
| 2
| 2015/6/12 17:27
|-
|'''''[[Sucrose_synthase]]'''''
|
| 4.428
| 4436
| 0.998
| 2
| 2
| 2013/7/18 11:20
|-
|'''''[[CL971152]]'''''
|
| 4.417
| 4472
| 0.988
| 2
| 2
| 2014/6/10 21:51
|-
|[[Os12g0603700|'''''OsCIPK04''''']]
|[[Os12g0603700]]
| 4.375
| 9322
| 0.469
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os02g0618400|'''''OsMPS''''']]
|[[Os02g0618400]]
| 4.347
| 8707
| 0.499
| 2
| 2
| 2015/5/14 13:45
|-
|[[Os03g0182800|'''''OsDERF1''''']]
|[[Os03g0182800]]
| 4.322
| 6519
| 0.663
| 2
| 2
| 2015/6/12 13:05
|-
|'''''[[ARF]]'''''
|
| 4.308
| 4308
| 1
| 1
| 1
| 2013/7/21 20:46
|-
|[[Os03g0183000|'''''OsRAF''''']]
|[[Os03g0183000]]
| 4.286
| 4286
| 1
| 1
| 1
| 2014/6/9 20:10
|-
|[[Os02g0654700|'''''AP59''''']]
|[[Os02g0654700]]
| 4.285
| 8306
| 0.516
| 2
| 2
| 2015/5/14 13:49
|-
|[[Os09g0466400|'''''OsZHD1''''']]
|[[Os09g0466400]]
| 4.265
| 8095
| 0.527
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os03g0103300|'''''qLTG3''''']]
|[[Os03g0103300]]
| 4.188
| 7457
| 0.562
| 2
| 2
| 2015/6/12 12:56
|-
|[[Os01g0834400|'''''OsHAP3A''''']]
|[[Os01g0834400]]
| 4.109
| 4109
| 1
| 1
| 1
| 2014/5/31 19:19
|-
|[[Os07g0512200|'''''OsAtg8''''']]
|[[Os07g0512200]]
| 4.095
| 7690
| 0.533
| 4
| 4
| 2015/6/12 16:43
|-
|'''''[[Bph9]]'''''
|
| 4.084
| 4084
| 1
| 1
| 1
| 2014/6/9 12:23
|-
|[[Os06g0181700|'''''OsWR1''''']]
|[[Os06g0181700]]
| 4.083
| 7433
| 0.549
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os06g0157500|'''''RFT1''''']]
|[[Os06g0157500]]
| 4.013
| 7888
| 0.509
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os09g0537700|'''''OsRNS4''''']]
|[[Os09g0537700]]
| 3.992
| 6731
| 0.593
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os02g0610500|'''''OsCOL4''''']]
|[[Os02g0610500]]
| 3.946
| 3946
| 1
| 1
| 1
| 2014/5/20 11:57
|-
|[[Os07g0529600|'''''OsDR8''''']]
|[[Os07g0529600]]
| 3.915
| 6908
| 0.567
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0106700|'''''AKT1''''']]
|[[Os09g0106700]]
| 3.845
| 6498
| 0.592
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os07g0568700|'''''OsFOR1''''']]
|[[Os07g0568700]]
| 3.845
| 6600
| 0.583
| 2
| 2
| 2015/6/12 16:46
|-
|'''''[[Pik-p]]'''''
|
| 3.816
| 3816
| 1
| 1
| 1
| 2014/6/6 10:16
|-
|[[Os06g0493100|'''''Bphi008a''''']]
|[[Os06g0493100]]
| 3.804
| 7241
| 0.525
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os02g0552700|'''''OsZFP6''''']]
|[[Os02g0552700]]
| 3.779
| 6604
| 0.572
| 2
| 2
| 2015/5/14 13:43
|-
|[[Os12g0100500|'''''COG2267''''']]
|[[Os12g0100500]]
| 3.729
| 5669
| 0.658
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os07g0129200|'''''OsPR1''''']]
|[[Os07g0129200]]
| 3.716
| 6629
| 0.561
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os10g0558900|'''''RL14''''']]
|[[Os10g0558900]]
| 3.699
| 7398
| 0.5
| 5
| 9
| 2015/6/13 16:57
|-
|[[Os01g0177400|'''''ACO1''''']]
|[[Os01g0177400]]
| 3.693
| 6293
| 0.587
| 3
| 3
| 2015/5/13 14:57
|-
|[[Os09g0380200|'''''YLC1''''']]
|[[Os09g0380200]]
| 3.69
| 6890
| 0.536
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os08g0163400|'''''OsSIG1''''']]
|[[Os08g0163400]]
| 3.662
| 3662
| 1
| 1
| 1
| 2014/6/9 20:52
|-
|[[Os09g0396900|'''''OsVIT2''''']]
|[[Os09g0396900]]
| 3.437
| 6527
| 0.527
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g0786400|'''''OsCKX2''''']]
|[[Os03g0786400]]
| 3.372
| 3372
| 1
| 1
| 1
| 2014/5/20 0:08
|-
|'''''[[Bhp-3]]'''''
|
| 3.33
| 3330
| 1
| 1
| 1
| 2014/5/31 23:33
|-
|[[Os07g0641200|'''''OsCCaMK''''']]
|[[Os07g0641200]]
| 3.212
| 6389
| 0.503
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0549600|'''''UDT1''''']]
|[[Os07g0549600]]
| 3.204
| 5875
| 0.545
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os11g0582500|'''''OsC6''''']]
|[[Os11g0582500]]
| 3.13
| 5666
| 0.552
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os03g0135700|'''''RAI1''''']]
|[[Os03g0135700]]
| 3.126
| 3126
| 1
| 1
| 1
| 2014/6/7 0:43
|-
|[[Os09g0459200|'''''SG1''''']]
|[[Os09g0459200]]
| 3.094
| 5090
| 0.608
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os11g0523700|'''''OsICE1''''']]
|[[Os11g0523700]]
| 3.071
| 3079
| 0.997
| 2
| 2
| 2014/6/3 13:41
|-
|[[Os09g0522200|'''''OsDREB1A''''']]
|[[Os09g0522200]]
| 3.031
| 5920
| 0.512
| 3
| 3
| 2015/6/12 22:36
|-
|[[Os06g0127100|'''''OsDREB1C''''']]
|[[Os06g0127100]]
| 3.015
| 5846
| 0.516
| 3
| 3
| 2015/6/12 16:02
|-
|[[Os10g0573400|'''''OsPYL10''''']]
|[[Os10g0573400]]
| 3.009
| 6148
| 0.489
| 4
| 4
| 2015/6/13 16:58
|-
|[[Os01g0274800|'''''CSA''''']]
|[[Os01g0274800]]
| 2.805
| 2805
| 1
| 1
| 1
| 2014/5/28 21:34
|-
|[[BGIOSGA033504|'''''csld4''''']]
|[[BGIOSGA033504]]
| 2.803
| 2818
| 0.995
| 2
| 2
| 2014/6/3 16:43
|-
|[[Os11g0454000|'''''rab16c''''']]
|[[Os11g0454000]]
| 2.786
| 5342
| 0.522
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os10g0148000|'''''OsDIL''''']]
|[[Os10g0148000]]
| 2.697
| 5106
| 0.528
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os08g0566600|'''''PGR5''''']]
|[[Os08g0566600]]
| 2.632
| 4314
| 0.61
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os03g0150200|'''''OsAP23''''']]
|[[Os03g0150200]]
| 2.621
| 5115
| 0.512
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os05g0341600|'''''RAB21''''']]
|[[Os05g0341600]]
| 2.592
| 2640
| 0.982
| 2
| 3
| 2014/6/1 17:02
|-
|[[Os07g0191600|'''''STR2''''']]
|[[Os07g0191600]]
| 2.541
| 2541
| 1
| 1
| 1
| 2014/6/11 19:08
|-
|[[Os11g0208900|'''''xa5''''']]
|[[Os11g0208900]]
| 2.152
| 2152
| 1
| 1
| 1
| 2014/6/8 17:23
|-
|[[Os07g0492000|'''''OsNDPK1''''']]
|[[Os07g0492000]]
| 1.777
| 1777
| 1
| 1
| 1
| 2014/6/9 23:45
|-
|[[Os03g0741100|'''''OsbHLH148''''']]
|[[Os03g0741100]]
| 1.578
| 1578
| 1
| 1
| 1
| 2014/5/19 3:18
|}

Os06g0594600

2017-03-08T06:27:23Z

Xysj1981: Replaced content with "Please input one-sentence summary here. ==Annotated Information== ===Expression=== ===Evolution=== ==Labs working on this gene== ==References== ==Structured Inf..."

Please input one-sentence summary here.

==Annotated Information==

===Expression===

===Evolution===

==Labs working on this gene==

==References==

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 6]]
[[Category:Chromosome 6]]

RiceWiki:Curated Genes

2017-03-08T06:26:00Z

Xysj1981:

{|class="wikitable sortable" style="width:90%;text-align:center"
|-
!'''Gene Symbol'''
!'''RAP-DB-ID'''
!'''Total Contribution Score'''
!'''Summed Edit Quantity'''
!'''Averaged Edit Quality'''
!'''Contributor Count'''
!'''Edit Count*'''
!'''Last Edit Time'''
|-
|[[Os09g0114500|'''''BC12''''']]
|[[Os09g0114500]]
| 14.854
| 23746
| 0.626
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os10g0405500|'''''PAIR3''''']]
|[[Os10g0405500]]
| 10.742
| 10877
| 0.988
| 3
| 3
| 2014/6/8 23:39
|-
|[[Os09g0286400|'''''OsNHX5''''']]
|[[Os09g0286400]]
| 12.133
| 24113
| 0.503
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0306400|'''''OsbZIP71''''']]
|[[Os09g0306400]]
| 7.71
| 12551
| 0.614
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0417600|'''''OsWRKY76''''']]
|[[Os09g0417600]]
| 5.713
| 10209
| 0.56
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os09g0434200|'''''OsDSG1''''']]
|[[Os09g0434200]]
| 5.792
| 11879
| 0.488
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os10g0553300|'''''OsTPP2''''']]
|[[Os10g0553300]]
| 8.403
| 35721
| 0.235
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os10g0563600|'''''OsMSRA4.1''''']]
|[[Os10g0563600]]
| 7.778
| 13380
| 0.581
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0127600|'''''ONAC045''''']]
|[[Os11g0127600]]
| 7.065
| 12576
| 0.562
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os11g0648000|'''''OsNHX3''''']]
|[[Os11g0648000]]
| 7.638
| 15767
| 0.484
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os12g0569700|'''''OsHsp23.7''''']]
|[[Os12g0569700]]
| 6.412
| 13859
| 0.463
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os12g0583700|'''''ZFP252''''']]
|[[Os12g0583700]]
| 8.489
| 12862
| 0.66
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os08g0139000|'''''OsDEG10''''']]
|[[Os08g0139000]]
| 4.811
| 9008
| 0.534
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os08g0323700|'''''OsCCC1''''']]
|[[Os08g0323700]]
| 6.709
| 11315
| 0.593
| 2
| 2
| 2015/6/12 17:29
|-
|[[Os08g0441100|'''''OsCIPK06''''']]
|[[Os08g0441100]]
| 3.819
| 7418
| 0.515
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os08g0504700|'''''OsSAP11''''']]
|[[Os08g0504700]]
| 7.149
| 10763
| 0.664
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0540400|'''''OsCPK21''''']]
|[[Os08g0540400]]
| 10.561
| 19732
| 0.535
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os08g0546800|'''''OsHsfB2b''''']]
|[[Os08g0546800]]
| 12.399
| 23039
| 0.538
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os07g0186000|'''''OsTRXh1''''']]
|[[Os07g0186000]]
| 7.817
| 12275
| 0.637
| 2
| 2
| 2015/6/12 16:34
|-
|[[Os07g0556800|'''''OSRIP18''''']]
|[[Os07g0556800]]
| 8.473
| 12924
| 0.656
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os07g0666900|'''''OsNHX1''''']]
|[[Os07g0666900]]
| 11.455
| 21522
| 0.532
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0678600|'''''OsCIPK2''''']]
|[[Os07g0678600]]
| 5.575
| 11240
| 0.496
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0693800|'''''OsFAD8''''']]
|[[Os07g0693800]]
| 5.613
| 11290
| 0.497
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os06g0130100|'''''OsSIK1''''']]
|[[Os06g0130100]]
| 11.48
| 22964
| 0.5
| 2
| 2
| 2015/6/12 16:04
|-
|[[Os06g0472000|'''''OsMSRB1.1''''']]
|[[Os06g0472000]]
| 6.592
| 12098
| 0.545
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os06g0561000|'''''OsMIOX''''']]
|[[Os06g0561000]]
| 6.249
| 12468
| 0.501
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os06g0603600|'''''OsSPX1''''']]
|[[Os06g0603600]]
| 7.774
| 15383
| 0.505
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os06g0612800|'''''OsiSAP8''''']]
|[[Os06g0612800]]
| 8.934
| 14002
| 0.638
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0644200|'''''OVP1''''']]
|[[Os06g0644200]]
| 10.007
| 15443
| 0.648
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0651100|'''''YK1''''']]
|[[Os06g0651100]]
| 8.803
| 18547
| 0.475
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0662200|'''''OsbZIP52''''']]
|[[Os06g0662200]]
| 6.942
| 12388
| 0.56
| 2
| 2
| 2015/6/12 16:22
|-
|[[Os06g0727200|'''''OsCATB''''']]
|[[Os06g0727200]]
| 6.864
| 13184
| 0.521
| 2
| 2
| 2015/6/12 16:27
|-
|[[Os03g0117900|'''''HYR''''']]
|[[Os03g0117900]]
| 5.381
| 8815
| 0.61
| 2
| 2
| 2015/6/12 12:59
|-
|[[Os09g0457900|'''''OsEATB''''']]
|[[Os09g0457900]]
| 42.219
| 42219
| 1
| 1
| 1
| 2014/6/6 14:12
|-
|[[Os06g0208800|'''''LYP6''''']]
|[[Os06g0208800]]
| 35.205
| 40853
| 0.862
| 2
| 2
| 2015/6/12 16:09
|-
|'''''[[GW5]]'''''
|
| 31.812
| 31817
| 1
| 2
| 2
| 2014/6/8 22:47
|-
|[[Os03g0122600|'''''OsMADS50''''']]
|[[Os03g0122600]]
| 31.778
| 36672
| 0.867
| 2
| 2
| 2015/6/12 13:00
|-
|'''''[[Du1]]'''''
|
| 26.789
| 26797
| 1
| 2
| 2
| 2014/6/5 11:51
|-
|[[Os01g0771200|'''''XB24''''']]
|[[Os01g0771200]]
| 25.112
| 106499
| 0.236
| 3
| 14
| 2015/5/13 15:32
|-
|'''''[[IPA1]]'''''
|
| 22.636
| 22636
| 1
| 1
| 1
| 2014/6/1 14:57
|-
|'''''[[AB013448]]'''''
|
| 21.65
| 21650
| 1
| 1
| 1
| 2014/6/8 17:24
|-
|[[Os10g0542100|'''''MT''''']]
|[[Os10g0542100]]
| 21.515
| 25382
| 0.848
| 3
| 3
| 2015/6/13 16:56
|-
|'''''[[MADS]]'''''
|
| 21.305
| 21310
| 1
| 3
| 3
| 2014/6/7 19:11
|-
|'''''[[MYB]]'''''
|
| 21.082
| 21418
| 0.984
| 2
| 2
| 2013/7/16 10:48
|-
|[[Os09g0272900|'''''PB''''']]
|[[Os09g0272900]]
| 21.033
| 24405
| 0.862
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os01g0848400|'''''qSH1''''']]
|[[Os01g0848400]]
| 20.688
| 31733
| 0.652
| 2
| 2
| 2015/5/13 15:40
|-
|[[Os09g0441900|'''''OsDEP1''''']]
|[[Os09g0441900]]
| 18.815
| 18855
| 0.998
| 5
| 5
| 2014/6/11 0:23
|-
|[[Os09g0240200|'''''CONSTANS''''']]
|[[Os09g0240200]]
| 18.077
| 26433
| 0.684
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os04g0271200|'''''SRT701''''']]
|[[Os04g0271200]]
| 18.041
| 18413
| 0.98
| 5
| 9
| 2014/6/10 16:01
|-
|[[Os01g0678500|'''''OsTPC1''''']]
|[[Os01g0678500]]
| 17.989
| 29118
| 0.618
| 6
| 7
| 2015/5/13 15:24
|-
|[[Os03g0332400|'''''OsGLYII-2''''']]
|[[Os03g0332400]]
| 17.603
| 17603
| 1
| 1
| 1
| 2014/12/27 21:46
|-
|[[Os06g0196700|'''''OsARF16'''''']]
|[[Os06g0196700]]
| 17.411
| 28849
| 0.604
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os07g0261200|'''''Ghd7''''']]
|[[Os07g0261200]]
| 17.077
| 17414
| 0.981
| 2
| 2
| 2014/6/1 17:56
|-
|'''''[[Xa7]]'''''
|
| 16.58
| 16580
| 1
| 1
| 1
| 2014/5/30 14:34
|-
|[[Os03g0227700|'''''OsDWARF4''''']]
|[[Os03g0227700]]
| 16.238
| 28577
| 0.568
| 4
| 6
| 2015/6/12 13:36
|-
|'''''[[Pb1]]'''''
|
| 15.987
| 15987
| 1
| 1
| 1
| 2014/6/3 15:06
|-
|[[Os12g0597000|'''''CBL''''']]
|[[Os12g0597000]]
| 15.897
| 25737
| 0.618
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os01g0841500|'''''OsMYB3R2''''']]
|[[Os01g0841500]]
| 15.635
| 27885
| 0.561
| 3
| 4
| 2015/5/13 15:39
|-
|[[Os01g0182600|'''''GI''''']]
|[[Os01g0182600]]
| 14.75
| 22705
| 0.65
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os08g0162100|'''''ASP1''''']]
|[[Os08g0162100]]
| 14.743
| 14743
| 1
| 1
| 1
| 2015/6/12 17:26
|-
|[[Os02g0738900|'''''OsDRP2B''''']]
|[[Os02g0738900]]
| 14.365
| 21439
| 0.67
| 2
| 2
| 2015/5/14 13:58
|-
|[[Os06g0594600|'''''OsAt10''''']]
|[[Os06g0594600]]
| 14.147
| 19008
| 0.744
| 3
| 4
| 2015/6/12 16:17
|-
|[[Os01g57340|'''''Npi37''''']]
|[[Os01g57340]]
| 14.08
| 14080
| 1
| 1
| 1
| 2014/5/27 20:22
|-
|[[Os01g0718300|'''''OsBRI1''''']]
|[[Os01g0718300]]
| 14.008
| 25923
| 0.54
| 3
| 3
| 2015/5/13 15:26
|-
|'''''[[Du2]]'''''
|
| 13.964
| 13964
| 1
| 2
| 2
| 2014/6/5 11:53
|-
|'''''[[OsMYB103L]]'''''
|
| 13.96
| 13960
| 1
| 1
| 1
| 2014/6/11 16:14
|-
|[[Os01g0782100|''''' Pi-sh''''']]
|[[Os01g0782100]]
| 13.897
| 27151
| 0.512
| 3
| 3
| 2015/5/13 15:34

|-
|[[Os06g0706400|'''''OsPTR9''''']]
|[[Os06g0706400]]
| 13.739
| 20020
| 0.686
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os08g0398400|'''''OsHIR1''''']]
|[[Os08g0398400]]
| 13.721
| 13748
| 0.998
| 3
| 6
| 2014/6/3 16:40
|-
|[[Os02g0141300|'''''CAP1''''']]
|[[Os02g0141300]]
| 13.71
| 28137
| 0.487
| 5
| 10
| 2015/5/14 13:21
|-
|[[Os07g0214100|'''''RAG1''''']]
|[[Os07g0214100]]
| 13.62
| 31302
| 0.435
| 2
| 2
| 2015/6/12 16:36
|-
|'''''[[DWT1]]'''''
|
| 13.275
| 13275
| 1
| 1
| 1
| 2014/5/31 12:55
|-
|[[Os01g0797600|'''''OsERF3''''']]
|[[Os01g0797600]]
| 13.247
| 13247
| 1
| 1
| 1
| 2014/5/25 15:17
|-
|[[Os01g0883800|'''''semidwarf-1''''']]
|[[Os01g0883800]]
| 13.17
| 24896
| 0.529
| 16
| 41
| 2016/6/17 17:22
|-
|[[Os08g0524100|'''''OsSRT1''''']]
|[[Os08g0524100]]
| 13.001
| 18711
| 0.695
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os08g0559300|'''''SPINDLY''''']]
|[[Os08g0559300]]
| 12.718
| 21018
| 0.605
| 3
| 6
| 2015/6/12 17:35
|-
|[[Os11g0225300|'''''PAMP''''']]
|[[Os11g0225300]]
| 12.691
| 23520
| 0.54
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os07g0155600|'''''OsEIN2''''']]
|[[Os07g0155600]]
| 12.605
| 18316
| 0.688
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os01g0607200|'''''OsBAT1''''']]
|[[Os01g0607200]]
| 12.553
| 19986
| 0.628
| 2
| 2
| 2015/5/13 15:17
|-
|[[Os07g0616800|'''''SUS''''']]
|[[Os07g0616800]]
| 12.42
| 26693
| 0.465
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os12g0102400|'''''OsRINGC2-2''''']]
|[[Os12g0102400]]
| 12.278
| 17739
| 0.692
| 3
| 3
| 2015/6/13 17:13
|-
|'''''[[WRKY]]'''''
|
| 12.226
| 12233
| 0.999
| 2
| 2
| 2014/5/31 12:44
|-
|[[Os10g0536100|'''''OsMADS50''''']]
|[[Os10g0536100]]
| 11.96
| 19080
| 0.627
| 3
| 3
| 2015/6/13 16:52
|-
|[[Os02g0725900|'''''HAP3''''']]
|[[Os02g0725900]]
| 11.931
| 16469
| 0.724
| 2
| 2
| 2015/5/14 13:55
|-
|[[Os01g0626400|'''''OsWRKY11''''']]
|[[Os01g0626400]]
| 11.902
| 18881
| 0.63
| 2
| 2
| 2015/5/13 15:20
|-
|[[Os01g0726400|'''''CFO1''''']]
|[[Os01g0726400]]
| 11.891
| 17625
| 0.675
| 2
| 2
| 2015/5/13 15:27
|-
|[[Os09g0422500|'''''OsCESA9''''']]
|[[Os09g0422500]]
| 11.747
| 23511
| 0.5
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os09g0250700|'''''OsABC1-12''''']]
|[[Os09g0250700]]
| 11.742
| 15681
| 0.749
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os06g0701300|'''''OsABC1-8''''']]
|[[Os06g0701300]]
| 11.604
| 15691
| 0.74
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0126400|'''''OsCPK4''''']]
|[[Os02g0126400]]
| 11.6
| 22962
| 0.505
| 2
| 2
| 2015/5/14 13:20
|-
|[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]
|[[Os06g0570100]]
| 11.586
| 15710
| 0.737
| 3
| 3
| 2015/6/12 16:16
|-
|[[Os03g0793500|'''''Hd16''''']]
|[[Os03g0793500]]
| 11.531
| 15843
| 0.728
| 2
| 2
| 2015/5/15 13:43
|-
|[[Os01g0536000|'''''OsCIPK08''''']]
|[[Os01g0536000]]
| 11.52
| 15150
| 0.76
| 2
| 2
| 2015/5/13 15:15
|-
|[[Os03g0848700|'''''Bph14''''']]
|[[Os03g0848700]]
| 11.486
| 21573
| 0.532
| 4
| 4
| 2015/5/15 13:41
|-
|[[Os01g0907900|'''''PLA2''''']]
|[[Os01g0907900]]
| 11.483
| 11485
| 1
| 2
| 2
| 2014/6/2 17:56
|-
|[[Os07g0459200|'''''OsABC1-10''''']]
|[[Os07g0459200]]
| 11.449
| 15381
| 0.744
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os07g0102300|'''''SRL1''''']]
|[[Os07g0102300]]
| 11.423
| 22326
| 0.512
| 3
| 3
| 2015/6/12 16:30
|-
|[[Os07g0186200|'''''OsSIK2''''']]
|[[Os07g0186200]]
| 11.413
| 20165
| 0.566
| 3
| 3
| 2015/6/12 16:34
|-
|[[Os03g0226800|'''''CMT3''''']]
|[[Os03g0226800]]
| 11.245
| 21415
| 0.525
| 3
| 3
| 2015/6/12 13:36
|-
|[[Os08g0114200|'''''OsGLU3''''']]
|[[Os08g0114200]]
| 11.137
| 17754
| 0.627
| 2
| 2
| 2015/6/12 17:23
|-
|[[Os07g0596300|'''''FH5''''']]
|[[Os07g0596300]]
| 11.085
| 15490
| 0.716
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os02g0178800|'''''OsGL1-2''''']]
|[[Os02g0178800]]
| 11.079
| 14720
| 0.753
| 2
| 2
| 2015/5/14 13:23
|-
|[[Os03g0811100|''''' Chl1''''']]
|[[Os03g0811100]]
| 11.068
| 14957
| 0.74
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os09g0395300|'''''SLL1''''']]
|[[Os09g0395300]]
| 11.063
| 16461
| 0.672
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g03150|'''''TAD1''''']]
|[[Os03g03150]]
| 10.972
| 10972
| 1
| 1
| 1
| 2014/6/9 12:35
|-
|[[Os12g0189500|'''''OsYUC11''''']]
|[[Os12g0189500]]
| 10.931
| 20645
| 0.529
| 7
| 7
| 2015/6/13 17:16
|-
|[[Os06g0211200|'''''OsAREB1''''']]
|[[Os06g0211200]]
| 10.925
| 19995
| 0.546
| 5
| 6
| 2015/6/12 16:09
|-
|[[Os02g0100200|'''''HSP''''']]
|[[Os02g0100200]]
| 10.917
| 21797
| 0.501
| 2
| 2
| 2015/5/14 13:17
|-
|'''''[[BHLH]]'''''
|
| 10.829
| 10829
| 1
| 1
| 1
| 2013/7/21 20:47
|-
|[[Os11g0703900|'''''Hsp70''''']]
|[[Os11g0703900]]
| 10.813
| 10898
| 0.992
| 4
| 5
| 2014/6/9 23:54
|-
|[[Os01g44260|'''''OsDfr''''']]
|[[Os01g44260]]
| 10.787
| 10787
| 1
| 1
| 1
| 2014/6/9 21:48
|-
|[[Os03g0815100|'''''SNAC1''''']]
|[[Os03g0815100]]
| 10.722
| 15783
| 0.679
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os10g0561400|'''''OsMYBS3''''']]
|[[Os10g0561400]]
| 10.656
| 22236
| 0.479
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0523800|'''''OsARF1''''']]
|[[Os11g0523800]]
| 10.633
| 21943
| 0.485
| 6
| 6
| 2015/6/13 17:08
|-
|[[Os07g0257200|'''''OsNRAMP5''''']]
|[[Os07g0257200]]
| 10.556
| 10556
| 1
| 1
| 1
| 2015/6/12 16:38
|-
|[[Os02g0661100|'''''OsTPP1''''']]
|[[Os02g0661100]]
| 10.544
| 18837
| 0.56
| 2
| 2
| 2015/5/14 13:51
|-
|[[Os07g0164000|'''''WAF1''''']]
|[[Os07g0164000]]
| 10.534
| 11864
| 0.888
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os12g0476200|'''''Xa25''''']]
|[[Os12g0476200]]
| 10.44
| 17073
| 0.611
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os10g0497300|'''''Rf1a''''']]
|[[Os10g0497300]]
| 10.431
| 18232
| 0.572
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os07g0108900|'''''OsMADS15''''']]
|[[Os07g0108900]]
| 10.425
| 20545
| 0.507
| 4
| 5
| 2015/6/12 16:31
|-
|[[Os03g0215400|'''''MADS1''''']]
|[[Os03g0215400]]
| 10.412
| 14715
| 0.708
| 2
| 2
| 2015/6/12 13:34
|-
|[[Os08g0174700|'''''OsSERK1''''']]
|[[Os08g0174700]]
| 10.335
| 21519
| 0.48
| 2
| 2
| 2015/6/12 17:28
|-
|[[Os01g0121700|'''''OsWBC1''''']]
|[[Os01g0121700]]
| 10.278
| 14300
| 0.719
| 2
| 2
| 2015/5/13 14:49
|-
|[[Os01g0201700|'''''OsMADS3''''']]
|[[Os01g0201700]]
| 10.276
| 20440
| 0.503
| 2
| 2
| 2015/5/13 15:03
|-
|[[Os10g0577600|'''''JMJ706''''']]
|[[Os10g0577600]]
| 10.16
| 18081
| 0.562
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0839100|'''''ZFP179''''']]
|[[Os01g0839100]]
| 10.128
| 13298
| 0.762
| 2
| 2
| 2015/5/13 15:38
|-
|[[Os03g0237250|'''''LPA1''''']]
|[[Os03g0237250]]
| 10.125
| 14184
| 0.714
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0133000|'''''Waxy''''']]
|[[Os06g0133000]]
| 10.084
| 22204
| 0.454
| 3
| 3
| 2015/6/12 16:04
|-
|[[Os03g0805100|'''''SQS''']]
|[[Os03g0805100]]
| 10.051
| 13542
| 0.742
| 2
| 2
| 2015/5/15 13:42
|-
|'''''[[AB013449]]'''''
|
| 10.03
| 10030
| 1
| 1
| 1
| 2014/6/10 22:14
|-
|[[Os07g0605200|'''''OsMADS18''''']]
|[[Os07g0605200]]
| 10.027
| 19041
| 0.527
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os06g0194900|'''''Sus''''']]
|[[Os06g0194900]]
| 10.026
| 20580
| 0.487
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os01g0764800|'''''GH3''''']]
|[[Os01g0764800]]
| 10.024
| 18674
| 0.537
| 2
| 2
| 2015/5/13 15:32
|-
|[[Os03g0111300|'''''NsLTPs''''']]
|[[Os03g0111300]]
| 10.013
| 12909
| 0.776
| 4
| 4
| 2015/6/12 12:57
|-
|[[Os10g0127900|'''''OsFbx352''''']]
|[[Os10g0127900]]
| 10.013
| 20618
| 0.486
| 4
| 8
| 2015/6/13 16:43
|-
|[[Os06g0662000|'''''OsVHA-A''''']]
|[[Os06g0662000]]
| 9.949
| 19796
| 0.503
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0254600|'''''CALEOSIN''''']]
|[[Os06g0254600]]
| 9.94
| 12129
| 0.82
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os06g0603000|'''''SE5''''']]
|[[Os06g0603000]]
| 9.889
| 9889
| 1
| 1
| 1
| 2014/6/9 17:03
|-
|[[Os08g0535200|'''''xa13''''']]
|[[Os08g0535200]]
| 9.858
| 18774
| 0.525
| 3
| 3
| 2015/6/12 17:34
|-
|[[Os12g0281300|'''''Pi-ta''''']]
|[[Os12g0281300]]
| 9.857
| 21855
| 0.451
| 4
| 4
| 2015/6/13 17:16
|-
|[[Os01g0919400|'''''SPS''''']]
|[[Os01g0919400]]
| 9.837
| 9837
| 1
| 1
| 1
| 2016/6/6 17:48
|-
|[[Os10g0573900|'''''OsNMD3''''']]
|[[Os10g0573900]]
| 9.818
| 16399
| 0.599
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0197100|'''''dwarf2''''']]
|[[Os01g0197100]]
| 9.81
| 19279
| 0.509
| 5
| 6
| 2015/5/13 14:59
|-
|[[Os11g0216300|'''''OsABC1-13''''']]
|[[Os11g0216300]]
| 9.795
| 13761
| 0.712
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os01g0102900|'''''Os-LIR1''''']]
|[[Os01g0102900]]
| 9.726
| 9726
| 1
| 1
| 1
| 2016/6/12 14:04
|-
|[[Os11g0249000|'''''NLS1''''']]
|[[Os11g0249000]]
| 9.718
| 17393
| 0.559
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os10g0467800|'''''OsCesA7''''']]
|[[Os10g0467800]]
| 9.68
| 22133
| 0.437
| 5
| 6
| 2015/6/13 16:48
|-
|[[Os02g0682200|'''''MADS6''''']]
|[[Os02g0682200]]
| 9.577
| 17192
| 0.557
| 3
| 13
| 2015/5/14 13:53
|-
|[[Os06g0569500|'''''GAs''''']]
|[[Os06g0569500]]
| 9.526
| 18834
| 0.506
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os09g0456800|'''''OsHsfs''''']]
|[[Os09g0456800]]
| 9.468
| 13735
| 0.689
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0274900|'''''OsGMST1''''']]
|[[Os02g0274900]]
| 9.449
| 18241
| 0.518
| 2
| 2
| 2015/5/14 13:38
|-
|[[Os06g0724900|'''''ILA1''''']]
|[[Os06g0724900]]
| 9.361
| 19950
| 0.469
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os01g0611100|'''''OsRAN1''''']]
|[[Os01g0611100]]
| 9.349
| 15330
| 0.61
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os08g0509600|'''''OsSPL14''''']]
|[[Os08g0509600]]
| 9.346
| 17625
| 0.53
| 3
| 4
| 2015/6/12 17:32
|-
|[[Os07g0558000|'''''OsABC1-11''''']]
|[[Os07g0558000]]
| 9.337
| 13289
| 0.703
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0449000|'''''PTC1''''']]
|[[Os09g0449000]]
| 9.33
| 16966
| 0.55
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os04g0415000|'''''BY240''''']]
|[[Os04g0415000]]
| 9.31
| 9310
| 1
| 1
| 1
| 2014/6/6 19:55
|-
|[[Os07g0471000|'''''OsIRE1''''']]
|[[Os07g0471000]]
| 9.278
| 18586
| 0.499
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os03g0170900|'''''OsSUT1''''']]
|[[Os03g0170900]]
| 9.272
| 19337
| 0.479
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os06g0610300|'''''MOC1''''']]
|[[Os06g0610300]]
| 9.171
| 11979
| 0.766
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0583400|'''''OsHDAC702''''']]
|[[Os06g0583400]]
| 9.15
| 11481
| 0.797
| 2
| 2
| 2015/6/12 16:16
|-
|[[Os02g0622100|'''''LTG1''''']]
|[[Os02g0622100]]
| 9.147
| 12303
| 0.743
| 2
| 2
| 2015/5/14 13:47
|-
|[[Os03g0203200|'''''HTD2''''']]
|[[Os03g0203200]]
| 9.128
| 17233
| 0.53
| 4
| 4
| 2015/6/12 13:06
|-
|[[Os06g0660200|'''''OsPIN2''''']]
|[[Os06g0660200]]
| 9.119
| 20530
| 0.444
| 5
| 6
| 2015/6/12 16:21
|-
|[[Os10g0403000|'''''PLA1 ''''']]
|[[Os10g0403000]]
| 9.104
| 15463
| 0.589
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os03g0112700|'''''Ehd4''''']]
|[[Os03g0112700]]
| 9.094
| 17122
| 0.531
| 3
| 3
| 2015/6/12 12:58
|-
|[[Os02g0799100|'''''Ossgo1''''']]
|[[Os02g0799100]]
| 9.068
| 16095
| 0.563
| 3
| 6
| 2015/5/14 14:02
|-
|[[Os09g0307800|'''''SDG724''''']]
|[[Os09g0307800]]
| 9.029
| 11279
| 0.801
| 4
| 15
| 2014/6/6 8:56
|-
|[[Os08g0424500|'''''Badh2''''']]
|[[Os08g0424500]]
| 9.021
| 17768
| 0.508
| 3
| 3
| 2015/6/12 17:30
|-
|[[Os11g0184900|'''''OsNAC5''''']]
|[[Os11g0184900]]
| 9.016
| 15182
| 0.594
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0203700|'''''SRZ1''''']]
|[[Os02g0203700]]
| 9.003
| 12324
| 0.731
| 2
| 2
| 2015/5/14 13:26
|-
|[[Os06g0125000|'''''RPM1''''']]
|[[Os06g0125000]]
| 8.97
| 12695
| 0.707
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os03g0128700|'''''OsCDPK13''''']]
|[[Os03g0128700]]
| 8.928
| 17882
| 0.499
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os03g0215200|'''''DL''''']]
|[[Os03g0215200]]
| 8.927
| 14196
| 0.629
| 3
| 3
| 2015/6/12 13:07
|-
|[[Os01g0952800|'''''OsIRO2''''']]
|[[Os01g0952800]]
| 8.922
| 8922
| 1
| 1
| 1
| 2014/6/10 21:52
|-
|[[Os06g0494100|'''''Pi-d2''''']]
|[[Os06g0494100]]
| 8.906
| 12742
| 0.699
| 3
| 3
| 2015/6/12 16:14
|-
|[[Os03g0149100|'''''OsCrl1''''']]
|[[Os03g0149100]]
| 8.897
| 13456
| 0.661
| 3
| 4
| 2015/6/12 11:15
|-
|'''''[[BZIP]]'''''
|
| 8.894
| 8924
| 0.997
| 2
| 2
| 2013/7/21 21:01
|-
|[[Os06g0625900|'''''OsHAK10''''']]
|[[Os06g0625900]]
| 8.872
| 13033
| 0.681
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0229800|'''''ALK''''']]
|[[Os06g0229800]]
| 8.835
| 16807
| 0.526
| 2
| 2
| 2015/6/12 16:11
|-
|[[Os07g0232900|'''''OsHMA3''''']]
|[[Os07g0232900]]
| 8.79
| 18004
| 0.488
| 3
| 8
| 2015/6/12 16:37
|-
|[[Os07g0129700|'''''OSH15''''']]
|[[Os07g0129700]]
| 8.789
| 18504
| 0.475
| 3
| 3
| 2015/6/12 16:32
|-
|[[Os12g0641400|'''''OsSUT2''''']]
|[[Os12g0641400]]
| 8.735
| 8735
| 1
| 1
| 1
| 2016/6/12 13:56
|-
|[[Os08g0137100|'''''OsFIE2''''']]
|[[Os08g0137100]]
| 8.717
| 8717
| 1
| 1
| 1
| 2015/6/12 17:25
|-
|'''''[[Htd1]]'''''
|
| 8.705
| 8705
| 1
| 1
| 1
| 2014/6/10 14:14
|-
|[[Os03g0707600|'''''GAI''''']]
|[[Os03g0707600]]
| 8.666
| 16659
| 0.52
| 2
| 5
| 2014/5/28 0:43
|-
|'''''[[Xa23]]'''''
|
| 8.641
| 8641
| 1
| 1
| 1
| 2014/5/31 21:49
|-
|[[Os11g0235200|'''''SP1''''']]
|[[Os11g0235200]]
| 8.563
| 17156
| 0.499
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os07g0100600|'''''OsPTR1''''']]
|[[Os07g0100600]]
| 8.559
| 15027
| 0.57
| 2
| 2
| 2015/6/12 16:30
|-
|[[Os06g0597000|'''''OsIAA23''''']]
|[[Os06g0597000]]
| 8.509
| 16209
| 0.525
| 4
| 11
| 2014/5/19 22:42
|-
|[[Os02g0232100|'''''HEI10''''']]
|[[Os02g0232100]]
| 8.485
| 15567
| 0.545
| 2
| 2
| 2015/5/14 13:36
|-
|[[Os04g0452500|'''''ZEP1''''']]
|[[Os04g0452500]]
| 8.484
| 8484
| 1
| 1
| 1
| 2014/5/31 16:56
|-
|[[Os09g0363900|'''''ONI3''''']]
|[[Os09g0363900]]
| 8.473
| 12412
| 0.683
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os09g0426800|'''''WSL2''''']]
|[[Os09g0426800]]
| 8.447
| 9634
| 0.877
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0253300|'''''alpha-1a''''']]
|[[Os01g0253300]]
| 8.439
| 17745
| 0.476
| 5
| 5
| 2015/5/13 15:07
|-
|[[Os06g0683400|'''''OsCCD1''''']]
|[[Os06g0683400]]
| 8.438
| 8438
| 1
| 1
| 1
| 2016/6/12 14:00
|-
|[[Os09g0522000|'''''OsDREB''''']]
|[[Os09g0522000]]
| 8.335
| 8335
| 1
| 1
| 1
| 2014/5/24 21:12
|-
|[[Os02g0580300|'''''GID2''''']]
|[[Os02g0580300]]
| 8.329
| 15752
| 0.529
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os08g0499300|'''''OsWRKY30''''']]
|[[Os08g0499300]]
| 8.324
| 17032
| 0.489
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0445700|'''''TPS''''']]
|[[Os08g0445700]]
| 8.317
| 10922
| 0.761
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os10g0505700|'''''LTPs''''']]
|[[Os10g0505700]]
| 8.312
| 16220
| 0.512
| 5
| 6
| 2015/6/13 16:46
|-
|[[Os11g0559200|'''''OsXa21''''']]
|[[Os11g0559200]]
| 8.294
| 15586
| 0.532
| 6
| 9
| 2015/6/13 17:08
|-
|[[Os03g0179400|'''''GUDK''''']]
|[[Os03g0179400]]
| 8.292
| 14840
| 0.559
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os02g0553200|'''''OsAPx8''''']]
|[[Os02g0553200]]
| 8.204
| 8204
| 1
| 1
| 1
| 2014/6/8 16:03
|-
|[[Os01g0571300|'''''OsHsfA7''''']]
|[[Os01g0571300]]
| 8.184
| 14946
| 0.548
| 2
| 2
| 2015/5/13 15:16
|-
|[[Os09g0401100|'''''STR1''''']]
|[[Os09g0401100]]
| 8.183
| 17216
| 0.475
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os02g0181300|'''''WRKY''''']]
|[[Os02g0181300]]
| 8.174
| 13252
| 0.617
| 2
| 2
| 2015/5/14 13:24
|-
|[[Os05g0346200|'''''OsDREB2B2''''']]
|[[Os05g0346200]]
| 8.14
| 8233
| 0.989
| 2
| 3
| 2014/6/5 17:14
|-
|[[Os09g0502100|'''''LGD1''''']]
|[[Os09g0502100]]
| 8.139
| 15501
| 0.525
| 2
| 2
| 2015/6/12 22:35
|-
|[[Os03g0820300|'''''ZFP182''''']]
|[[Os03g0820300]]
| 8.137
| 11604
| 0.701
| 2
| 2
| 2015/5/15 13:41
|-
|[[Os03g0230300|'''''OsSRO1c''''']]
|[[Os03g0230300]]
| 8.029
| 15193
| 0.528
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os07g0438800|'''''OsPHR2''''']]
|[[Os07g0438800]]
| 8.026
| 15610
| 0.514
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os02g0534400|'''''OsCIN1''''']]
|[[Os02g0534400]]
| 7.997
| 16635
| 0.481
| 2
| 2
| 2015/5/14 13:41
|-
|[[Os06g0165600|'''''OsDREB1D''''']]
|[[Os06g0165600]]
| 7.982
| 11937
| 0.669
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os11g0490600|'''''LAZY1''''']]
|[[Os11g0490600]]
| 7.98
| 16603
| 0.481
| 4
| 5
| 2015/6/13 17:07
|-
|[[Os07g0585700|'''''Sdr4''''']]
|[[Os07g0585700]]
| 7.966
| 7966
| 1
| 1
| 1
| 2014/6/9 23:14
|-
|[[Os01g0194300|'''''OsNPR1''''']]
|[[Os01g0194300]]
| 7.966
| 11111
| 0.717
| 2
| 2
| 2015/5/13 14:59
|-
|[[Os01g0869900|'''''SNF1''''']]
|[[Os01g0869900]]
| 7.964
| 16289
| 0.489
| 2
| 2
| 2015/5/13 15:42
|-
|[[Os06g0160700|'''''SSSl''''']]
|[[Os06g0160700]]
| 7.962
| 15027
| 0.53
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os09g0451500|'''''PDI''''']]
|[[Os09g0451500]]
| 7.903
| 10040
| 0.787
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os01g0759400|'''''OsCIPK12''''']]
|[[Os01g0759400]]
| 7.902
| 15742
| 0.502
| 2
| 2
| 2015/5/13 15:30
|-
|[[Os06g0205100|'''''OsC1-Myb''''']]
|[[Os06g0205100]]
| 7.891
| 12914
| 0.611
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os09g0244900|'''''Ypt1p''''']]
|[[Os09g0244900]]
| 7.89
| 11371
| 0.694
| 2
| 2
| 2015/6/12 17:38
|-
|'''''[[HTD2]]'''''
|
| 7.887
| 7887
| 1
| 1
| 1
| 2014/6/4 22:20
|-
|[[Os09g0482400|'''''HSP82''''']]
|[[Os09g0482400]]
| 7.873
| 11843
| 0.665
| 2
| 2
| 2015/6/12 17:47
|-
|[[Os10g0478000|'''''TAW1''''']]
|[[Os10g0478000]]
| 7.871
| 12275
| 0.641
| 4
| 5
| 2015/6/13 16:47
|-
|[[Os07g0258400|'''''OsNRAMP1''''']]
|[[Os07g0258400]]
| 7.866
| 13708
| 0.574
| 2
| 2
| 2015/6/12 16:38
|-
|[[Os10g0445400|'''''OsHCI1''''']]
|[[Os10g0445400]]
| 7.848
| 15652
| 0.501
| 6
| 15
| 2015/6/13 16:48
|-
|[[Os01g0273800|'''''OsYUC9''''']]
|[[Os01g0273800]]
| 7.843
| 9988
| 0.785
| 2
| 2
| 2015/5/13 15:10
|-
|[[Os01g0643300|'''''OsPIN10a''''']]
|[[Os01g0643300]]
| 7.839
| 16276
| 0.482
| 3
| 3
| 2015/5/13 15:22
|-
|[[Os06g0286700|'''''Pi9''''']]
|[[Os06g0286700]]
| 7.816
| 16653
| 0.469
| 6
| 9
| 2015/6/12 16:13
|-
|[[Os11g0104300|'''''DWARF53''''']]
|[[Os11g0104300]]
| 7.791
| 11682
| 0.667
| 4
| 4
| 2015/6/13 17:00
|-
|[[Os07g0150700|'''''Os-AKT1''''']]
|[[Os07g0150700]]
| 7.79
| 15994
| 0.487
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os09g0494200|'''''BC15''''']]
|[[Os09g0494200]]
| 7.776
| 7776
| 1
| 1
| 1
| 2014/6/3 23:51
|-
|[[Os03g0181500|'''''ONI1''''']]
|[[Os03g0181500]]
| 7.751
| 12230
| 0.634
| 3
| 4
| 2015/6/12 13:05
|-
|[[Os02g0814200|'''''OsGL1-6''''']]
|[[Os02g0814200]]
| 7.743
| 13379
| 0.579
| 2
| 2
| 2015/5/14 14:03
|-
|[[Os02g0103800|'''''OsLFNR1''''']]
|[[Os02g0103800]]
| 7.686
| 7686
| 1
| 1
| 1
| 2016/6/12 14:12
|-
|[[Os11g0225100|'''''Pia''''']]
|[[Os11g0225100]]
| 7.669
| 12296
| 0.624
| 3
| 3
| 2015/6/13 17:04
|-
|'''''[[Pi1]]'''''
|
| 7.644
| 7644
| 1
| 1
| 1
| 2014/6/5 17:02
|-
|[[Os01g0307500|'''''SKC1''''']]
|[[Os01g0307500]]
| 7.639
| 7639
| 1
| 1
| 1
| 2014/6/7 21:57
|-
|'''''[[Chalk5]]'''''
|
| 7.635
| 7635
| 1
| 1
| 1
| 2014/5/29 11:10
|-
|[[Os08g0140300|'''''TDC''''']]
|[[Os08g0140300]]
| 7.633
| 13769
| 0.554
| 2
| 2
| 2015/6/12 17:26
|-
|[[Os07g0622900|'''''DTM1''''']]
|[[Os07g0622900]]
| 7.632
| 14288
| 0.534
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os01g0292200|'''''OsCIPK1''''']]
|[[Os01g0292200]]
| 7.626
| 12859
| 0.593
| 2
| 2
| 2015/5/13 15:11
|-
|[[Os03g0230500|'''''DSM3''''']]
|[[Os03g0230500]]
| 7.618
| 14126
| 0.539
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os12g0472500|'''''OsTDL1A''''']]
|[[Os12g0472500]]
| 7.581
| 13819
| 0.549
| 4
| 4
| 2015/6/13 17:17
|-
|[[Os03g0262900|'''''glup6''''']]
|[[Os03g0262900]]
| 7.571
| 15719
| 0.482
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0107700|'''''OsLFNR2''''']]
|[[Os06g0107700]]
| 7.533
| 7533
| 1
| 1
| 1
| 2016/6/6 9:33
|-
|[[Os02g57310|'''''Pib''''']]
|[[Os02g57310]]
| 7.531
| 7531
| 1
| 1
| 1
| 2014/6/6 14:27
|-
|[[Os09g0104200|'''''OsRAD51D''''']]
|[[Os09g0104200]]
| 7.502
| 15399
| 0.487
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os06g0142600|'''''Hd17''''']]
|[[Os06g0142600]]
| 7.492
| 11545
| 0.649
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os03g0788500|'''''OsCPK10''''']]
|[[Os03g0788500]]
| 7.454
| 10159
| 0.734
| 2
| 2
| 2015/5/15 13:44
|-
|[[Os06g0139000|'''''F-box''''']]
|[[Os06g0139000]]
| 7.443
| 15282
| 0.487
| 3
| 4
| 2015/6/12 16:05
|-
|[[Os03g0168600|'''''CYP704B2''''']]
|[[Os03g0168600]]
| 7.43
| 12348
| 0.602
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os11g0117400|'''''OsWRKY89''''']]
|[[Os11g0117400]]
| 7.353
| 11607
| 0.633
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os03g0223400|'''''OsGLN1_2''''']]
|[[Os03g0223400]]
| 7.313
| 14417
| 0.507
| 3
| 3
| 2015/6/12 13:35
|-
|[[Os02g0731200|'''''MADS57''''']]
|[[Os02g0731200]]
| 7.311
| 14927
| 0.49
| 2
| 2
| 2015/5/14 13:56
|-
|[[Os09g02650|'''''BC12''''']]
|[[Os09g02650]]
| 7.302
| 7302
| 1
| 1
| 1
| 2014/6/1 19:01
|-
|[[Os01g0859300|'''''OsABI5''''']]
|[[Os01g0859300]]
| 7.265
| 12246
| 0.593
| 2
| 2
| 2015/5/13 15:41
|-
|[[Os08g0105000|'''''Ghd7''''']]
|[[Os08g0105000]]
| 7.237
| 15311
| 0.473
| 4
| 4
| 2015/6/12 17:23
|-
|[[Os03g0110800|'''''OsDRM2''''']]
|[[Os03g0110800]]
| 7.203
| 14838
| 0.485
| 2
| 2
| 2015/6/12 12:57
|-
|[[Os01g0367100|'''''PHD1''''']]
|[[Os01g0367100]]
| 7.2
| 12561
| 0.573
| 3
| 3
| 2015/6/9 9:53
|-
|[[Os02g0191600|'''''OsbZIP16''''']]
|[[Os02g0191600]]
| 7.2
| 13785
| 0.522
| 2
| 2
| 2015/5/14 13:25
|-
|[[Os08g0137250|'''''FIE1''''']]
|[[Os08g0137250]]
| 7.185
| 14660
| 0.49
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os02g0220400|'''''Cga1''''']]
|[[Os02g0220400]]
| 7.158
| 17791
| 0.402
| 6
| 8
| 2015/5/14 13:36
|-
|[[Os10g0404500|'''''SUTs''''']]
|[[Os10g0404500]]
| 7.151
| 7164
| 0.998
| 2
| 2
| 2014/6/7 23:34
|-
|[[Os10g0177200|'''''OsDSR-1''''']]
|[[Os10g0177200]]
| 7.15
| 9017
| 0.793
| 3
| 3
| 2015/6/13 16:45
|-
|[[Os10g0496900|'''''OsPORB''''']]
|[[Os10g0496900]]
| 7.143
| 14022
| 0.509
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os02g0313400|'''''API5''''']]
|[[Os02g0313400]]
| 7.12
| 14554
| 0.489
| 2
| 2
| 2015/5/14 13:39
|-
|[[Os08g0117000|'''''PSS1''''']]
|[[Os08g0117000]]
| 7.092
| 8202
| 0.865
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os08g0531700|'''''MADS-box''''']]
|[[Os08g0531700]]
| 7.054
| 13276
| 0.531
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os06g0499500|'''''GH3''''']]
|[[Os06g0499500]]
| 7.051
| 12958
| 0.544
| 3
| 4
| 2015/6/12 16:15
|-
|[[Os03g0188400|'''''OsSRT1''''']]
|[[Os03g0188400]]
| 7.05
| 12067
| 0.584
| 2
| 2
| 2015/6/12 13:06
|-
|[[Os02g0649900|'''''OsYSL2''''']]
|[[Os02g0649900]]
| 7.031
| 12503
| 0.562
| 2
| 2
| 2015/5/14 13:48
|-
|[[Os09g0442700|'''''OsDDM1''''']]
|[[Os09g0442700]]
| 7.028
| 10589
| 0.664
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os12g0438600|'''''AtCLC-a''''']]
|[[Os12g0438600]]
| 7.022
| 14835
| 0.473
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os07g0124700|'''''CRL5''''']]
|[[Os07g0124700]]
| 6.998
| 14469
| 0.484
| 2
| 2
| 2015/6/12 16:31
|-
|[[Os11g0639100|'''''Pi54''''']]
|[[Os11g0639100]]
| 6.934
| 11269
| 0.615
| 4
| 4
| 2015/6/13 17:09
|-
|[[Os01g0615050|'''''OCPI1''''']]
|[[Os01g0615050]]
| 6.92
| 9869
| 0.701
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os12g0610200|'''''OsPIL11''''']]
|[[Os12g0610200]]
| 6.911
| 12604
| 0.548
| 4
| 4
| 2015/6/13 17:18
|-
|[[Os03g0123300|'''''TAD1''''']]
|[[Os03g0123300]]
| 6.87
| 15272
| 0.45
| 4
| 8
| 2015/6/12 13:00
|-
|[[Os07g0682800|'''''rth1''''']]
|[[Os07g0682800]]
| 6.853
| 13550
| 0.506
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os11g0446000|'''''RSS3''''']]
|[[Os11g0446000]]
| 6.838
| 13942
| 0.49
| 5
| 5
| 2015/6/13 17:07
|-
|[[Os07g0182900|'''''OsMET1a''''']]
|[[Os07g0182900]]
| 6.821
| 13295
| 0.513
| 5
| 11
| 2015/6/12 16:33
|-
|[[Os01g0205700|'''''OsGSK1''''']]
|[[Os01g0205700]]
| 6.813
| 12490
| 0.545
| 2
| 2
| 2015/5/13 15:04
|-
|[[Os05g0333200|'''''GPA1''''']]
|[[Os05g0333200]]
| 6.778
| 8703
| 0.779
| 2
| 2
| 2014/6/9 9:17
|-
|[[Os10g0167600|'''''OsCPDP''''']]
|[[Os10g0167600]]
| 6.756
| 14570
| 0.464
| 4
| 4
| 2015/6/13 16:45
|-
|[[Os07g0227800|'''''OsABC1-9''''']]
|[[Os07g0227800]]
| 6.744
| 10826
| 0.623
| 2
| 2
| 2015/6/12 16:37
|-
|[[Os10g0567400|'''''OsCAO1''''']]
|[[Os10g0567400]]
| 6.732
| 13437
| 0.501
| 3
| 3
| 2015/6/13 16:58
|-
|'''''[[DEP2]]'''''
|
| 6.724
| 6763
| 0.994
| 3
| 7
| 2014/6/10 22:30
|-
|[[Os07g0592600|'''''OsMGH3''''']]
|[[Os07g0592600]]
| 6.72
| 15320
| 0.439
| 5
| 11
| 2015/6/12 16:46
|-
|[[Os11g0126900|'''''OsNAC10''''']]
|[[Os11g0126900]]
| 6.705
| 6705
| 1
| 1
| 1
| 2014/5/24 12:41
|-
|[[Os09g0561600|'''''OsDEES1''''']]
|[[Os09g0561600]]
| 6.699
| 11352
| 0.59
| 2
| 2
| 2015/6/13 16:42
|-
|'''''[[Sub1A]]'''''
|
| 6.679
| 6679
| 1
| 1
| 1
| 2014/6/4 16:03
|-
|[[Os08g0126300|'''''OsGAPDH''''']]
|[[Os08g0126300]]
| 6.658
| 13730
| 0.485
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os10g0533600|'''''OsMPK6''''']]
|[[Os10g0533600]]
| 6.522
| 8207
| 0.795
| 3
| 3
| 2015/6/13 16:46
|-
|[[Os10g0397400|'''''dwarf2''''']]
|[[Os10g0397400]]
| 6.52
| 11105
| 0.587
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os06g0712700|'''''OsMADS16''''']]
|[[Os06g0712700]]
| 6.51
| 7624
| 0.854
| 2
| 2
| 2014/6/9 16:43
|-
|[[Os08g0237000|'''''OsXTH8''''']]
|[[Os08g0237000]]
| 6.46
| 6460
| 1
| 1
| 1
| 2014/6/9 18:44
|-
|[[Os02g0811000|'''''TH1''''']]
|[[Os02g0811000]]
| 6.453
| 11487
| 0.562
| 2
| 2
| 2015/5/14 14:02
|-
|[[Os07g0505200|'''''OsSPL13''''']]
|[[Os07g0505200]]
| 6.444
| 6444
| 1
| 1
| 1
| 2016/6/13 9:49
|-
|[[Os11g0247300|'''''Srs5''''']]
|[[Os11g0247300]]
| 6.442
| 13081
| 0.492
| 4
| 4
| 2015/6/13 17:05
|-
|[[AY986492|'''''Xa27''''']]
|[[AY986492]]
| 6.408
| 6408
| 1
| 2
| 2
| 2014/6/10 21:12
|-
|[[Os06g0700700|'''''OsHMA2''''']]
|[[Os06g0700700]]
| 6.404
| 6404
| 1
| 1
| 1
| 2014/6/3 20:16
|-
|[[Os02g0771400|'''''OsPFA-DSP2''''']]
|[[Os02g0771400]]
| 6.399
| 6702
| 0.955
| 2
| 3
| 2014/5/12 16:03
|-
|[[Os06g0127800|'''''DLT''''']]
|[[Os06g0127800]]
| 6.393
| 10797
| 0.592
| 2
| 2
| 2015/6/12 16:03
|-
|[[Os02g0120500|'''''OsTDR''''']]
|[[Os02g0120500]]
| 6.372
| 6372
| 1
| 1
| 1
| 2015/5/14 13:19
|-
|[[Os03g0854500|'''''OsHsfs''''']]
|[[Os03g0854500]]
| 6.367
| 10086
| 0.631
| 2
| 2
| 2015/5/15 13:40
|-
|[[Os06g0275000|'''''Hd1''''']]
|[[Os06g0275000]]
| 6.307
| 11994
| 0.526
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os02g0759800|'''''OsSKIPa''''']]
|[[Os02g0759800]]
| 6.249
| 12883
| 0.485
| 2
| 2
| 2015/5/14 14:00
|-
|[[Os08g0101000|'''''IDEF1''''']]
|[[Os08g0101000]]
| 6.239
| 10862
| 0.574
| 2
| 2
| 2015/6/12 17:22
|-
|[[Os09g0456200|'''''OsbZIP72''''']]
|[[Os09g0456200]]
| 6.23
| 10901
| 0.572
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os12g0101600|'''''leaf2''''']]
|[[Os12g0101600]]
| 6.221
| 35095
| 0.177
| 2
| 3
| 2014/5/31 21:22
|-
|[[Os06g0695800|'''''STAR1''''']]
|[[Os06g0695800]]
| 6.213
| 8582
| 0.724
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0606700|'''''RSS1''''']]
|[[Os02g0606700]]
| 6.198
| 12432
| 0.499
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os11g0210300|'''''Adh1''''']]
|[[Os11g0210300]]
| 6.196
| 12384
| 0.5
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0736400|'''''OsDHODH''''']]
|[[Os02g0736400]]
| 6.183
| 11839
| 0.522
| 2
| 2
| 2015/5/14 13:57
|-
|[[Os08g0549100|'''''OsAPx4''''']]
|[[Os08g0549100]]
| 6.175
| 10093
| 0.612
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os09g0452200|'''''LYP4''''']]
|[[Os09g0452200]]
| 6.171
| 11987
| 0.515
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0170300|'''''OsMADS29''''']]
|[[Os02g0170300]]
| 6.166
| 12582
| 0.49
| 3
| 4
| 2015/5/14 13:23
|-
|[[Os03g0224700|'''''Hsfs''''']]
|[[Os03g0224700]]
| 6.166
| 11925
| 0.517
| 4
| 4
| 2015/6/12 13:35
|-
|[[Os07g0558500|'''''THF1''''']]
|[[Os07g0558500]]
| 6.078
| 12744
| 0.477
| 5
| 9
| 2015/6/12 16:45
|-
|[[Os09g0511000|'''''OsCERK1''''']]
|[[Os09g0511000]]
| 6.076
| 12097
| 0.502
| 2
| 2
| 2015/6/12 22:35
|-
|'''''[[OsWRKY13]]'''''
|
| 6.069
| 6101
| 0.995
| 2
| 3
| 2014/6/4 20:18
|-
|[[Os06g0308100|'''''OsIBR5''''']]
|[[Os06g0308100]]
| 6.062
| 12455
| 0.487
| 2
| 2
| 2015/6/12 16:13
|-
|[[Os11g0113700|'''''OsCIPK15''''']]
|[[Os11g0113700]]
| 5.961
| 12261
| 0.486
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os02g0656600|'''''GPA3''''']]
|[[Os02g0656600]]
| 5.915
| 10022
| 0.59
| 2
| 2
| 2015/5/14 13:50
|-
|[[Os01g0733200|'''''OsHsfC1b''''']]
|[[Os01g0733200]]
| 5.889
| 5889
| 1
| 1
| 1
| 2014/5/31 11:56
|-
|[[Os01g0785400|'''''GH3''''']]
|[[Os01g0785400]]
| 5.864
| 10600
| 0.553
| 2
| 2
| 2015/5/13 15:34
|-
|[[Os04g0541700|'''''Oshox22''''']]
|[[Os04g0541700]]
| 5.857
| 6037
| 0.97
| 2
| 3
| 2014/6/8 16:10
|-
|[[Os08g0140500|'''''TDC-3''''']]
|[[Os08g0140500]]
| 5.829
| 11343
| 0.514
| 2
| 2
| 2015/6/12 17:26
|-
|'''''[[IPK1]]'''''
|
| 5.803
| 5803
| 1
| 1
| 1
| 2014/6/8 16:55
|-
|[[Os09g0522100|'''''CBF''''']]
|[[Os09g0522100]]
| 5.713
| 9270
| 0.616
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os01g0177900|'''''OsABCG31''''']]
|[[Os01g0177900]]
| 5.693
| 11327
| 0.503
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os02g0149800|'''''OsPP18''''']]
|[[Os02g0149800]]
| 5.681
| 11452
| 0.496
| 2
| 2
| 2015/5/14 13:22
|-
|[[Os01g0831000|'''''LAX''''']]
|[[Os01g0831000]]
| 5.68
| 9517
| 0.597
| 2
| 2
| 2015/5/13 15:37
|-
|[[Os05g0580500|'''''OsRAD21-4''''']]
|[[Os05g0580500]]
| 5.66
| 5660
| 1
| 1
| 1
| 2014/5/23 11:03
|-
|'''''[[OsCERK1]]'''''
|
| 5.61
| 5610
| 1
| 1
| 1
| 2014/6/1 18:31
|-
|[[Os11g0116200|'''''LTPs''''']]
|[[Os11g0116200]]
| 5.602
| 7206
| 0.777
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os09g0567800|'''''Lipase''''']]
|[[Os09g0567800]]
| 5.558
| 5558
| 1
| 1
| 1
| 2014/6/6 16:24
|-
|[[Os06g0610350|'''''OsMOC1''''']]
|[[Os06g0610350]]
| 5.547
| 5547
| 1
| 1
| 1
| 2016/6/12 13:57
|-
|[[Os02g0657000|'''''ARAG1''''']]
|[[Os02g0657000]]
| 5.536
| 9210
| 0.601
| 2
| 2
| 2015/5/14 13:51
|-
|'''''[[Wbph8]]'''''
|
| 5.531
| 5531
| 1
| 1
| 1
| 2014/6/10 18:50
|-
|[[Os07g0563300|'''''GD1''''']]
|[[Os07g0563300]]
| 5.487
| 11105
| 0.494
| 2
| 2
| 2015/6/12 16:45
|-
|[[Os06g0701700|'''''OsHKT2;1''''']]
|[[Os06g0701700]]
| 5.432
| 8295
| 0.655
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os10g0419200|'''''RID1''''']]
|[[Os10g0419200]]
| 5.432
| 9118
| 0.596
| 3
| 3
| 2015/6/13 16:44
|-
|'''''[[OsCEBiP]]'''''
|
| 5.419
| 5419
| 1
| 1
| 1
| 2014/6/8 12:32
|-
|'''''[[Xa10]]'''''
|
| 5.416
| 5416
| 1
| 1
| 1
| 2014/6/1 16:52
|-
|[[Os03g0272300|'''''OsSDIR1''''']]
|[[Os03g0272300]]
| 5.41
| 9862
| 0.549
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os10g0528300|'''''GSTs''''']]
|[[Os10g0528300]]
| 5.364
| 9566
| 0.561
| 3
| 3
| 2015/6/13 16:46
|-
|'''''[[Badh2]]'''''
|
| 5.363
| 5363
| 1
| 1
| 1
| 2014/6/8 19:38
|-
|[[Os03g0233900|'''''Hbs''''']]
|[[Os03g0233900]]
| 5.348
| 9011
| 0.593
| 2
| 2
| 2015/6/12 13:38
|-
|'''''[[Xa21]]'''''
|
| 5.345
| 5345
| 1
| 1
| 1
| 2014/6/1 13:37
|-
|'''''[[Bls1]]'''''
|
| 5.308
| 5308
| 1
| 1
| 1
| 2014/5/24 15:17
|-
|[[Os06g0157700|'''''Hd3''''']]
|[[Os06g0157700]]
| 5.304
| 10277
| 0.516
| 2
| 2
| 2015/6/12 16:06
|-
|[[Os02g0260200|'''''LP''''']]
|[[Os02g0260200]]
| 5.302
| 7745
| 0.685
| 2
| 2
| 2015/5/14 13:37
|-
|[[Os03g0232600|'''''TUD1''''']]
|[[Os03g0232600]]
| 5.249
| 10595
| 0.495
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os03g0125100|'''''OsHYD3''''']]
|[[Os03g0125100]]
| 5.183
| 10331
| 0.502
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os06g0212900|'''''ORF3''''']]
|[[Os06g0212900]]
| 5.175
| 6651
| 0.778
| 3
| 3
| 2015/6/12 16:09
|-
|[[Os02g0491300|'''''MTR1''''']]
|[[Os02g0491300]]
| 5.166
| 10047
| 0.514
| 2
| 2
| 2015/5/14 13:40
|-
|[[Os09g0470500|'''''Oshox4''''']]
|[[Os09g0470500]]
| 5.144
| 9661
| 0.532
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os09g0439800|'''''DRO1''''']]
|[[Os09g0439800]]
| 5.122
| 8022
| 0.638
| 3
| 4
| 2015/6/12 17:43
|-
|[[Os12g0555500|'''''PBZ1''''']]
|[[Os12g0555500]]
| 5.108
| 8929
| 0.572
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os11g0508600|'''''Os-11N3''''']]
|[[Os11g0508600]]
| 5.066
| 7754
| 0.653
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os08g0174500|'''''OsDTH8''''']]
|[[Os08g0174500]]
| 5.017
| 9397
| 0.534
| 3
| 3
| 2015/6/12 17:28
|-
|[[Os03g0267200|'''''sHSP17.7''''']]
|[[Os03g0267200]]
| 5.008
| 7991
| 0.627
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os06g0622700|'''''OsbZIP50 ''''']]
|[[Os06g0622700]]
| 5
| 9868
| 0.507
| 2
| 2
| 2015/6/12 16:19
|-
|'''''[[SBP]]'''''
|
| 4.997
| 4997
| 1
| 1
| 1
| 2013/7/21 18:43
|-
|[[Os05g0465800|'''''PI3K''''']]
|[[Os05g0465800]]
| 4.939
| 4939
| 1
| 1
| 1
| 2014/6/6 16:19
|-
|[[Os10g0491000|'''''BSP''''']]
|[[Os10g0491000]]
| 4.912
| 8991
| 0.546
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os01g0206700|'''''OsCIPK05''''']]
|[[Os01g0206700]]
| 4.909
| 9664
| 0.508
| 2
| 2
| 2015/5/13 15:05
|-
|[[Os06g0643300|'''''RISBZ1''''']]
|[[Os06g0643300]]
| 4.869
| 7953
| 0.612
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os03g0180800|'''''OsTIFY11a''''']]
|[[Os03g0180800]]
| 4.859
| 8158
| 0.596
| 2
| 2
| 2015/6/12 13:04
|-
|'''''[[BPH_gene]]'''''
|
| 4.857
| 4857
| 1
| 2
| 2
| 2014/6/11 11:14
|-
|[[Os01g0805600|'''''CycB1''''']]
|[[Os01g0805600]]
| 4.842
| 4842
| 1
| 1
| 1
| 2014/6/5 18:11
|-
|[[Os06g0701600|'''''HKT''''']]
|[[Os06g0701600]]
| 4.831
| 7482
| 0.646
| 2
| 2
| 2015/6/12 16:25
|-
|[[Os08g0531600|'''''OsSPL16''''']]
|[[Os08g0531600]]
| 4.818
| 4825
| 0.999
| 2
| 2
| 2014/5/27 23:11
|-
|[[Os06g0254700|'''''OsCLO-6''''']]
|[[Os06g0254700]]
| 4.802
| 7514
| 0.639
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os01g0615100|'''''OCPI2''''']]
|[[Os01g0615100]]
| 4.794
| 7379
| 0.65
| 2
| 2
| 2015/5/13 15:19
|-
|'''''[[HSF]]'''''
|
| 4.772
| 4781
| 0.998
| 2
| 2
| 2013/7/21 20:57
|-
|[[Os06g0125800|'''''OsBBI1''''']]
|[[Os06g0125800]]
| 4.629
| 9410
| 0.492
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os07g0628500|'''''OsbHLH1''''']]
|[[Os07g0628500]]
| 4.606
| 8573
| 0.537
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os07g0694700|'''''APX''''']]
|[[Os07g0694700]]
| 4.569
| 8480
| 0.539
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os01g0293100|'''''TIP2''''']]
|[[Os01g0293100]]
| 4.568
| 8480
| 0.539
| 2
| 2
| 2015/5/13 15:12
|-
|'''''[[Rl14]]'''''
|
| 4.564
| 4764
| 0.958
| 2
| 2
| 2014/6/10 11:19
|-
|'''''[[OsRPA2]]'''''
|
| 4.552
| 4552
| 1
| 1
| 1
| 2014/6/6 9:13
|-
|[[Os06g0604000|'''''OsWR2''''']]
|[[Os06g0604000]]
| 4.53
| 8229
| 0.55
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os01g0192000|'''''OsDOS''''']]
|[[Os01g0192000]]
| 4.527
| 4527
| 1
| 1
| 1
| 2015/7/30 23:13
|-
|[[Os01g0922800|'''''OsMADS51''''']]
|[[Os01g0922800]]
| 4.506
| 4506
| 1
| 1
| 1
| 2014/5/24 18:45
|-
|[[Os02g0787300|'''''OsRac1''''']]
|[[Os02g0787300]]
| 4.483
| 6886
| 0.651
| 2
| 2
| 2015/5/14 14:01
|-
|[[Os09g0439200|'''''OsJAZ8''''']]
|[[Os09g0439200]]
| 4.477
| 8745
| 0.512
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0822900|'''''Dwarf1''''']]
|[[Os01g0822900]]
| 4.447
| 7550
| 0.589
| 3
| 4
| 2015/5/13 15:36
|-
|[[Os08g0167500|'''''CRR6''''']]
|[[Os08g0167500]]
| 4.432
| 8906
| 0.498
| 2
| 2
| 2015/6/12 17:27
|-
|'''''[[Sucrose_synthase]]'''''
|
| 4.428
| 4436
| 0.998
| 2
| 2
| 2013/7/18 11:20
|-
|'''''[[CL971152]]'''''
|
| 4.417
| 4472
| 0.988
| 2
| 2
| 2014/6/10 21:51
|-
|[[Os12g0603700|'''''OsCIPK04''''']]
|[[Os12g0603700]]
| 4.375
| 9322
| 0.469
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os02g0618400|'''''OsMPS''''']]
|[[Os02g0618400]]
| 4.347
| 8707
| 0.499
| 2
| 2
| 2015/5/14 13:45
|-
|[[Os03g0182800|'''''OsDERF1''''']]
|[[Os03g0182800]]
| 4.322
| 6519
| 0.663
| 2
| 2
| 2015/6/12 13:05
|-
|'''''[[ARF]]'''''
|
| 4.308
| 4308
| 1
| 1
| 1
| 2013/7/21 20:46
|-
|[[Os03g0183000|'''''OsRAF''''']]
|[[Os03g0183000]]
| 4.286
| 4286
| 1
| 1
| 1
| 2014/6/9 20:10
|-
|[[Os02g0654700|'''''AP59''''']]
|[[Os02g0654700]]
| 4.285
| 8306
| 0.516
| 2
| 2
| 2015/5/14 13:49
|-
|[[Os09g0466400|'''''OsZHD1''''']]
|[[Os09g0466400]]
| 4.265
| 8095
| 0.527
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os03g0103300|'''''qLTG3''''']]
|[[Os03g0103300]]
| 4.188
| 7457
| 0.562
| 2
| 2
| 2015/6/12 12:56
|-
|[[Os01g0834400|'''''OsHAP3A''''']]
|[[Os01g0834400]]
| 4.109
| 4109
| 1
| 1
| 1
| 2014/5/31 19:19
|-
|[[Os07g0512200|'''''OsAtg8''''']]
|[[Os07g0512200]]
| 4.095
| 7690
| 0.533
| 4
| 4
| 2015/6/12 16:43
|-
|'''''[[Bph9]]'''''
|
| 4.084
| 4084
| 1
| 1
| 1
| 2014/6/9 12:23
|-
|[[Os06g0181700|'''''OsWR1''''']]
|[[Os06g0181700]]
| 4.083
| 7433
| 0.549
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os06g0157500|'''''RFT1''''']]
|[[Os06g0157500]]
| 4.013
| 7888
| 0.509
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os09g0537700|'''''OsRNS4''''']]
|[[Os09g0537700]]
| 3.992
| 6731
| 0.593
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os02g0610500|'''''OsCOL4''''']]
|[[Os02g0610500]]
| 3.946
| 3946
| 1
| 1
| 1
| 2014/5/20 11:57
|-
|[[Os07g0529600|'''''OsDR8''''']]
|[[Os07g0529600]]
| 3.915
| 6908
| 0.567
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0106700|'''''AKT1''''']]
|[[Os09g0106700]]
| 3.845
| 6498
| 0.592
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os07g0568700|'''''OsFOR1''''']]
|[[Os07g0568700]]
| 3.845
| 6600
| 0.583
| 2
| 2
| 2015/6/12 16:46
|-
|'''''[[Pik-p]]'''''
|
| 3.816
| 3816
| 1
| 1
| 1
| 2014/6/6 10:16
|-
|[[Os06g0493100|'''''Bphi008a''''']]
|[[Os06g0493100]]
| 3.804
| 7241
| 0.525
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os02g0552700|'''''OsZFP6''''']]
|[[Os02g0552700]]
| 3.779
| 6604
| 0.572
| 2
| 2
| 2015/5/14 13:43
|-
|[[Os12g0100500|'''''COG2267''''']]
|[[Os12g0100500]]
| 3.729
| 5669
| 0.658
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os07g0129200|'''''OsPR1''''']]
|[[Os07g0129200]]
| 3.716
| 6629
| 0.561
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os10g0558900|'''''RL14''''']]
|[[Os10g0558900]]
| 3.699
| 7398
| 0.5
| 5
| 9
| 2015/6/13 16:57
|-
|[[Os01g0177400|'''''ACO1''''']]
|[[Os01g0177400]]
| 3.693
| 6293
| 0.587
| 3
| 3
| 2015/5/13 14:57
|-
|[[Os09g0380200|'''''YLC1''''']]
|[[Os09g0380200]]
| 3.69
| 6890
| 0.536
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os08g0163400|'''''OsSIG1''''']]
|[[Os08g0163400]]
| 3.662
| 3662
| 1
| 1
| 1
| 2014/6/9 20:52
|-
|[[Os09g0396900|'''''OsVIT2''''']]
|[[Os09g0396900]]
| 3.437
| 6527
| 0.527
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g0786400|'''''OsCKX2''''']]
|[[Os03g0786400]]
| 3.372
| 3372
| 1
| 1
| 1
| 2014/5/20 0:08
|-
|'''''[[Bhp-3]]'''''
|
| 3.33
| 3330
| 1
| 1
| 1
| 2014/5/31 23:33
|-
|[[Os07g0641200|'''''OsCCaMK''''']]
|[[Os07g0641200]]
| 3.212
| 6389
| 0.503
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0549600|'''''UDT1''''']]
|[[Os07g0549600]]
| 3.204
| 5875
| 0.545
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os11g0582500|'''''OsC6''''']]
|[[Os11g0582500]]
| 3.13
| 5666
| 0.552
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os03g0135700|'''''RAI1''''']]
|[[Os03g0135700]]
| 3.126
| 3126
| 1
| 1
| 1
| 2014/6/7 0:43
|-
|[[Os09g0459200|'''''SG1''''']]
|[[Os09g0459200]]
| 3.094
| 5090
| 0.608
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os11g0523700|'''''OsICE1''''']]
|[[Os11g0523700]]
| 3.071
| 3079
| 0.997
| 2
| 2
| 2014/6/3 13:41
|-
|[[Os09g0522200|'''''OsDREB1A''''']]
|[[Os09g0522200]]
| 3.031
| 5920
| 0.512
| 3
| 3
| 2015/6/12 22:36
|-
|[[Os06g0127100|'''''OsDREB1C''''']]
|[[Os06g0127100]]
| 3.015
| 5846
| 0.516
| 3
| 3
| 2015/6/12 16:02
|-
|[[Os10g0573400|'''''OsPYL10''''']]
|[[Os10g0573400]]
| 3.009
| 6148
| 0.489
| 4
| 4
| 2015/6/13 16:58
|-
|[[Os01g0274800|'''''CSA''''']]
|[[Os01g0274800]]
| 2.805
| 2805
| 1
| 1
| 1
| 2014/5/28 21:34
|-
|[[BGIOSGA033504|'''''csld4''''']]
|[[BGIOSGA033504]]
| 2.803
| 2818
| 0.995
| 2
| 2
| 2014/6/3 16:43
|-
|[[Os11g0454000|'''''rab16c''''']]
|[[Os11g0454000]]
| 2.786
| 5342
| 0.522
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os10g0148000|'''''OsDIL''''']]
|[[Os10g0148000]]
| 2.697
| 5106
| 0.528
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os08g0566600|'''''PGR5''''']]
|[[Os08g0566600]]
| 2.632
| 4314
| 0.61
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os03g0150200|'''''OsAP23''''']]
|[[Os03g0150200]]
| 2.621
| 5115
| 0.512
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os05g0341600|'''''RAB21''''']]
|[[Os05g0341600]]
| 2.592
| 2640
| 0.982
| 2
| 3
| 2014/6/1 17:02
|-
|[[Os07g0191600|'''''STR2''''']]
|[[Os07g0191600]]
| 2.541
| 2541
| 1
| 1
| 1
| 2014/6/11 19:08
|-
|[[Os11g0208900|'''''xa5''''']]
|[[Os11g0208900]]
| 2.152
| 2152
| 1
| 1
| 1
| 2014/6/8 17:23
|-
|[[Os07g0492000|'''''OsNDPK1''''']]
|[[Os07g0492000]]
| 1.777
| 1777
| 1
| 1
| 1
| 2014/6/9 23:45
|-
|[[Os03g0741100|'''''OsbHLH148''''']]
|[[Os03g0741100]]
| 1.578
| 1578
| 1
| 1
| 1
| 2014/5/19 3:18
|}

Os11g0587000

2017-03-08T06:25:45Z

Xysj1981:

==Annotated Information==
===Function===
Please input The Function of This Gene.

===Expression===
Please input The Function of This Gene.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
1.Wang Y, Li J. Branching in rice[J]. Current opinion in plant biology, 2011, 14(1): 94-99. http://www.ncbi.nlm.nih.gov/pubmed/21144796
Waters M T, Brewer P B, Bussell J D, et al. The Arabidopsis ortholog of rice DWARF27 acts upstream of MAX1 in the control of plant development by strigolactones[J]. 2.Plant physiology, 2012, 159(3): 1073-1085. http://www.ncbi.nlm.nih.gov/pubmed/22623516

==Structured Information==

[[Category:Genes]]
[[Category: Japonica DNA]]
[[Category:Oryza sativa Japonica Group]]
[[Category: Japonica Genes]]
[[Category:Japonica Chromosome 11]]
[[Category:Chromosome 11]]

RiceWiki:Curated Genes

2017-03-08T06:24:33Z

Xysj1981:

{|class="wikitable sortable" style="width:90%;text-align:center"
|-
!'''Gene Symbol'''
!'''RAP-DB-ID'''
!'''Total Contribution Score'''
!'''Summed Edit Quantity'''
!'''Averaged Edit Quality'''
!'''Contributor Count'''
!'''Edit Count*'''
!'''Last Edit Time'''
|-
|[[Os09g0114500|'''''BC12''''']]
|[[Os09g0114500]]
| 14.854
| 23746
| 0.626
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os10g0405500|'''''PAIR3''''']]
|[[Os10g0405500]]
| 10.742
| 10877
| 0.988
| 3
| 3
| 2014/6/8 23:39
|-
|[[Os09g0286400|'''''OsNHX5''''']]
|[[Os09g0286400]]
| 12.133
| 24113
| 0.503
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0306400|'''''OsbZIP71''''']]
|[[Os09g0306400]]
| 7.71
| 12551
| 0.614
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0417600|'''''OsWRKY76''''']]
|[[Os09g0417600]]
| 5.713
| 10209
| 0.56
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os09g0434200|'''''OsDSG1''''']]
|[[Os09g0434200]]
| 5.792
| 11879
| 0.488
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os10g0553300|'''''OsTPP2''''']]
|[[Os10g0553300]]
| 8.403
| 35721
| 0.235
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os10g0563600|'''''OsMSRA4.1''''']]
|[[Os10g0563600]]
| 7.778
| 13380
| 0.581
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0127600|'''''ONAC045''''']]
|[[Os11g0127600]]
| 7.065
| 12576
| 0.562
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os11g0648000|'''''OsNHX3''''']]
|[[Os11g0648000]]
| 7.638
| 15767
| 0.484
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os12g0569700|'''''OsHsp23.7''''']]
|[[Os12g0569700]]
| 6.412
| 13859
| 0.463
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os12g0583700|'''''ZFP252''''']]
|[[Os12g0583700]]
| 8.489
| 12862
| 0.66
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os08g0139000|'''''OsDEG10''''']]
|[[Os08g0139000]]
| 4.811
| 9008
| 0.534
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os08g0323700|'''''OsCCC1''''']]
|[[Os08g0323700]]
| 6.709
| 11315
| 0.593
| 2
| 2
| 2015/6/12 17:29
|-
|[[Os08g0441100|'''''OsCIPK06''''']]
|[[Os08g0441100]]
| 3.819
| 7418
| 0.515
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os08g0504700|'''''OsSAP11''''']]
|[[Os08g0504700]]
| 7.149
| 10763
| 0.664
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0540400|'''''OsCPK21''''']]
|[[Os08g0540400]]
| 10.561
| 19732
| 0.535
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os08g0546800|'''''OsHsfB2b''''']]
|[[Os08g0546800]]
| 12.399
| 23039
| 0.538
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os07g0186000|'''''OsTRXh1''''']]
|[[Os07g0186000]]
| 7.817
| 12275
| 0.637
| 2
| 2
| 2015/6/12 16:34
|-
|[[Os07g0556800|'''''OSRIP18''''']]
|[[Os07g0556800]]
| 8.473
| 12924
| 0.656
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os07g0666900|'''''OsNHX1''''']]
|[[Os07g0666900]]
| 11.455
| 21522
| 0.532
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0678600|'''''OsCIPK2''''']]
|[[Os07g0678600]]
| 5.575
| 11240
| 0.496
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0693800|'''''OsFAD8''''']]
|[[Os07g0693800]]
| 5.613
| 11290
| 0.497
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os06g0130100|'''''OsSIK1''''']]
|[[Os06g0130100]]
| 11.48
| 22964
| 0.5
| 2
| 2
| 2015/6/12 16:04
|-
|[[Os06g0472000|'''''OsMSRB1.1''''']]
|[[Os06g0472000]]
| 6.592
| 12098
| 0.545
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os06g0561000|'''''OsMIOX''''']]
|[[Os06g0561000]]
| 6.249
| 12468
| 0.501
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os06g0603600|'''''OsSPX1''''']]
|[[Os06g0603600]]
| 7.774
| 15383
| 0.505
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os06g0612800|'''''OsiSAP8''''']]
|[[Os06g0612800]]
| 8.934
| 14002
| 0.638
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0644200|'''''OVP1''''']]
|[[Os06g0644200]]
| 10.007
| 15443
| 0.648
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0651100|'''''YK1''''']]
|[[Os06g0651100]]
| 8.803
| 18547
| 0.475
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0662200|'''''OsbZIP52''''']]
|[[Os06g0662200]]
| 6.942
| 12388
| 0.56
| 2
| 2
| 2015/6/12 16:22
|-
|[[Os06g0727200|'''''OsCATB''''']]
|[[Os06g0727200]]
| 6.864
| 13184
| 0.521
| 2
| 2
| 2015/6/12 16:27
|-
|[[Os03g0117900|'''''HYR''''']]
|[[Os03g0117900]]
| 5.381
| 8815
| 0.61
| 2
| 2
| 2015/6/12 12:59
|-
|[[Os09g0457900|'''''OsEATB''''']]
|[[Os09g0457900]]
| 42.219
| 42219
| 1
| 1
| 1
| 2014/6/6 14:12
|-
|[[Os06g0208800|'''''LYP6''''']]
|[[Os06g0208800]]
| 35.205
| 40853
| 0.862
| 2
| 2
| 2015/6/12 16:09
|-
|[[Os11g0587000|'''''DWARF27''''']]
|[[Os11g0587000]]
| 31.862
| 34044
| 0.936
| 2
| 4
| 2014/6/9 2:23
|-
|'''''[[GW5]]'''''
|
| 31.812
| 31817
| 1
| 2
| 2
| 2014/6/8 22:47
|-
|[[Os03g0122600|'''''OsMADS50''''']]
|[[Os03g0122600]]
| 31.778
| 36672
| 0.867
| 2
| 2
| 2015/6/12 13:00
|-
|'''''[[Du1]]'''''
|
| 26.789
| 26797
| 1
| 2
| 2
| 2014/6/5 11:51
|-
|[[Os01g0771200|'''''XB24''''']]
|[[Os01g0771200]]
| 25.112
| 106499
| 0.236
| 3
| 14
| 2015/5/13 15:32
|-
|'''''[[IPA1]]'''''
|
| 22.636
| 22636
| 1
| 1
| 1
| 2014/6/1 14:57
|-
|'''''[[AB013448]]'''''
|
| 21.65
| 21650
| 1
| 1
| 1
| 2014/6/8 17:24
|-
|[[Os10g0542100|'''''MT''''']]
|[[Os10g0542100]]
| 21.515
| 25382
| 0.848
| 3
| 3
| 2015/6/13 16:56
|-
|'''''[[MADS]]'''''
|
| 21.305
| 21310
| 1
| 3
| 3
| 2014/6/7 19:11
|-
|'''''[[MYB]]'''''
|
| 21.082
| 21418
| 0.984
| 2
| 2
| 2013/7/16 10:48
|-
|[[Os09g0272900|'''''PB''''']]
|[[Os09g0272900]]
| 21.033
| 24405
| 0.862
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os01g0848400|'''''qSH1''''']]
|[[Os01g0848400]]
| 20.688
| 31733
| 0.652
| 2
| 2
| 2015/5/13 15:40
|-
|[[Os09g0441900|'''''OsDEP1''''']]
|[[Os09g0441900]]
| 18.815
| 18855
| 0.998
| 5
| 5
| 2014/6/11 0:23
|-
|[[Os09g0240200|'''''CONSTANS''''']]
|[[Os09g0240200]]
| 18.077
| 26433
| 0.684
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os04g0271200|'''''SRT701''''']]
|[[Os04g0271200]]
| 18.041
| 18413
| 0.98
| 5
| 9
| 2014/6/10 16:01
|-
|[[Os01g0678500|'''''OsTPC1''''']]
|[[Os01g0678500]]
| 17.989
| 29118
| 0.618
| 6
| 7
| 2015/5/13 15:24
|-
|[[Os03g0332400|'''''OsGLYII-2''''']]
|[[Os03g0332400]]
| 17.603
| 17603
| 1
| 1
| 1
| 2014/12/27 21:46
|-
|[[Os06g0196700|'''''OsARF16'''''']]
|[[Os06g0196700]]
| 17.411
| 28849
| 0.604
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os07g0261200|'''''Ghd7''''']]
|[[Os07g0261200]]
| 17.077
| 17414
| 0.981
| 2
| 2
| 2014/6/1 17:56
|-
|'''''[[Xa7]]'''''
|
| 16.58
| 16580
| 1
| 1
| 1
| 2014/5/30 14:34
|-
|[[Os03g0227700|'''''OsDWARF4''''']]
|[[Os03g0227700]]
| 16.238
| 28577
| 0.568
| 4
| 6
| 2015/6/12 13:36
|-
|'''''[[Pb1]]'''''
|
| 15.987
| 15987
| 1
| 1
| 1
| 2014/6/3 15:06
|-
|[[Os12g0597000|'''''CBL''''']]
|[[Os12g0597000]]
| 15.897
| 25737
| 0.618
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os01g0841500|'''''OsMYB3R2''''']]
|[[Os01g0841500]]
| 15.635
| 27885
| 0.561
| 3
| 4
| 2015/5/13 15:39
|-
|[[Os01g0182600|'''''GI''''']]
|[[Os01g0182600]]
| 14.75
| 22705
| 0.65
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os08g0162100|'''''ASP1''''']]
|[[Os08g0162100]]
| 14.743
| 14743
| 1
| 1
| 1
| 2015/6/12 17:26
|-
|[[Os02g0738900|'''''OsDRP2B''''']]
|[[Os02g0738900]]
| 14.365
| 21439
| 0.67
| 2
| 2
| 2015/5/14 13:58
|-
|[[Os06g0594600|'''''OsAt10''''']]
|[[Os06g0594600]]
| 14.147
| 19008
| 0.744
| 3
| 4
| 2015/6/12 16:17
|-
|[[Os01g57340|'''''Npi37''''']]
|[[Os01g57340]]
| 14.08
| 14080
| 1
| 1
| 1
| 2014/5/27 20:22
|-
|[[Os01g0718300|'''''OsBRI1''''']]
|[[Os01g0718300]]
| 14.008
| 25923
| 0.54
| 3
| 3
| 2015/5/13 15:26
|-
|'''''[[Du2]]'''''
|
| 13.964
| 13964
| 1
| 2
| 2
| 2014/6/5 11:53
|-
|'''''[[OsMYB103L]]'''''
|
| 13.96
| 13960
| 1
| 1
| 1
| 2014/6/11 16:14
|-
|[[Os01g0782100|''''' Pi-sh''''']]
|[[Os01g0782100]]
| 13.897
| 27151
| 0.512
| 3
| 3
| 2015/5/13 15:34

|-
|[[Os06g0706400|'''''OsPTR9''''']]
|[[Os06g0706400]]
| 13.739
| 20020
| 0.686
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os08g0398400|'''''OsHIR1''''']]
|[[Os08g0398400]]
| 13.721
| 13748
| 0.998
| 3
| 6
| 2014/6/3 16:40
|-
|[[Os02g0141300|'''''CAP1''''']]
|[[Os02g0141300]]
| 13.71
| 28137
| 0.487
| 5
| 10
| 2015/5/14 13:21
|-
|[[Os07g0214100|'''''RAG1''''']]
|[[Os07g0214100]]
| 13.62
| 31302
| 0.435
| 2
| 2
| 2015/6/12 16:36
|-
|'''''[[DWT1]]'''''
|
| 13.275
| 13275
| 1
| 1
| 1
| 2014/5/31 12:55
|-
|[[Os01g0797600|'''''OsERF3''''']]
|[[Os01g0797600]]
| 13.247
| 13247
| 1
| 1
| 1
| 2014/5/25 15:17
|-
|[[Os01g0883800|'''''semidwarf-1''''']]
|[[Os01g0883800]]
| 13.17
| 24896
| 0.529
| 16
| 41
| 2016/6/17 17:22
|-
|[[Os08g0524100|'''''OsSRT1''''']]
|[[Os08g0524100]]
| 13.001
| 18711
| 0.695
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os08g0559300|'''''SPINDLY''''']]
|[[Os08g0559300]]
| 12.718
| 21018
| 0.605
| 3
| 6
| 2015/6/12 17:35
|-
|[[Os11g0225300|'''''PAMP''''']]
|[[Os11g0225300]]
| 12.691
| 23520
| 0.54
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os07g0155600|'''''OsEIN2''''']]
|[[Os07g0155600]]
| 12.605
| 18316
| 0.688
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os01g0607200|'''''OsBAT1''''']]
|[[Os01g0607200]]
| 12.553
| 19986
| 0.628
| 2
| 2
| 2015/5/13 15:17
|-
|[[Os07g0616800|'''''SUS''''']]
|[[Os07g0616800]]
| 12.42
| 26693
| 0.465
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os12g0102400|'''''OsRINGC2-2''''']]
|[[Os12g0102400]]
| 12.278
| 17739
| 0.692
| 3
| 3
| 2015/6/13 17:13
|-
|'''''[[WRKY]]'''''
|
| 12.226
| 12233
| 0.999
| 2
| 2
| 2014/5/31 12:44
|-
|[[Os10g0536100|'''''OsMADS50''''']]
|[[Os10g0536100]]
| 11.96
| 19080
| 0.627
| 3
| 3
| 2015/6/13 16:52
|-
|[[Os02g0725900|'''''HAP3''''']]
|[[Os02g0725900]]
| 11.931
| 16469
| 0.724
| 2
| 2
| 2015/5/14 13:55
|-
|[[Os01g0626400|'''''OsWRKY11''''']]
|[[Os01g0626400]]
| 11.902
| 18881
| 0.63
| 2
| 2
| 2015/5/13 15:20
|-
|[[Os01g0726400|'''''CFO1''''']]
|[[Os01g0726400]]
| 11.891
| 17625
| 0.675
| 2
| 2
| 2015/5/13 15:27
|-
|[[Os09g0422500|'''''OsCESA9''''']]
|[[Os09g0422500]]
| 11.747
| 23511
| 0.5
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os09g0250700|'''''OsABC1-12''''']]
|[[Os09g0250700]]
| 11.742
| 15681
| 0.749
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os06g0701300|'''''OsABC1-8''''']]
|[[Os06g0701300]]
| 11.604
| 15691
| 0.74
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0126400|'''''OsCPK4''''']]
|[[Os02g0126400]]
| 11.6
| 22962
| 0.505
| 2
| 2
| 2015/5/14 13:20
|-
|[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]
|[[Os06g0570100]]
| 11.586
| 15710
| 0.737
| 3
| 3
| 2015/6/12 16:16
|-
|[[Os03g0793500|'''''Hd16''''']]
|[[Os03g0793500]]
| 11.531
| 15843
| 0.728
| 2
| 2
| 2015/5/15 13:43
|-
|[[Os01g0536000|'''''OsCIPK08''''']]
|[[Os01g0536000]]
| 11.52
| 15150
| 0.76
| 2
| 2
| 2015/5/13 15:15
|-
|[[Os03g0848700|'''''Bph14''''']]
|[[Os03g0848700]]
| 11.486
| 21573
| 0.532
| 4
| 4
| 2015/5/15 13:41
|-
|[[Os01g0907900|'''''PLA2''''']]
|[[Os01g0907900]]
| 11.483
| 11485
| 1
| 2
| 2
| 2014/6/2 17:56
|-
|[[Os07g0459200|'''''OsABC1-10''''']]
|[[Os07g0459200]]
| 11.449
| 15381
| 0.744
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os07g0102300|'''''SRL1''''']]
|[[Os07g0102300]]
| 11.423
| 22326
| 0.512
| 3
| 3
| 2015/6/12 16:30
|-
|[[Os07g0186200|'''''OsSIK2''''']]
|[[Os07g0186200]]
| 11.413
| 20165
| 0.566
| 3
| 3
| 2015/6/12 16:34
|-
|[[Os03g0226800|'''''CMT3''''']]
|[[Os03g0226800]]
| 11.245
| 21415
| 0.525
| 3
| 3
| 2015/6/12 13:36
|-
|[[Os08g0114200|'''''OsGLU3''''']]
|[[Os08g0114200]]
| 11.137
| 17754
| 0.627
| 2
| 2
| 2015/6/12 17:23
|-
|[[Os07g0596300|'''''FH5''''']]
|[[Os07g0596300]]
| 11.085
| 15490
| 0.716
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os02g0178800|'''''OsGL1-2''''']]
|[[Os02g0178800]]
| 11.079
| 14720
| 0.753
| 2
| 2
| 2015/5/14 13:23
|-
|[[Os03g0811100|''''' Chl1''''']]
|[[Os03g0811100]]
| 11.068
| 14957
| 0.74
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os09g0395300|'''''SLL1''''']]
|[[Os09g0395300]]
| 11.063
| 16461
| 0.672
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g03150|'''''TAD1''''']]
|[[Os03g03150]]
| 10.972
| 10972
| 1
| 1
| 1
| 2014/6/9 12:35
|-
|[[Os12g0189500|'''''OsYUC11''''']]
|[[Os12g0189500]]
| 10.931
| 20645
| 0.529
| 7
| 7
| 2015/6/13 17:16
|-
|[[Os06g0211200|'''''OsAREB1''''']]
|[[Os06g0211200]]
| 10.925
| 19995
| 0.546
| 5
| 6
| 2015/6/12 16:09
|-
|[[Os02g0100200|'''''HSP''''']]
|[[Os02g0100200]]
| 10.917
| 21797
| 0.501
| 2
| 2
| 2015/5/14 13:17
|-
|'''''[[BHLH]]'''''
|
| 10.829
| 10829
| 1
| 1
| 1
| 2013/7/21 20:47
|-
|[[Os11g0703900|'''''Hsp70''''']]
|[[Os11g0703900]]
| 10.813
| 10898
| 0.992
| 4
| 5
| 2014/6/9 23:54
|-
|[[Os01g44260|'''''OsDfr''''']]
|[[Os01g44260]]
| 10.787
| 10787
| 1
| 1
| 1
| 2014/6/9 21:48
|-
|[[Os03g0815100|'''''SNAC1''''']]
|[[Os03g0815100]]
| 10.722
| 15783
| 0.679
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os10g0561400|'''''OsMYBS3''''']]
|[[Os10g0561400]]
| 10.656
| 22236
| 0.479
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0523800|'''''OsARF1''''']]
|[[Os11g0523800]]
| 10.633
| 21943
| 0.485
| 6
| 6
| 2015/6/13 17:08
|-
|[[Os07g0257200|'''''OsNRAMP5''''']]
|[[Os07g0257200]]
| 10.556
| 10556
| 1
| 1
| 1
| 2015/6/12 16:38
|-
|[[Os02g0661100|'''''OsTPP1''''']]
|[[Os02g0661100]]
| 10.544
| 18837
| 0.56
| 2
| 2
| 2015/5/14 13:51
|-
|[[Os07g0164000|'''''WAF1''''']]
|[[Os07g0164000]]
| 10.534
| 11864
| 0.888
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os12g0476200|'''''Xa25''''']]
|[[Os12g0476200]]
| 10.44
| 17073
| 0.611
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os10g0497300|'''''Rf1a''''']]
|[[Os10g0497300]]
| 10.431
| 18232
| 0.572
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os07g0108900|'''''OsMADS15''''']]
|[[Os07g0108900]]
| 10.425
| 20545
| 0.507
| 4
| 5
| 2015/6/12 16:31
|-
|[[Os03g0215400|'''''MADS1''''']]
|[[Os03g0215400]]
| 10.412
| 14715
| 0.708
| 2
| 2
| 2015/6/12 13:34
|-
|[[Os08g0174700|'''''OsSERK1''''']]
|[[Os08g0174700]]
| 10.335
| 21519
| 0.48
| 2
| 2
| 2015/6/12 17:28
|-
|[[Os01g0121700|'''''OsWBC1''''']]
|[[Os01g0121700]]
| 10.278
| 14300
| 0.719
| 2
| 2
| 2015/5/13 14:49
|-
|[[Os01g0201700|'''''OsMADS3''''']]
|[[Os01g0201700]]
| 10.276
| 20440
| 0.503
| 2
| 2
| 2015/5/13 15:03
|-
|[[Os10g0577600|'''''JMJ706''''']]
|[[Os10g0577600]]
| 10.16
| 18081
| 0.562
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0839100|'''''ZFP179''''']]
|[[Os01g0839100]]
| 10.128
| 13298
| 0.762
| 2
| 2
| 2015/5/13 15:38
|-
|[[Os03g0237250|'''''LPA1''''']]
|[[Os03g0237250]]
| 10.125
| 14184
| 0.714
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0133000|'''''Waxy''''']]
|[[Os06g0133000]]
| 10.084
| 22204
| 0.454
| 3
| 3
| 2015/6/12 16:04
|-
|[[Os03g0805100|'''''SQS''']]
|[[Os03g0805100]]
| 10.051
| 13542
| 0.742
| 2
| 2
| 2015/5/15 13:42
|-
|'''''[[AB013449]]'''''
|
| 10.03
| 10030
| 1
| 1
| 1
| 2014/6/10 22:14
|-
|[[Os07g0605200|'''''OsMADS18''''']]
|[[Os07g0605200]]
| 10.027
| 19041
| 0.527
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os06g0194900|'''''Sus''''']]
|[[Os06g0194900]]
| 10.026
| 20580
| 0.487
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os01g0764800|'''''GH3''''']]
|[[Os01g0764800]]
| 10.024
| 18674
| 0.537
| 2
| 2
| 2015/5/13 15:32
|-
|[[Os03g0111300|'''''NsLTPs''''']]
|[[Os03g0111300]]
| 10.013
| 12909
| 0.776
| 4
| 4
| 2015/6/12 12:57
|-
|[[Os10g0127900|'''''OsFbx352''''']]
|[[Os10g0127900]]
| 10.013
| 20618
| 0.486
| 4
| 8
| 2015/6/13 16:43
|-
|[[Os06g0662000|'''''OsVHA-A''''']]
|[[Os06g0662000]]
| 9.949
| 19796
| 0.503
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0254600|'''''CALEOSIN''''']]
|[[Os06g0254600]]
| 9.94
| 12129
| 0.82
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os06g0603000|'''''SE5''''']]
|[[Os06g0603000]]
| 9.889
| 9889
| 1
| 1
| 1
| 2014/6/9 17:03
|-
|[[Os08g0535200|'''''xa13''''']]
|[[Os08g0535200]]
| 9.858
| 18774
| 0.525
| 3
| 3
| 2015/6/12 17:34
|-
|[[Os12g0281300|'''''Pi-ta''''']]
|[[Os12g0281300]]
| 9.857
| 21855
| 0.451
| 4
| 4
| 2015/6/13 17:16
|-
|[[Os01g0919400|'''''SPS''''']]
|[[Os01g0919400]]
| 9.837
| 9837
| 1
| 1
| 1
| 2016/6/6 17:48
|-
|[[Os10g0573900|'''''OsNMD3''''']]
|[[Os10g0573900]]
| 9.818
| 16399
| 0.599
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0197100|'''''dwarf2''''']]
|[[Os01g0197100]]
| 9.81
| 19279
| 0.509
| 5
| 6
| 2015/5/13 14:59
|-
|[[Os11g0216300|'''''OsABC1-13''''']]
|[[Os11g0216300]]
| 9.795
| 13761
| 0.712
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os01g0102900|'''''Os-LIR1''''']]
|[[Os01g0102900]]
| 9.726
| 9726
| 1
| 1
| 1
| 2016/6/12 14:04
|-
|[[Os11g0249000|'''''NLS1''''']]
|[[Os11g0249000]]
| 9.718
| 17393
| 0.559
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os10g0467800|'''''OsCesA7''''']]
|[[Os10g0467800]]
| 9.68
| 22133
| 0.437
| 5
| 6
| 2015/6/13 16:48
|-
|[[Os02g0682200|'''''MADS6''''']]
|[[Os02g0682200]]
| 9.577
| 17192
| 0.557
| 3
| 13
| 2015/5/14 13:53
|-
|[[Os06g0569500|'''''GAs''''']]
|[[Os06g0569500]]
| 9.526
| 18834
| 0.506
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os09g0456800|'''''OsHsfs''''']]
|[[Os09g0456800]]
| 9.468
| 13735
| 0.689
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0274900|'''''OsGMST1''''']]
|[[Os02g0274900]]
| 9.449
| 18241
| 0.518
| 2
| 2
| 2015/5/14 13:38
|-
|[[Os06g0724900|'''''ILA1''''']]
|[[Os06g0724900]]
| 9.361
| 19950
| 0.469
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os01g0611100|'''''OsRAN1''''']]
|[[Os01g0611100]]
| 9.349
| 15330
| 0.61
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os08g0509600|'''''OsSPL14''''']]
|[[Os08g0509600]]
| 9.346
| 17625
| 0.53
| 3
| 4
| 2015/6/12 17:32
|-
|[[Os07g0558000|'''''OsABC1-11''''']]
|[[Os07g0558000]]
| 9.337
| 13289
| 0.703
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0449000|'''''PTC1''''']]
|[[Os09g0449000]]
| 9.33
| 16966
| 0.55
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os04g0415000|'''''BY240''''']]
|[[Os04g0415000]]
| 9.31
| 9310
| 1
| 1
| 1
| 2014/6/6 19:55
|-
|[[Os07g0471000|'''''OsIRE1''''']]
|[[Os07g0471000]]
| 9.278
| 18586
| 0.499
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os03g0170900|'''''OsSUT1''''']]
|[[Os03g0170900]]
| 9.272
| 19337
| 0.479
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os06g0610300|'''''MOC1''''']]
|[[Os06g0610300]]
| 9.171
| 11979
| 0.766
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0583400|'''''OsHDAC702''''']]
|[[Os06g0583400]]
| 9.15
| 11481
| 0.797
| 2
| 2
| 2015/6/12 16:16
|-
|[[Os02g0622100|'''''LTG1''''']]
|[[Os02g0622100]]
| 9.147
| 12303
| 0.743
| 2
| 2
| 2015/5/14 13:47
|-
|[[Os03g0203200|'''''HTD2''''']]
|[[Os03g0203200]]
| 9.128
| 17233
| 0.53
| 4
| 4
| 2015/6/12 13:06
|-
|[[Os06g0660200|'''''OsPIN2''''']]
|[[Os06g0660200]]
| 9.119
| 20530
| 0.444
| 5
| 6
| 2015/6/12 16:21
|-
|[[Os10g0403000|'''''PLA1 ''''']]
|[[Os10g0403000]]
| 9.104
| 15463
| 0.589
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os03g0112700|'''''Ehd4''''']]
|[[Os03g0112700]]
| 9.094
| 17122
| 0.531
| 3
| 3
| 2015/6/12 12:58
|-
|[[Os02g0799100|'''''Ossgo1''''']]
|[[Os02g0799100]]
| 9.068
| 16095
| 0.563
| 3
| 6
| 2015/5/14 14:02
|-
|[[Os09g0307800|'''''SDG724''''']]
|[[Os09g0307800]]
| 9.029
| 11279
| 0.801
| 4
| 15
| 2014/6/6 8:56
|-
|[[Os08g0424500|'''''Badh2''''']]
|[[Os08g0424500]]
| 9.021
| 17768
| 0.508
| 3
| 3
| 2015/6/12 17:30
|-
|[[Os11g0184900|'''''OsNAC5''''']]
|[[Os11g0184900]]
| 9.016
| 15182
| 0.594
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0203700|'''''SRZ1''''']]
|[[Os02g0203700]]
| 9.003
| 12324
| 0.731
| 2
| 2
| 2015/5/14 13:26
|-
|[[Os06g0125000|'''''RPM1''''']]
|[[Os06g0125000]]
| 8.97
| 12695
| 0.707
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os03g0128700|'''''OsCDPK13''''']]
|[[Os03g0128700]]
| 8.928
| 17882
| 0.499
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os03g0215200|'''''DL''''']]
|[[Os03g0215200]]
| 8.927
| 14196
| 0.629
| 3
| 3
| 2015/6/12 13:07
|-
|[[Os01g0952800|'''''OsIRO2''''']]
|[[Os01g0952800]]
| 8.922
| 8922
| 1
| 1
| 1
| 2014/6/10 21:52
|-
|[[Os06g0494100|'''''Pi-d2''''']]
|[[Os06g0494100]]
| 8.906
| 12742
| 0.699
| 3
| 3
| 2015/6/12 16:14
|-
|[[Os03g0149100|'''''OsCrl1''''']]
|[[Os03g0149100]]
| 8.897
| 13456
| 0.661
| 3
| 4
| 2015/6/12 11:15
|-
|'''''[[BZIP]]'''''
|
| 8.894
| 8924
| 0.997
| 2
| 2
| 2013/7/21 21:01
|-
|[[Os06g0625900|'''''OsHAK10''''']]
|[[Os06g0625900]]
| 8.872
| 13033
| 0.681
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0229800|'''''ALK''''']]
|[[Os06g0229800]]
| 8.835
| 16807
| 0.526
| 2
| 2
| 2015/6/12 16:11
|-
|[[Os07g0232900|'''''OsHMA3''''']]
|[[Os07g0232900]]
| 8.79
| 18004
| 0.488
| 3
| 8
| 2015/6/12 16:37
|-
|[[Os07g0129700|'''''OSH15''''']]
|[[Os07g0129700]]
| 8.789
| 18504
| 0.475
| 3
| 3
| 2015/6/12 16:32
|-
|[[Os12g0641400|'''''OsSUT2''''']]
|[[Os12g0641400]]
| 8.735
| 8735
| 1
| 1
| 1
| 2016/6/12 13:56
|-
|[[Os08g0137100|'''''OsFIE2''''']]
|[[Os08g0137100]]
| 8.717
| 8717
| 1
| 1
| 1
| 2015/6/12 17:25
|-
|'''''[[Htd1]]'''''
|
| 8.705
| 8705
| 1
| 1
| 1
| 2014/6/10 14:14
|-
|[[Os03g0707600|'''''GAI''''']]
|[[Os03g0707600]]
| 8.666
| 16659
| 0.52
| 2
| 5
| 2014/5/28 0:43
|-
|'''''[[Xa23]]'''''
|
| 8.641
| 8641
| 1
| 1
| 1
| 2014/5/31 21:49
|-
|[[Os11g0235200|'''''SP1''''']]
|[[Os11g0235200]]
| 8.563
| 17156
| 0.499
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os07g0100600|'''''OsPTR1''''']]
|[[Os07g0100600]]
| 8.559
| 15027
| 0.57
| 2
| 2
| 2015/6/12 16:30
|-
|[[Os06g0597000|'''''OsIAA23''''']]
|[[Os06g0597000]]
| 8.509
| 16209
| 0.525
| 4
| 11
| 2014/5/19 22:42
|-
|[[Os02g0232100|'''''HEI10''''']]
|[[Os02g0232100]]
| 8.485
| 15567
| 0.545
| 2
| 2
| 2015/5/14 13:36
|-
|[[Os04g0452500|'''''ZEP1''''']]
|[[Os04g0452500]]
| 8.484
| 8484
| 1
| 1
| 1
| 2014/5/31 16:56
|-
|[[Os09g0363900|'''''ONI3''''']]
|[[Os09g0363900]]
| 8.473
| 12412
| 0.683
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os09g0426800|'''''WSL2''''']]
|[[Os09g0426800]]
| 8.447
| 9634
| 0.877
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0253300|'''''alpha-1a''''']]
|[[Os01g0253300]]
| 8.439
| 17745
| 0.476
| 5
| 5
| 2015/5/13 15:07
|-
|[[Os06g0683400|'''''OsCCD1''''']]
|[[Os06g0683400]]
| 8.438
| 8438
| 1
| 1
| 1
| 2016/6/12 14:00
|-
|[[Os09g0522000|'''''OsDREB''''']]
|[[Os09g0522000]]
| 8.335
| 8335
| 1
| 1
| 1
| 2014/5/24 21:12
|-
|[[Os02g0580300|'''''GID2''''']]
|[[Os02g0580300]]
| 8.329
| 15752
| 0.529
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os08g0499300|'''''OsWRKY30''''']]
|[[Os08g0499300]]
| 8.324
| 17032
| 0.489
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0445700|'''''TPS''''']]
|[[Os08g0445700]]
| 8.317
| 10922
| 0.761
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os10g0505700|'''''LTPs''''']]
|[[Os10g0505700]]
| 8.312
| 16220
| 0.512
| 5
| 6
| 2015/6/13 16:46
|-
|[[Os11g0559200|'''''OsXa21''''']]
|[[Os11g0559200]]
| 8.294
| 15586
| 0.532
| 6
| 9
| 2015/6/13 17:08
|-
|[[Os03g0179400|'''''GUDK''''']]
|[[Os03g0179400]]
| 8.292
| 14840
| 0.559
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os02g0553200|'''''OsAPx8''''']]
|[[Os02g0553200]]
| 8.204
| 8204
| 1
| 1
| 1
| 2014/6/8 16:03
|-
|[[Os01g0571300|'''''OsHsfA7''''']]
|[[Os01g0571300]]
| 8.184
| 14946
| 0.548
| 2
| 2
| 2015/5/13 15:16
|-
|[[Os09g0401100|'''''STR1''''']]
|[[Os09g0401100]]
| 8.183
| 17216
| 0.475
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os02g0181300|'''''WRKY''''']]
|[[Os02g0181300]]
| 8.174
| 13252
| 0.617
| 2
| 2
| 2015/5/14 13:24
|-
|[[Os05g0346200|'''''OsDREB2B2''''']]
|[[Os05g0346200]]
| 8.14
| 8233
| 0.989
| 2
| 3
| 2014/6/5 17:14
|-
|[[Os09g0502100|'''''LGD1''''']]
|[[Os09g0502100]]
| 8.139
| 15501
| 0.525
| 2
| 2
| 2015/6/12 22:35
|-
|[[Os03g0820300|'''''ZFP182''''']]
|[[Os03g0820300]]
| 8.137
| 11604
| 0.701
| 2
| 2
| 2015/5/15 13:41
|-
|[[Os03g0230300|'''''OsSRO1c''''']]
|[[Os03g0230300]]
| 8.029
| 15193
| 0.528
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os07g0438800|'''''OsPHR2''''']]
|[[Os07g0438800]]
| 8.026
| 15610
| 0.514
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os02g0534400|'''''OsCIN1''''']]
|[[Os02g0534400]]
| 7.997
| 16635
| 0.481
| 2
| 2
| 2015/5/14 13:41
|-
|[[Os06g0165600|'''''OsDREB1D''''']]
|[[Os06g0165600]]
| 7.982
| 11937
| 0.669
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os11g0490600|'''''LAZY1''''']]
|[[Os11g0490600]]
| 7.98
| 16603
| 0.481
| 4
| 5
| 2015/6/13 17:07
|-
|[[Os07g0585700|'''''Sdr4''''']]
|[[Os07g0585700]]
| 7.966
| 7966
| 1
| 1
| 1
| 2014/6/9 23:14
|-
|[[Os01g0194300|'''''OsNPR1''''']]
|[[Os01g0194300]]
| 7.966
| 11111
| 0.717
| 2
| 2
| 2015/5/13 14:59
|-
|[[Os01g0869900|'''''SNF1''''']]
|[[Os01g0869900]]
| 7.964
| 16289
| 0.489
| 2
| 2
| 2015/5/13 15:42
|-
|[[Os06g0160700|'''''SSSl''''']]
|[[Os06g0160700]]
| 7.962
| 15027
| 0.53
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os09g0451500|'''''PDI''''']]
|[[Os09g0451500]]
| 7.903
| 10040
| 0.787
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os01g0759400|'''''OsCIPK12''''']]
|[[Os01g0759400]]
| 7.902
| 15742
| 0.502
| 2
| 2
| 2015/5/13 15:30
|-
|[[Os06g0205100|'''''OsC1-Myb''''']]
|[[Os06g0205100]]
| 7.891
| 12914
| 0.611
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os09g0244900|'''''Ypt1p''''']]
|[[Os09g0244900]]
| 7.89
| 11371
| 0.694
| 2
| 2
| 2015/6/12 17:38
|-
|'''''[[HTD2]]'''''
|
| 7.887
| 7887
| 1
| 1
| 1
| 2014/6/4 22:20
|-
|[[Os09g0482400|'''''HSP82''''']]
|[[Os09g0482400]]
| 7.873
| 11843
| 0.665
| 2
| 2
| 2015/6/12 17:47
|-
|[[Os10g0478000|'''''TAW1''''']]
|[[Os10g0478000]]
| 7.871
| 12275
| 0.641
| 4
| 5
| 2015/6/13 16:47
|-
|[[Os07g0258400|'''''OsNRAMP1''''']]
|[[Os07g0258400]]
| 7.866
| 13708
| 0.574
| 2
| 2
| 2015/6/12 16:38
|-
|[[Os10g0445400|'''''OsHCI1''''']]
|[[Os10g0445400]]
| 7.848
| 15652
| 0.501
| 6
| 15
| 2015/6/13 16:48
|-
|[[Os01g0273800|'''''OsYUC9''''']]
|[[Os01g0273800]]
| 7.843
| 9988
| 0.785
| 2
| 2
| 2015/5/13 15:10
|-
|[[Os01g0643300|'''''OsPIN10a''''']]
|[[Os01g0643300]]
| 7.839
| 16276
| 0.482
| 3
| 3
| 2015/5/13 15:22
|-
|[[Os06g0286700|'''''Pi9''''']]
|[[Os06g0286700]]
| 7.816
| 16653
| 0.469
| 6
| 9
| 2015/6/12 16:13
|-
|[[Os11g0104300|'''''DWARF53''''']]
|[[Os11g0104300]]
| 7.791
| 11682
| 0.667
| 4
| 4
| 2015/6/13 17:00
|-
|[[Os07g0150700|'''''Os-AKT1''''']]
|[[Os07g0150700]]
| 7.79
| 15994
| 0.487
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os09g0494200|'''''BC15''''']]
|[[Os09g0494200]]
| 7.776
| 7776
| 1
| 1
| 1
| 2014/6/3 23:51
|-
|[[Os03g0181500|'''''ONI1''''']]
|[[Os03g0181500]]
| 7.751
| 12230
| 0.634
| 3
| 4
| 2015/6/12 13:05
|-
|[[Os02g0814200|'''''OsGL1-6''''']]
|[[Os02g0814200]]
| 7.743
| 13379
| 0.579
| 2
| 2
| 2015/5/14 14:03
|-
|[[Os02g0103800|'''''OsLFNR1''''']]
|[[Os02g0103800]]
| 7.686
| 7686
| 1
| 1
| 1
| 2016/6/12 14:12
|-
|[[Os11g0225100|'''''Pia''''']]
|[[Os11g0225100]]
| 7.669
| 12296
| 0.624
| 3
| 3
| 2015/6/13 17:04
|-
|'''''[[Pi1]]'''''
|
| 7.644
| 7644
| 1
| 1
| 1
| 2014/6/5 17:02
|-
|[[Os01g0307500|'''''SKC1''''']]
|[[Os01g0307500]]
| 7.639
| 7639
| 1
| 1
| 1
| 2014/6/7 21:57
|-
|'''''[[Chalk5]]'''''
|
| 7.635
| 7635
| 1
| 1
| 1
| 2014/5/29 11:10
|-
|[[Os08g0140300|'''''TDC''''']]
|[[Os08g0140300]]
| 7.633
| 13769
| 0.554
| 2
| 2
| 2015/6/12 17:26
|-
|[[Os07g0622900|'''''DTM1''''']]
|[[Os07g0622900]]
| 7.632
| 14288
| 0.534
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os01g0292200|'''''OsCIPK1''''']]
|[[Os01g0292200]]
| 7.626
| 12859
| 0.593
| 2
| 2
| 2015/5/13 15:11
|-
|[[Os03g0230500|'''''DSM3''''']]
|[[Os03g0230500]]
| 7.618
| 14126
| 0.539
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os12g0472500|'''''OsTDL1A''''']]
|[[Os12g0472500]]
| 7.581
| 13819
| 0.549
| 4
| 4
| 2015/6/13 17:17
|-
|[[Os03g0262900|'''''glup6''''']]
|[[Os03g0262900]]
| 7.571
| 15719
| 0.482
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0107700|'''''OsLFNR2''''']]
|[[Os06g0107700]]
| 7.533
| 7533
| 1
| 1
| 1
| 2016/6/6 9:33
|-
|[[Os02g57310|'''''Pib''''']]
|[[Os02g57310]]
| 7.531
| 7531
| 1
| 1
| 1
| 2014/6/6 14:27
|-
|[[Os09g0104200|'''''OsRAD51D''''']]
|[[Os09g0104200]]
| 7.502
| 15399
| 0.487
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os06g0142600|'''''Hd17''''']]
|[[Os06g0142600]]
| 7.492
| 11545
| 0.649
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os03g0788500|'''''OsCPK10''''']]
|[[Os03g0788500]]
| 7.454
| 10159
| 0.734
| 2
| 2
| 2015/5/15 13:44
|-
|[[Os06g0139000|'''''F-box''''']]
|[[Os06g0139000]]
| 7.443
| 15282
| 0.487
| 3
| 4
| 2015/6/12 16:05
|-
|[[Os03g0168600|'''''CYP704B2''''']]
|[[Os03g0168600]]
| 7.43
| 12348
| 0.602
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os11g0117400|'''''OsWRKY89''''']]
|[[Os11g0117400]]
| 7.353
| 11607
| 0.633
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os03g0223400|'''''OsGLN1_2''''']]
|[[Os03g0223400]]
| 7.313
| 14417
| 0.507
| 3
| 3
| 2015/6/12 13:35
|-
|[[Os02g0731200|'''''MADS57''''']]
|[[Os02g0731200]]
| 7.311
| 14927
| 0.49
| 2
| 2
| 2015/5/14 13:56
|-
|[[Os09g02650|'''''BC12''''']]
|[[Os09g02650]]
| 7.302
| 7302
| 1
| 1
| 1
| 2014/6/1 19:01
|-
|[[Os01g0859300|'''''OsABI5''''']]
|[[Os01g0859300]]
| 7.265
| 12246
| 0.593
| 2
| 2
| 2015/5/13 15:41
|-
|[[Os08g0105000|'''''Ghd7''''']]
|[[Os08g0105000]]
| 7.237
| 15311
| 0.473
| 4
| 4
| 2015/6/12 17:23
|-
|[[Os03g0110800|'''''OsDRM2''''']]
|[[Os03g0110800]]
| 7.203
| 14838
| 0.485
| 2
| 2
| 2015/6/12 12:57
|-
|[[Os01g0367100|'''''PHD1''''']]
|[[Os01g0367100]]
| 7.2
| 12561
| 0.573
| 3
| 3
| 2015/6/9 9:53
|-
|[[Os02g0191600|'''''OsbZIP16''''']]
|[[Os02g0191600]]
| 7.2
| 13785
| 0.522
| 2
| 2
| 2015/5/14 13:25
|-
|[[Os08g0137250|'''''FIE1''''']]
|[[Os08g0137250]]
| 7.185
| 14660
| 0.49
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os02g0220400|'''''Cga1''''']]
|[[Os02g0220400]]
| 7.158
| 17791
| 0.402
| 6
| 8
| 2015/5/14 13:36
|-
|[[Os10g0404500|'''''SUTs''''']]
|[[Os10g0404500]]
| 7.151
| 7164
| 0.998
| 2
| 2
| 2014/6/7 23:34
|-
|[[Os10g0177200|'''''OsDSR-1''''']]
|[[Os10g0177200]]
| 7.15
| 9017
| 0.793
| 3
| 3
| 2015/6/13 16:45
|-
|[[Os10g0496900|'''''OsPORB''''']]
|[[Os10g0496900]]
| 7.143
| 14022
| 0.509
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os02g0313400|'''''API5''''']]
|[[Os02g0313400]]
| 7.12
| 14554
| 0.489
| 2
| 2
| 2015/5/14 13:39
|-
|[[Os08g0117000|'''''PSS1''''']]
|[[Os08g0117000]]
| 7.092
| 8202
| 0.865
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os08g0531700|'''''MADS-box''''']]
|[[Os08g0531700]]
| 7.054
| 13276
| 0.531
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os06g0499500|'''''GH3''''']]
|[[Os06g0499500]]
| 7.051
| 12958
| 0.544
| 3
| 4
| 2015/6/12 16:15
|-
|[[Os03g0188400|'''''OsSRT1''''']]
|[[Os03g0188400]]
| 7.05
| 12067
| 0.584
| 2
| 2
| 2015/6/12 13:06
|-
|[[Os02g0649900|'''''OsYSL2''''']]
|[[Os02g0649900]]
| 7.031
| 12503
| 0.562
| 2
| 2
| 2015/5/14 13:48
|-
|[[Os09g0442700|'''''OsDDM1''''']]
|[[Os09g0442700]]
| 7.028
| 10589
| 0.664
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os12g0438600|'''''AtCLC-a''''']]
|[[Os12g0438600]]
| 7.022
| 14835
| 0.473
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os07g0124700|'''''CRL5''''']]
|[[Os07g0124700]]
| 6.998
| 14469
| 0.484
| 2
| 2
| 2015/6/12 16:31
|-
|[[Os11g0639100|'''''Pi54''''']]
|[[Os11g0639100]]
| 6.934
| 11269
| 0.615
| 4
| 4
| 2015/6/13 17:09
|-
|[[Os01g0615050|'''''OCPI1''''']]
|[[Os01g0615050]]
| 6.92
| 9869
| 0.701
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os12g0610200|'''''OsPIL11''''']]
|[[Os12g0610200]]
| 6.911
| 12604
| 0.548
| 4
| 4
| 2015/6/13 17:18
|-
|[[Os03g0123300|'''''TAD1''''']]
|[[Os03g0123300]]
| 6.87
| 15272
| 0.45
| 4
| 8
| 2015/6/12 13:00
|-
|[[Os07g0682800|'''''rth1''''']]
|[[Os07g0682800]]
| 6.853
| 13550
| 0.506
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os11g0446000|'''''RSS3''''']]
|[[Os11g0446000]]
| 6.838
| 13942
| 0.49
| 5
| 5
| 2015/6/13 17:07
|-
|[[Os07g0182900|'''''OsMET1a''''']]
|[[Os07g0182900]]
| 6.821
| 13295
| 0.513
| 5
| 11
| 2015/6/12 16:33
|-
|[[Os01g0205700|'''''OsGSK1''''']]
|[[Os01g0205700]]
| 6.813
| 12490
| 0.545
| 2
| 2
| 2015/5/13 15:04
|-
|[[Os05g0333200|'''''GPA1''''']]
|[[Os05g0333200]]
| 6.778
| 8703
| 0.779
| 2
| 2
| 2014/6/9 9:17
|-
|[[Os10g0167600|'''''OsCPDP''''']]
|[[Os10g0167600]]
| 6.756
| 14570
| 0.464
| 4
| 4
| 2015/6/13 16:45
|-
|[[Os07g0227800|'''''OsABC1-9''''']]
|[[Os07g0227800]]
| 6.744
| 10826
| 0.623
| 2
| 2
| 2015/6/12 16:37
|-
|[[Os10g0567400|'''''OsCAO1''''']]
|[[Os10g0567400]]
| 6.732
| 13437
| 0.501
| 3
| 3
| 2015/6/13 16:58
|-
|'''''[[DEP2]]'''''
|
| 6.724
| 6763
| 0.994
| 3
| 7
| 2014/6/10 22:30
|-
|[[Os07g0592600|'''''OsMGH3''''']]
|[[Os07g0592600]]
| 6.72
| 15320
| 0.439
| 5
| 11
| 2015/6/12 16:46
|-
|[[Os11g0126900|'''''OsNAC10''''']]
|[[Os11g0126900]]
| 6.705
| 6705
| 1
| 1
| 1
| 2014/5/24 12:41
|-
|[[Os09g0561600|'''''OsDEES1''''']]
|[[Os09g0561600]]
| 6.699
| 11352
| 0.59
| 2
| 2
| 2015/6/13 16:42
|-
|'''''[[Sub1A]]'''''
|
| 6.679
| 6679
| 1
| 1
| 1
| 2014/6/4 16:03
|-
|[[Os08g0126300|'''''OsGAPDH''''']]
|[[Os08g0126300]]
| 6.658
| 13730
| 0.485
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os10g0533600|'''''OsMPK6''''']]
|[[Os10g0533600]]
| 6.522
| 8207
| 0.795
| 3
| 3
| 2015/6/13 16:46
|-
|[[Os10g0397400|'''''dwarf2''''']]
|[[Os10g0397400]]
| 6.52
| 11105
| 0.587
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os06g0712700|'''''OsMADS16''''']]
|[[Os06g0712700]]
| 6.51
| 7624
| 0.854
| 2
| 2
| 2014/6/9 16:43
|-
|[[Os08g0237000|'''''OsXTH8''''']]
|[[Os08g0237000]]
| 6.46
| 6460
| 1
| 1
| 1
| 2014/6/9 18:44
|-
|[[Os02g0811000|'''''TH1''''']]
|[[Os02g0811000]]
| 6.453
| 11487
| 0.562
| 2
| 2
| 2015/5/14 14:02
|-
|[[Os07g0505200|'''''OsSPL13''''']]
|[[Os07g0505200]]
| 6.444
| 6444
| 1
| 1
| 1
| 2016/6/13 9:49
|-
|[[Os11g0247300|'''''Srs5''''']]
|[[Os11g0247300]]
| 6.442
| 13081
| 0.492
| 4
| 4
| 2015/6/13 17:05
|-
|[[AY986492|'''''Xa27''''']]
|[[AY986492]]
| 6.408
| 6408
| 1
| 2
| 2
| 2014/6/10 21:12
|-
|[[Os06g0700700|'''''OsHMA2''''']]
|[[Os06g0700700]]
| 6.404
| 6404
| 1
| 1
| 1
| 2014/6/3 20:16
|-
|[[Os02g0771400|'''''OsPFA-DSP2''''']]
|[[Os02g0771400]]
| 6.399
| 6702
| 0.955
| 2
| 3
| 2014/5/12 16:03
|-
|[[Os06g0127800|'''''DLT''''']]
|[[Os06g0127800]]
| 6.393
| 10797
| 0.592
| 2
| 2
| 2015/6/12 16:03
|-
|[[Os02g0120500|'''''OsTDR''''']]
|[[Os02g0120500]]
| 6.372
| 6372
| 1
| 1
| 1
| 2015/5/14 13:19
|-
|[[Os03g0854500|'''''OsHsfs''''']]
|[[Os03g0854500]]
| 6.367
| 10086
| 0.631
| 2
| 2
| 2015/5/15 13:40
|-
|[[Os06g0275000|'''''Hd1''''']]
|[[Os06g0275000]]
| 6.307
| 11994
| 0.526
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os02g0759800|'''''OsSKIPa''''']]
|[[Os02g0759800]]
| 6.249
| 12883
| 0.485
| 2
| 2
| 2015/5/14 14:00
|-
|[[Os08g0101000|'''''IDEF1''''']]
|[[Os08g0101000]]
| 6.239
| 10862
| 0.574
| 2
| 2
| 2015/6/12 17:22
|-
|[[Os09g0456200|'''''OsbZIP72''''']]
|[[Os09g0456200]]
| 6.23
| 10901
| 0.572
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os12g0101600|'''''leaf2''''']]
|[[Os12g0101600]]
| 6.221
| 35095
| 0.177
| 2
| 3
| 2014/5/31 21:22
|-
|[[Os06g0695800|'''''STAR1''''']]
|[[Os06g0695800]]
| 6.213
| 8582
| 0.724
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0606700|'''''RSS1''''']]
|[[Os02g0606700]]
| 6.198
| 12432
| 0.499
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os11g0210300|'''''Adh1''''']]
|[[Os11g0210300]]
| 6.196
| 12384
| 0.5
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0736400|'''''OsDHODH''''']]
|[[Os02g0736400]]
| 6.183
| 11839
| 0.522
| 2
| 2
| 2015/5/14 13:57
|-
|[[Os08g0549100|'''''OsAPx4''''']]
|[[Os08g0549100]]
| 6.175
| 10093
| 0.612
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os09g0452200|'''''LYP4''''']]
|[[Os09g0452200]]
| 6.171
| 11987
| 0.515
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0170300|'''''OsMADS29''''']]
|[[Os02g0170300]]
| 6.166
| 12582
| 0.49
| 3
| 4
| 2015/5/14 13:23
|-
|[[Os03g0224700|'''''Hsfs''''']]
|[[Os03g0224700]]
| 6.166
| 11925
| 0.517
| 4
| 4
| 2015/6/12 13:35
|-
|[[Os07g0558500|'''''THF1''''']]
|[[Os07g0558500]]
| 6.078
| 12744
| 0.477
| 5
| 9
| 2015/6/12 16:45
|-
|[[Os09g0511000|'''''OsCERK1''''']]
|[[Os09g0511000]]
| 6.076
| 12097
| 0.502
| 2
| 2
| 2015/6/12 22:35
|-
|'''''[[OsWRKY13]]'''''
|
| 6.069
| 6101
| 0.995
| 2
| 3
| 2014/6/4 20:18
|-
|[[Os06g0308100|'''''OsIBR5''''']]
|[[Os06g0308100]]
| 6.062
| 12455
| 0.487
| 2
| 2
| 2015/6/12 16:13
|-
|[[Os11g0113700|'''''OsCIPK15''''']]
|[[Os11g0113700]]
| 5.961
| 12261
| 0.486
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os02g0656600|'''''GPA3''''']]
|[[Os02g0656600]]
| 5.915
| 10022
| 0.59
| 2
| 2
| 2015/5/14 13:50
|-
|[[Os01g0733200|'''''OsHsfC1b''''']]
|[[Os01g0733200]]
| 5.889
| 5889
| 1
| 1
| 1
| 2014/5/31 11:56
|-
|[[Os01g0785400|'''''GH3''''']]
|[[Os01g0785400]]
| 5.864
| 10600
| 0.553
| 2
| 2
| 2015/5/13 15:34
|-
|[[Os04g0541700|'''''Oshox22''''']]
|[[Os04g0541700]]
| 5.857
| 6037
| 0.97
| 2
| 3
| 2014/6/8 16:10
|-
|[[Os08g0140500|'''''TDC-3''''']]
|[[Os08g0140500]]
| 5.829
| 11343
| 0.514
| 2
| 2
| 2015/6/12 17:26
|-
|'''''[[IPK1]]'''''
|
| 5.803
| 5803
| 1
| 1
| 1
| 2014/6/8 16:55
|-
|[[Os09g0522100|'''''CBF''''']]
|[[Os09g0522100]]
| 5.713
| 9270
| 0.616
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os01g0177900|'''''OsABCG31''''']]
|[[Os01g0177900]]
| 5.693
| 11327
| 0.503
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os02g0149800|'''''OsPP18''''']]
|[[Os02g0149800]]
| 5.681
| 11452
| 0.496
| 2
| 2
| 2015/5/14 13:22
|-
|[[Os01g0831000|'''''LAX''''']]
|[[Os01g0831000]]
| 5.68
| 9517
| 0.597
| 2
| 2
| 2015/5/13 15:37
|-
|[[Os05g0580500|'''''OsRAD21-4''''']]
|[[Os05g0580500]]
| 5.66
| 5660
| 1
| 1
| 1
| 2014/5/23 11:03
|-
|'''''[[OsCERK1]]'''''
|
| 5.61
| 5610
| 1
| 1
| 1
| 2014/6/1 18:31
|-
|[[Os11g0116200|'''''LTPs''''']]
|[[Os11g0116200]]
| 5.602
| 7206
| 0.777
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os09g0567800|'''''Lipase''''']]
|[[Os09g0567800]]
| 5.558
| 5558
| 1
| 1
| 1
| 2014/6/6 16:24
|-
|[[Os06g0610350|'''''OsMOC1''''']]
|[[Os06g0610350]]
| 5.547
| 5547
| 1
| 1
| 1
| 2016/6/12 13:57
|-
|[[Os02g0657000|'''''ARAG1''''']]
|[[Os02g0657000]]
| 5.536
| 9210
| 0.601
| 2
| 2
| 2015/5/14 13:51
|-
|'''''[[Wbph8]]'''''
|
| 5.531
| 5531
| 1
| 1
| 1
| 2014/6/10 18:50
|-
|[[Os07g0563300|'''''GD1''''']]
|[[Os07g0563300]]
| 5.487
| 11105
| 0.494
| 2
| 2
| 2015/6/12 16:45
|-
|[[Os06g0701700|'''''OsHKT2;1''''']]
|[[Os06g0701700]]
| 5.432
| 8295
| 0.655
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os10g0419200|'''''RID1''''']]
|[[Os10g0419200]]
| 5.432
| 9118
| 0.596
| 3
| 3
| 2015/6/13 16:44
|-
|'''''[[OsCEBiP]]'''''
|
| 5.419
| 5419
| 1
| 1
| 1
| 2014/6/8 12:32
|-
|'''''[[Xa10]]'''''
|
| 5.416
| 5416
| 1
| 1
| 1
| 2014/6/1 16:52
|-
|[[Os03g0272300|'''''OsSDIR1''''']]
|[[Os03g0272300]]
| 5.41
| 9862
| 0.549
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os10g0528300|'''''GSTs''''']]
|[[Os10g0528300]]
| 5.364
| 9566
| 0.561
| 3
| 3
| 2015/6/13 16:46
|-
|'''''[[Badh2]]'''''
|
| 5.363
| 5363
| 1
| 1
| 1
| 2014/6/8 19:38
|-
|[[Os03g0233900|'''''Hbs''''']]
|[[Os03g0233900]]
| 5.348
| 9011
| 0.593
| 2
| 2
| 2015/6/12 13:38
|-
|'''''[[Xa21]]'''''
|
| 5.345
| 5345
| 1
| 1
| 1
| 2014/6/1 13:37
|-
|'''''[[Bls1]]'''''
|
| 5.308
| 5308
| 1
| 1
| 1
| 2014/5/24 15:17
|-
|[[Os06g0157700|'''''Hd3''''']]
|[[Os06g0157700]]
| 5.304
| 10277
| 0.516
| 2
| 2
| 2015/6/12 16:06
|-
|[[Os02g0260200|'''''LP''''']]
|[[Os02g0260200]]
| 5.302
| 7745
| 0.685
| 2
| 2
| 2015/5/14 13:37
|-
|[[Os03g0232600|'''''TUD1''''']]
|[[Os03g0232600]]
| 5.249
| 10595
| 0.495
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os03g0125100|'''''OsHYD3''''']]
|[[Os03g0125100]]
| 5.183
| 10331
| 0.502
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os06g0212900|'''''ORF3''''']]
|[[Os06g0212900]]
| 5.175
| 6651
| 0.778
| 3
| 3
| 2015/6/12 16:09
|-
|[[Os02g0491300|'''''MTR1''''']]
|[[Os02g0491300]]
| 5.166
| 10047
| 0.514
| 2
| 2
| 2015/5/14 13:40
|-
|[[Os09g0470500|'''''Oshox4''''']]
|[[Os09g0470500]]
| 5.144
| 9661
| 0.532
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os09g0439800|'''''DRO1''''']]
|[[Os09g0439800]]
| 5.122
| 8022
| 0.638
| 3
| 4
| 2015/6/12 17:43
|-
|[[Os12g0555500|'''''PBZ1''''']]
|[[Os12g0555500]]
| 5.108
| 8929
| 0.572
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os11g0508600|'''''Os-11N3''''']]
|[[Os11g0508600]]
| 5.066
| 7754
| 0.653
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os08g0174500|'''''OsDTH8''''']]
|[[Os08g0174500]]
| 5.017
| 9397
| 0.534
| 3
| 3
| 2015/6/12 17:28
|-
|[[Os03g0267200|'''''sHSP17.7''''']]
|[[Os03g0267200]]
| 5.008
| 7991
| 0.627
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os06g0622700|'''''OsbZIP50 ''''']]
|[[Os06g0622700]]
| 5
| 9868
| 0.507
| 2
| 2
| 2015/6/12 16:19
|-
|'''''[[SBP]]'''''
|
| 4.997
| 4997
| 1
| 1
| 1
| 2013/7/21 18:43
|-
|[[Os05g0465800|'''''PI3K''''']]
|[[Os05g0465800]]
| 4.939
| 4939
| 1
| 1
| 1
| 2014/6/6 16:19
|-
|[[Os10g0491000|'''''BSP''''']]
|[[Os10g0491000]]
| 4.912
| 8991
| 0.546
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os01g0206700|'''''OsCIPK05''''']]
|[[Os01g0206700]]
| 4.909
| 9664
| 0.508
| 2
| 2
| 2015/5/13 15:05
|-
|[[Os06g0643300|'''''RISBZ1''''']]
|[[Os06g0643300]]
| 4.869
| 7953
| 0.612
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os03g0180800|'''''OsTIFY11a''''']]
|[[Os03g0180800]]
| 4.859
| 8158
| 0.596
| 2
| 2
| 2015/6/12 13:04
|-
|'''''[[BPH_gene]]'''''
|
| 4.857
| 4857
| 1
| 2
| 2
| 2014/6/11 11:14
|-
|[[Os01g0805600|'''''CycB1''''']]
|[[Os01g0805600]]
| 4.842
| 4842
| 1
| 1
| 1
| 2014/6/5 18:11
|-
|[[Os06g0701600|'''''HKT''''']]
|[[Os06g0701600]]
| 4.831
| 7482
| 0.646
| 2
| 2
| 2015/6/12 16:25
|-
|[[Os08g0531600|'''''OsSPL16''''']]
|[[Os08g0531600]]
| 4.818
| 4825
| 0.999
| 2
| 2
| 2014/5/27 23:11
|-
|[[Os06g0254700|'''''OsCLO-6''''']]
|[[Os06g0254700]]
| 4.802
| 7514
| 0.639
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os01g0615100|'''''OCPI2''''']]
|[[Os01g0615100]]
| 4.794
| 7379
| 0.65
| 2
| 2
| 2015/5/13 15:19
|-
|'''''[[HSF]]'''''
|
| 4.772
| 4781
| 0.998
| 2
| 2
| 2013/7/21 20:57
|-
|[[Os06g0125800|'''''OsBBI1''''']]
|[[Os06g0125800]]
| 4.629
| 9410
| 0.492
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os07g0628500|'''''OsbHLH1''''']]
|[[Os07g0628500]]
| 4.606
| 8573
| 0.537
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os07g0694700|'''''APX''''']]
|[[Os07g0694700]]
| 4.569
| 8480
| 0.539
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os01g0293100|'''''TIP2''''']]
|[[Os01g0293100]]
| 4.568
| 8480
| 0.539
| 2
| 2
| 2015/5/13 15:12
|-
|'''''[[Rl14]]'''''
|
| 4.564
| 4764
| 0.958
| 2
| 2
| 2014/6/10 11:19
|-
|'''''[[OsRPA2]]'''''
|
| 4.552
| 4552
| 1
| 1
| 1
| 2014/6/6 9:13
|-
|[[Os06g0604000|'''''OsWR2''''']]
|[[Os06g0604000]]
| 4.53
| 8229
| 0.55
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os01g0192000|'''''OsDOS''''']]
|[[Os01g0192000]]
| 4.527
| 4527
| 1
| 1
| 1
| 2015/7/30 23:13
|-
|[[Os01g0922800|'''''OsMADS51''''']]
|[[Os01g0922800]]
| 4.506
| 4506
| 1
| 1
| 1
| 2014/5/24 18:45
|-
|[[Os02g0787300|'''''OsRac1''''']]
|[[Os02g0787300]]
| 4.483
| 6886
| 0.651
| 2
| 2
| 2015/5/14 14:01
|-
|[[Os09g0439200|'''''OsJAZ8''''']]
|[[Os09g0439200]]
| 4.477
| 8745
| 0.512
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0822900|'''''Dwarf1''''']]
|[[Os01g0822900]]
| 4.447
| 7550
| 0.589
| 3
| 4
| 2015/5/13 15:36
|-
|[[Os08g0167500|'''''CRR6''''']]
|[[Os08g0167500]]
| 4.432
| 8906
| 0.498
| 2
| 2
| 2015/6/12 17:27
|-
|'''''[[Sucrose_synthase]]'''''
|
| 4.428
| 4436
| 0.998
| 2
| 2
| 2013/7/18 11:20
|-
|'''''[[CL971152]]'''''
|
| 4.417
| 4472
| 0.988
| 2
| 2
| 2014/6/10 21:51
|-
|[[Os12g0603700|'''''OsCIPK04''''']]
|[[Os12g0603700]]
| 4.375
| 9322
| 0.469
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os02g0618400|'''''OsMPS''''']]
|[[Os02g0618400]]
| 4.347
| 8707
| 0.499
| 2
| 2
| 2015/5/14 13:45
|-
|[[Os03g0182800|'''''OsDERF1''''']]
|[[Os03g0182800]]
| 4.322
| 6519
| 0.663
| 2
| 2
| 2015/6/12 13:05
|-
|'''''[[ARF]]'''''
|
| 4.308
| 4308
| 1
| 1
| 1
| 2013/7/21 20:46
|-
|[[Os03g0183000|'''''OsRAF''''']]
|[[Os03g0183000]]
| 4.286
| 4286
| 1
| 1
| 1
| 2014/6/9 20:10
|-
|[[Os02g0654700|'''''AP59''''']]
|[[Os02g0654700]]
| 4.285
| 8306
| 0.516
| 2
| 2
| 2015/5/14 13:49
|-
|[[Os09g0466400|'''''OsZHD1''''']]
|[[Os09g0466400]]
| 4.265
| 8095
| 0.527
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os03g0103300|'''''qLTG3''''']]
|[[Os03g0103300]]
| 4.188
| 7457
| 0.562
| 2
| 2
| 2015/6/12 12:56
|-
|[[Os01g0834400|'''''OsHAP3A''''']]
|[[Os01g0834400]]
| 4.109
| 4109
| 1
| 1
| 1
| 2014/5/31 19:19
|-
|[[Os07g0512200|'''''OsAtg8''''']]
|[[Os07g0512200]]
| 4.095
| 7690
| 0.533
| 4
| 4
| 2015/6/12 16:43
|-
|'''''[[Bph9]]'''''
|
| 4.084
| 4084
| 1
| 1
| 1
| 2014/6/9 12:23
|-
|[[Os06g0181700|'''''OsWR1''''']]
|[[Os06g0181700]]
| 4.083
| 7433
| 0.549
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os06g0157500|'''''RFT1''''']]
|[[Os06g0157500]]
| 4.013
| 7888
| 0.509
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os09g0537700|'''''OsRNS4''''']]
|[[Os09g0537700]]
| 3.992
| 6731
| 0.593
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os02g0610500|'''''OsCOL4''''']]
|[[Os02g0610500]]
| 3.946
| 3946
| 1
| 1
| 1
| 2014/5/20 11:57
|-
|[[Os07g0529600|'''''OsDR8''''']]
|[[Os07g0529600]]
| 3.915
| 6908
| 0.567
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0106700|'''''AKT1''''']]
|[[Os09g0106700]]
| 3.845
| 6498
| 0.592
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os07g0568700|'''''OsFOR1''''']]
|[[Os07g0568700]]
| 3.845
| 6600
| 0.583
| 2
| 2
| 2015/6/12 16:46
|-
|'''''[[Pik-p]]'''''
|
| 3.816
| 3816
| 1
| 1
| 1
| 2014/6/6 10:16
|-
|[[Os06g0493100|'''''Bphi008a''''']]
|[[Os06g0493100]]
| 3.804
| 7241
| 0.525
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os02g0552700|'''''OsZFP6''''']]
|[[Os02g0552700]]
| 3.779
| 6604
| 0.572
| 2
| 2
| 2015/5/14 13:43
|-
|[[Os12g0100500|'''''COG2267''''']]
|[[Os12g0100500]]
| 3.729
| 5669
| 0.658
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os07g0129200|'''''OsPR1''''']]
|[[Os07g0129200]]
| 3.716
| 6629
| 0.561
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os10g0558900|'''''RL14''''']]
|[[Os10g0558900]]
| 3.699
| 7398
| 0.5
| 5
| 9
| 2015/6/13 16:57
|-
|[[Os01g0177400|'''''ACO1''''']]
|[[Os01g0177400]]
| 3.693
| 6293
| 0.587
| 3
| 3
| 2015/5/13 14:57
|-
|[[Os09g0380200|'''''YLC1''''']]
|[[Os09g0380200]]
| 3.69
| 6890
| 0.536
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os08g0163400|'''''OsSIG1''''']]
|[[Os08g0163400]]
| 3.662
| 3662
| 1
| 1
| 1
| 2014/6/9 20:52
|-
|[[Os09g0396900|'''''OsVIT2''''']]
|[[Os09g0396900]]
| 3.437
| 6527
| 0.527
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g0786400|'''''OsCKX2''''']]
|[[Os03g0786400]]
| 3.372
| 3372
| 1
| 1
| 1
| 2014/5/20 0:08
|-
|'''''[[Bhp-3]]'''''
|
| 3.33
| 3330
| 1
| 1
| 1
| 2014/5/31 23:33
|-
|[[Os07g0641200|'''''OsCCaMK''''']]
|[[Os07g0641200]]
| 3.212
| 6389
| 0.503
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0549600|'''''UDT1''''']]
|[[Os07g0549600]]
| 3.204
| 5875
| 0.545
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os11g0582500|'''''OsC6''''']]
|[[Os11g0582500]]
| 3.13
| 5666
| 0.552
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os03g0135700|'''''RAI1''''']]
|[[Os03g0135700]]
| 3.126
| 3126
| 1
| 1
| 1
| 2014/6/7 0:43
|-
|[[Os09g0459200|'''''SG1''''']]
|[[Os09g0459200]]
| 3.094
| 5090
| 0.608
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os11g0523700|'''''OsICE1''''']]
|[[Os11g0523700]]
| 3.071
| 3079
| 0.997
| 2
| 2
| 2014/6/3 13:41
|-
|[[Os09g0522200|'''''OsDREB1A''''']]
|[[Os09g0522200]]
| 3.031
| 5920
| 0.512
| 3
| 3
| 2015/6/12 22:36
|-
|[[Os06g0127100|'''''OsDREB1C''''']]
|[[Os06g0127100]]
| 3.015
| 5846
| 0.516
| 3
| 3
| 2015/6/12 16:02
|-
|[[Os10g0573400|'''''OsPYL10''''']]
|[[Os10g0573400]]
| 3.009
| 6148
| 0.489
| 4
| 4
| 2015/6/13 16:58
|-
|[[Os01g0274800|'''''CSA''''']]
|[[Os01g0274800]]
| 2.805
| 2805
| 1
| 1
| 1
| 2014/5/28 21:34
|-
|[[BGIOSGA033504|'''''csld4''''']]
|[[BGIOSGA033504]]
| 2.803
| 2818
| 0.995
| 2
| 2
| 2014/6/3 16:43
|-
|[[Os11g0454000|'''''rab16c''''']]
|[[Os11g0454000]]
| 2.786
| 5342
| 0.522
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os10g0148000|'''''OsDIL''''']]
|[[Os10g0148000]]
| 2.697
| 5106
| 0.528
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os08g0566600|'''''PGR5''''']]
|[[Os08g0566600]]
| 2.632
| 4314
| 0.61
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os03g0150200|'''''OsAP23''''']]
|[[Os03g0150200]]
| 2.621
| 5115
| 0.512
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os05g0341600|'''''RAB21''''']]
|[[Os05g0341600]]
| 2.592
| 2640
| 0.982
| 2
| 3
| 2014/6/1 17:02
|-
|[[Os07g0191600|'''''STR2''''']]
|[[Os07g0191600]]
| 2.541
| 2541
| 1
| 1
| 1
| 2014/6/11 19:08
|-
|[[Os11g0208900|'''''xa5''''']]
|[[Os11g0208900]]
| 2.152
| 2152
| 1
| 1
| 1
| 2014/6/8 17:23
|-
|[[Os07g0492000|'''''OsNDPK1''''']]
|[[Os07g0492000]]
| 1.777
| 1777
| 1
| 1
| 1
| 2014/6/9 23:45
|-
|[[Os03g0741100|'''''OsbHLH148''''']]
|[[Os03g0741100]]
| 1.578
| 1578
| 1
| 1
| 1
| 2014/5/19 3:18
|}

RiceWiki:Curated Genes

2017-03-08T06:23:19Z

Xysj1981:

{|class="wikitable sortable" style="width:90%;text-align:center"
|-
!'''Gene Symbol'''
!'''RAP-DB-ID'''
!'''Total Contribution Score'''
!'''Summed Edit Quantity'''
!'''Averaged Edit Quality'''
!'''Contributor Count'''
!'''Edit Count*'''
!'''Last Edit Time'''
|-
|[[Os09g0114500|'''''BC12''''']]
|[[Os09g0114500]]
| 14.854
| 23746
| 0.626
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os10g0405500|'''''PAIR3''''']]
|[[Os10g0405500]]
| 10.742
| 10877
| 0.988
| 3
| 3
| 2014/6/8 23:39
|-
|[[Os09g0286400|'''''OsNHX5''''']]
|[[Os09g0286400]]
| 12.133
| 24113
| 0.503
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0306400|'''''OsbZIP71''''']]
|[[Os09g0306400]]
| 7.71
| 12551
| 0.614
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0417600|'''''OsWRKY76''''']]
|[[Os09g0417600]]
| 5.713
| 10209
| 0.56
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os09g0434200|'''''OsDSG1''''']]
|[[Os09g0434200]]
| 5.792
| 11879
| 0.488
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os10g0553300|'''''OsTPP2''''']]
|[[Os10g0553300]]
| 8.403
| 35721
| 0.235
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os10g0563600|'''''OsMSRA4.1''''']]
|[[Os10g0563600]]
| 7.778
| 13380
| 0.581
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0127600|'''''ONAC045''''']]
|[[Os11g0127600]]
| 7.065
| 12576
| 0.562
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os11g0648000|'''''OsNHX3''''']]
|[[Os11g0648000]]
| 7.638
| 15767
| 0.484
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os12g0569700|'''''OsHsp23.7''''']]
|[[Os12g0569700]]
| 6.412
| 13859
| 0.463
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os12g0583700|'''''ZFP252''''']]
|[[Os12g0583700]]
| 8.489
| 12862
| 0.66
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os08g0139000|'''''OsDEG10''''']]
|[[Os08g0139000]]
| 4.811
| 9008
| 0.534
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os08g0323700|'''''OsCCC1''''']]
|[[Os08g0323700]]
| 6.709
| 11315
| 0.593
| 2
| 2
| 2015/6/12 17:29
|-
|[[Os08g0441100|'''''OsCIPK06''''']]
|[[Os08g0441100]]
| 3.819
| 7418
| 0.515
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os08g0504700|'''''OsSAP11''''']]
|[[Os08g0504700]]
| 7.149
| 10763
| 0.664
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0540400|'''''OsCPK21''''']]
|[[Os08g0540400]]
| 10.561
| 19732
| 0.535
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os08g0546800|'''''OsHsfB2b''''']]
|[[Os08g0546800]]
| 12.399
| 23039
| 0.538
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os07g0186000|'''''OsTRXh1''''']]
|[[Os07g0186000]]
| 7.817
| 12275
| 0.637
| 2
| 2
| 2015/6/12 16:34
|-
|[[Os07g0556800|'''''OSRIP18''''']]
|[[Os07g0556800]]
| 8.473
| 12924
| 0.656
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os07g0666900|'''''OsNHX1''''']]
|[[Os07g0666900]]
| 11.455
| 21522
| 0.532
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0678600|'''''OsCIPK2''''']]
|[[Os07g0678600]]
| 5.575
| 11240
| 0.496
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0693800|'''''OsFAD8''''']]
|[[Os07g0693800]]
| 5.613
| 11290
| 0.497
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os06g0130100|'''''OsSIK1''''']]
|[[Os06g0130100]]
| 11.48
| 22964
| 0.5
| 2
| 2
| 2015/6/12 16:04
|-
|[[Os06g0472000|'''''OsMSRB1.1''''']]
|[[Os06g0472000]]
| 6.592
| 12098
| 0.545
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os06g0561000|'''''OsMIOX''''']]
|[[Os06g0561000]]
| 6.249
| 12468
| 0.501
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os06g0603600|'''''OsSPX1''''']]
|[[Os06g0603600]]
| 7.774
| 15383
| 0.505
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os06g0612800|'''''OsiSAP8''''']]
|[[Os06g0612800]]
| 8.934
| 14002
| 0.638
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0644200|'''''OVP1''''']]
|[[Os06g0644200]]
| 10.007
| 15443
| 0.648
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0651100|'''''YK1''''']]
|[[Os06g0651100]]
| 8.803
| 18547
| 0.475
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0662200|'''''OsbZIP52''''']]
|[[Os06g0662200]]
| 6.942
| 12388
| 0.56
| 2
| 2
| 2015/6/12 16:22
|-
|[[Os06g0727200|'''''OsCATB''''']]
|[[Os06g0727200]]
| 6.864
| 13184
| 0.521
| 2
| 2
| 2015/6/12 16:27
|-
|[[Os03g0117900|'''''HYR''''']]
|[[Os03g0117900]]
| 5.381
| 8815
| 0.61
| 2
| 2
| 2015/6/12 12:59
|-
|[[Os09g0457900|'''''OsEATB''''']]
|[[Os09g0457900]]
| 42.219
| 42219
| 1
| 1
| 1
| 2014/6/6 14:12
|-
|[[Os06g0208800|'''''LYP6''''']]
|[[Os06g0208800]]
| 35.205
| 40853
| 0.862
| 2
| 2
| 2015/6/12 16:09
|-
|[[Os11g0587000|'''''DWARF27''''']]
|[[Os11g0587000]]
| 31.862
| 34044
| 0.936
| 2
| 4
| 2014/6/9 2:23
|-
|'''''[[GW5]]'''''
|
| 31.812
| 31817
| 1
| 2
| 2
| 2014/6/8 22:47
|-
|[[Os03g0122600|'''''OsMADS50''''']]
|[[Os03g0122600]]
| 31.778
| 36672
| 0.867
| 2
| 2
| 2015/6/12 13:00
|-
|'''''[[Du1]]'''''
|
| 26.789
| 26797
| 1
| 2
| 2
| 2014/6/5 11:51
|-
|[[Os01g0771200|'''''XB24''''']]
|[[Os01g0771200]]
| 25.112
| 106499
| 0.236
| 3
| 14
| 2015/5/13 15:32
|-
|'''''[[IPA1]]'''''
|
| 22.636
| 22636
| 1
| 1
| 1
| 2014/6/1 14:57
|-
|'''''[[AB013448]]'''''
|
| 21.65
| 21650
| 1
| 1
| 1
| 2014/6/8 17:24
|-
|[[Os10g0542100|'''''MT''''']]
|[[Os10g0542100]]
| 21.515
| 25382
| 0.848
| 3
| 3
| 2015/6/13 16:56
|-
|'''''[[MADS]]'''''
|
| 21.305
| 21310
| 1
| 3
| 3
| 2014/6/7 19:11
|-
|'''''[[MYB]]'''''
|
| 21.082
| 21418
| 0.984
| 2
| 2
| 2013/7/16 10:48
|-
|[[Os09g0272900|'''''PB''''']]
|[[Os09g0272900]]
| 21.033
| 24405
| 0.862
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os01g0848400|'''''qSH1''''']]
|[[Os01g0848400]]
| 20.688
| 31733
| 0.652
| 2
| 2
| 2015/5/13 15:40
|-
|[[Os09g0441900|'''''OsDEP1''''']]
|[[Os09g0441900]]
| 18.815
| 18855
| 0.998
| 5
| 5
| 2014/6/11 0:23
|-
|[[Os09g0240200|'''''CONSTANS''''']]
|[[Os09g0240200]]
| 18.077
| 26433
| 0.684
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os04g0271200|'''''SRT701''''']]
|[[Os04g0271200]]
| 18.041
| 18413
| 0.98
| 5
| 9
| 2014/6/10 16:01
|-
|[[Os01g0678500|'''''OsTPC1''''']]
|[[Os01g0678500]]
| 17.989
| 29118
| 0.618
| 6
| 7
| 2015/5/13 15:24
|-
|[[Os03g0332400|'''''OsGLYII-2''''']]
|[[Os03g0332400]]
| 17.603
| 17603
| 1
| 1
| 1
| 2014/12/27 21:46
|-
|[[Os06g0196700|'''''OsARF16'''''']]
|[[Os06g0196700]]
| 17.411
| 28849
| 0.604
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os07g0261200|'''''Ghd7''''']]
|[[Os07g0261200]]
| 17.077
| 17414
| 0.981
| 2
| 2
| 2014/6/1 17:56
|-
|'''''[[Xa7]]'''''
|
| 16.58
| 16580
| 1
| 1
| 1
| 2014/5/30 14:34
|-
|[[Os03g0227700|'''''OsDWARF4''''']]
|[[Os03g0227700]]
| 16.238
| 28577
| 0.568
| 4
| 6
| 2015/6/12 13:36
|-
|'''''[[Pb1]]'''''
|
| 15.987
| 15987
| 1
| 1
| 1
| 2014/6/3 15:06
|-
|[[Os12g0597000|'''''CBL''''']]
|[[Os12g0597000]]
| 15.897
| 25737
| 0.618
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os01g0841500|'''''OsMYB3R2''''']]
|[[Os01g0841500]]
| 15.635
| 27885
| 0.561
| 3
| 4
| 2015/5/13 15:39
|-
|[[Os01g0182600|'''''GI''''']]
|[[Os01g0182600]]
| 14.75
| 22705
| 0.65
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os08g0162100|'''''ASP1''''']]
|[[Os08g0162100]]
| 14.743
| 14743
| 1
| 1
| 1
| 2015/6/12 17:26
|-
|[[Os02g0738900|'''''OsDRP2B''''']]
|[[Os02g0738900]]
| 14.365
| 21439
| 0.67
| 2
| 2
| 2015/5/14 13:58
|-
|[[Os06g0594600|'''''OsAt10''''']]
|[[Os06g0594600]]
| 14.147
| 19008
| 0.744
| 3
| 4
| 2015/6/12 16:17
|-
|[[Os01g57340|'''''Npi37''''']]
|[[Os01g57340]]
| 14.08
| 14080
| 1
| 1
| 1
| 2014/5/27 20:22
|-
|[[Os01g0718300|'''''OsBRI1''''']]
|[[Os01g0718300]]
| 14.008
| 25923
| 0.54
| 3
| 3
| 2015/5/13 15:26
|-
|'''''[[Du2]]'''''
|
| 13.964
| 13964
| 1
| 2
| 2
| 2014/6/5 11:53
|-
|'''''[[OsMYB103L]]'''''
|
| 13.96
| 13960
| 1
| 1
| 1
| 2014/6/11 16:14
|-
|[[Os01g0782100|''''' Pi-sh''''']]
|[[Os01g0782100]]
| 13.897
| 27151
| 0.512
| 3
| 3
| 2015/5/13 15:34

|-
|[[Os06g0706400|'''''OsPTR9''''']]
|[[Os06g0706400]]
| 13.739
| 20020
| 0.686
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os08g0398400|'''''OsHIR1''''']]
|[[Os08g0398400]]
| 13.721
| 13748
| 0.998
| 3
| 6
| 2014/6/3 16:40
|-
|[[Os02g0141300|'''''CAP1''''']]
|[[Os02g0141300]]
| 13.71
| 28137
| 0.487
| 5
| 10
| 2015/5/14 13:21
|-
|[[Os07g0214100|'''''RAG1''''']]
|[[Os07g0214100]]
| 13.62
| 31302
| 0.435
| 2
| 2
| 2015/6/12 16:36
|-
|'''''[[DWT1]]'''''
|
| 13.275
| 13275
| 1
| 1
| 1
| 2014/5/31 12:55
|-
|[[Os01g0797600|'''''OsERF3''''']]
|[[Os01g0797600]]
| 13.247
| 13247
| 1
| 1
| 1
| 2014/5/25 15:17
|-
|[[Os01g0883800|'''''semidwarf-1''''']]
|[[Os01g0883800]]
| 13.17
| 24896
| 0.529
| 16
| 41
| 2016/6/17 17:22
|-
|[[Os08g0524100|'''''OsSRT1''''']]
|[[Os08g0524100]]
| 13.001
| 18711
| 0.695
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os08g0559300|'''''SPINDLY''''']]
|[[Os08g0559300]]
| 12.718
| 21018
| 0.605
| 3
| 6
| 2015/6/12 17:35
|-
|[[Os11g0225300|'''''PAMP''''']]
|[[Os11g0225300]]
| 12.691
| 23520
| 0.54
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os07g0155600|'''''OsEIN2''''']]
|[[Os07g0155600]]
| 12.605
| 18316
| 0.688
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os01g0607200|'''''OsBAT1''''']]
|[[Os01g0607200]]
| 12.553
| 19986
| 0.628
| 2
| 2
| 2015/5/13 15:17
|-
|[[Os07g0616800|'''''SUS''''']]
|[[Os07g0616800]]
| 12.42
| 26693
| 0.465
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os12g0102400|'''''OsRINGC2-2''''']]
|[[Os12g0102400]]
| 12.278
| 17739
| 0.692
| 3
| 3
| 2015/6/13 17:13
|-
|'''''[[WRKY]]'''''
|
| 12.226
| 12233
| 0.999
| 2
| 2
| 2014/5/31 12:44
|-
|[[Os10g0536100|'''''OsMADS50''''']]
|[[Os10g0536100]]
| 11.96
| 19080
| 0.627
| 3
| 3
| 2015/6/13 16:52
|-
|[[Os02g0725900|'''''HAP3''''']]
|[[Os02g0725900]]
| 11.931
| 16469
| 0.724
| 2
| 2
| 2015/5/14 13:55
|-
|[[Os01g0626400|'''''OsWRKY11''''']]
|[[Os01g0626400]]
| 11.902
| 18881
| 0.63
| 2
| 2
| 2015/5/13 15:20
|-
|[[Os01g0726400|'''''CFO1''''']]
|[[Os01g0726400]]
| 11.891
| 17625
| 0.675
| 2
| 2
| 2015/5/13 15:27
|-
|[[Os09g0422500|'''''OsCESA9''''']]
|[[Os09g0422500]]
| 11.747
| 23511
| 0.5
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os09g0250700|'''''OsABC1-12''''']]
|[[Os09g0250700]]
| 11.742
| 15681
| 0.749
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os06g0701300|'''''OsABC1-8''''']]
|[[Os06g0701300]]
| 11.604
| 15691
| 0.74
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0126400|'''''OsCPK4''''']]
|[[Os02g0126400]]
| 11.6
| 22962
| 0.505
| 2
| 2
| 2015/5/14 13:20
|-
|[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]
|[[Os06g0570100]]
| 11.586
| 15710
| 0.737
| 3
| 3
| 2015/6/12 16:16
|-
|[[Os03g0793500|'''''Hd16''''']]
|[[Os03g0793500]]
| 11.531
| 15843
| 0.728
| 2
| 2
| 2015/5/15 13:43
|-
|[[Os01g0536000|'''''OsCIPK08''''']]
|[[Os01g0536000]]
| 11.52
| 15150
| 0.76
| 2
| 2
| 2015/5/13 15:15
|-
|[[Os03g0848700|'''''Bph14''''']]
|[[Os03g0848700]]
| 11.486
| 21573
| 0.532
| 4
| 4
| 2015/5/15 13:41
|-
|[[Os01g0907900|'''''PLA2''''']]
|[[Os01g0907900]]
| 11.483
| 11485
| 1
| 2
| 2
| 2014/6/2 17:56
|-
|[[Os07g0459200|'''''OsABC1-10''''']]
|[[Os07g0459200]]
| 11.449
| 15381
| 0.744
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os07g0102300|'''''SRL1''''']]
|[[Os07g0102300]]
| 11.423
| 22326
| 0.512
| 3
| 3
| 2015/6/12 16:30
|-
|[[Os07g0186200|'''''OsSIK2''''']]
|[[Os07g0186200]]
| 11.413
| 20165
| 0.566
| 3
| 3
| 2015/6/12 16:34
|-
|[[Os03g0226800|'''''CMT3''''']]
|[[Os03g0226800]]
| 11.245
| 21415
| 0.525
| 3
| 3
| 2015/6/12 13:36
|-
|[[Os08g0114200|'''''OsGLU3''''']]
|[[Os08g0114200]]
| 11.137
| 17754
| 0.627
| 2
| 2
| 2015/6/12 17:23
|-
|[[Os07g0596300|'''''FH5''''']]
|[[Os07g0596300]]
| 11.085
| 15490
| 0.716
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os02g0178800|'''''OsGL1-2''''']]
|[[Os02g0178800]]
| 11.079
| 14720
| 0.753
| 2
| 2
| 2015/5/14 13:23
|-
|[[Os03g0811100|''''' Chl1''''']]
|[[Os03g0811100]]
| 11.068
| 14957
| 0.74
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os09g0395300|'''''SLL1''''']]
|[[Os09g0395300]]
| 11.063
| 16461
| 0.672
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g03150|'''''TAD1''''']]
|[[Os03g03150]]
| 10.972
| 10972
| 1
| 1
| 1
| 2014/6/9 12:35
|-
|[[Os12g0189500|'''''OsYUC11''''']]
|[[Os12g0189500]]
| 10.931
| 20645
| 0.529
| 7
| 7
| 2015/6/13 17:16
|-
|[[Os06g0211200|'''''OsAREB1''''']]
|[[Os06g0211200]]
| 10.925
| 19995
| 0.546
| 5
| 6
| 2015/6/12 16:09
|-
|[[Os02g0100200|'''''HSP''''']]
|[[Os02g0100200]]
| 10.917
| 21797
| 0.501
| 2
| 2
| 2015/5/14 13:17
|-
|'''''[[BHLH]]'''''
|
| 10.829
| 10829
| 1
| 1
| 1
| 2013/7/21 20:47
|-
|[[Os11g0703900|'''''Hsp70''''']]
|[[Os11g0703900]]
| 10.813
| 10898
| 0.992
| 4
| 5
| 2014/6/9 23:54
|-
|[[Os01g44260|'''''OsDfr''''']]
|[[Os01g44260]]
| 10.787
| 10787
| 1
| 1
| 1
| 2014/6/9 21:48
|-
|[[Os03g0815100|'''''SNAC1''''']]
|[[Os03g0815100]]
| 10.722
| 15783
| 0.679
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os10g0561400|'''''OsMYBS3''''']]
|[[Os10g0561400]]
| 10.656
| 22236
| 0.479
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0523800|'''''OsARF1''''']]
|[[Os11g0523800]]
| 10.633
| 21943
| 0.485
| 6
| 6
| 2015/6/13 17:08
|-
|[[Os07g0257200|'''''OsNRAMP5''''']]
|[[Os07g0257200]]
| 10.556
| 10556
| 1
| 1
| 1
| 2015/6/12 16:38
|-
|[[Os02g0661100|'''''OsTPP1''''']]
|[[Os02g0661100]]
| 10.544
| 18837
| 0.56
| 2
| 2
| 2015/5/14 13:51
|-
|[[Os07g0164000|'''''WAF1''''']]
|[[Os07g0164000]]
| 10.534
| 11864
| 0.888
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os12g0476200|'''''Xa25''''']]
|[[Os12g0476200]]
| 10.44
| 17073
| 0.611
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os10g0497300|'''''Rf1a''''']]
|[[Os10g0497300]]
| 10.431
| 18232
| 0.572
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os07g0108900|'''''OsMADS15''''']]
|[[Os07g0108900]]
| 10.425
| 20545
| 0.507
| 4
| 5
| 2015/6/12 16:31
|-
|[[Os03g0215400|'''''MADS1''''']]
|[[Os03g0215400]]
| 10.412
| 14715
| 0.708
| 2
| 2
| 2015/6/12 13:34
|-
|[[Os08g0174700|'''''OsSERK1''''']]
|[[Os08g0174700]]
| 10.335
| 21519
| 0.48
| 2
| 2
| 2015/6/12 17:28
|-
|[[Os01g0121700|'''''OsWBC1''''']]
|[[Os01g0121700]]
| 10.278
| 14300
| 0.719
| 2
| 2
| 2015/5/13 14:49
|-
|[[Os01g0201700|'''''OsMADS3''''']]
|[[Os01g0201700]]
| 10.276
| 20440
| 0.503
| 2
| 2
| 2015/5/13 15:03
|-
|[[Os10g0577600|'''''JMJ706''''']]
|[[Os10g0577600]]
| 10.16
| 18081
| 0.562
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0839100|'''''ZFP179''''']]
|[[Os01g0839100]]
| 10.128
| 13298
| 0.762
| 2
| 2
| 2015/5/13 15:38
|-
|[[Os03g0237250|'''''LPA1''''']]
|[[Os03g0237250]]
| 10.125
| 14184
| 0.714
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0133000|'''''Waxy''''']]
|[[Os06g0133000]]
| 10.084
| 22204
| 0.454
| 3
| 3
| 2015/6/12 16:04
|-
|[[Os03g0805100|'''''SQS''']]
|[[Os03g0805100]]
| 10.051
| 13542
| 0.742
| 2
| 2
| 2015/5/15 13:42
|-
|'''''[[AB013449]]'''''
|
| 10.03
| 10030
| 1
| 1
| 1
| 2014/6/10 22:14
|-
|[[Os07g0605200|'''''OsMADS18''''']]
|[[Os07g0605200]]
| 10.027
| 19041
| 0.527
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os06g0194900|'''''Sus''''']]
|[[Os06g0194900]]
| 10.026
| 20580
| 0.487
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os01g0764800|'''''GH3''''']]
|[[Os01g0764800]]
| 10.024
| 18674
| 0.537
| 2
| 2
| 2015/5/13 15:32
|-
|[[Os03g0111300|'''''NsLTPs''''']]
|[[Os03g0111300]]
| 10.013
| 12909
| 0.776
| 4
| 4
| 2015/6/12 12:57
|-
|[[Os10g0127900|'''''OsFbx352''''']]
|[[Os10g0127900]]
| 10.013
| 20618
| 0.486
| 4
| 8
| 2015/6/13 16:43
|-
|[[Os06g0662000|'''''OsVHA-A''''']]
|[[Os06g0662000]]
| 9.949
| 19796
| 0.503
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0254600|'''''CALEOSIN''''']]
|[[Os06g0254600]]
| 9.94
| 12129
| 0.82
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os06g0330100|'''''Pi-25''''']]
|[[Os06g0330100]]
| 9.935
| 18990
| 0.523
| 4
| 5
| 2015/6/12 16:13
|-
|[[Os06g0603000|'''''SE5''''']]
|[[Os06g0603000]]
| 9.889
| 9889
| 1
| 1
| 1
| 2014/6/9 17:03
|-
|[[Os08g0535200|'''''xa13''''']]
|[[Os08g0535200]]
| 9.858
| 18774
| 0.525
| 3
| 3
| 2015/6/12 17:34
|-
|[[Os12g0281300|'''''Pi-ta''''']]
|[[Os12g0281300]]
| 9.857
| 21855
| 0.451
| 4
| 4
| 2015/6/13 17:16
|-
|[[Os01g0919400|'''''SPS''''']]
|[[Os01g0919400]]
| 9.837
| 9837
| 1
| 1
| 1
| 2016/6/6 17:48
|-
|[[Os10g0573900|'''''OsNMD3''''']]
|[[Os10g0573900]]
| 9.818
| 16399
| 0.599
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0197100|'''''dwarf2''''']]
|[[Os01g0197100]]
| 9.81
| 19279
| 0.509
| 5
| 6
| 2015/5/13 14:59
|-
|[[Os11g0216300|'''''OsABC1-13''''']]
|[[Os11g0216300]]
| 9.795
| 13761
| 0.712
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os01g0102900|'''''Os-LIR1''''']]
|[[Os01g0102900]]
| 9.726
| 9726
| 1
| 1
| 1
| 2016/6/12 14:04
|-
|[[Os11g0249000|'''''NLS1''''']]
|[[Os11g0249000]]
| 9.718
| 17393
| 0.559
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os10g0467800|'''''OsCesA7''''']]
|[[Os10g0467800]]
| 9.68
| 22133
| 0.437
| 5
| 6
| 2015/6/13 16:48
|-
|[[Os02g0682200|'''''MADS6''''']]
|[[Os02g0682200]]
| 9.577
| 17192
| 0.557
| 3
| 13
| 2015/5/14 13:53
|-
|[[Os06g0569500|'''''GAs''''']]
|[[Os06g0569500]]
| 9.526
| 18834
| 0.506
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os09g0456800|'''''OsHsfs''''']]
|[[Os09g0456800]]
| 9.468
| 13735
| 0.689
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0274900|'''''OsGMST1''''']]
|[[Os02g0274900]]
| 9.449
| 18241
| 0.518
| 2
| 2
| 2015/5/14 13:38
|-
|[[Os06g0724900|'''''ILA1''''']]
|[[Os06g0724900]]
| 9.361
| 19950
| 0.469
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os01g0611100|'''''OsRAN1''''']]
|[[Os01g0611100]]
| 9.349
| 15330
| 0.61
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os08g0509600|'''''OsSPL14''''']]
|[[Os08g0509600]]
| 9.346
| 17625
| 0.53
| 3
| 4
| 2015/6/12 17:32
|-
|[[Os07g0558000|'''''OsABC1-11''''']]
|[[Os07g0558000]]
| 9.337
| 13289
| 0.703
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0449000|'''''PTC1''''']]
|[[Os09g0449000]]
| 9.33
| 16966
| 0.55
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os04g0415000|'''''BY240''''']]
|[[Os04g0415000]]
| 9.31
| 9310
| 1
| 1
| 1
| 2014/6/6 19:55
|-
|[[Os07g0471000|'''''OsIRE1''''']]
|[[Os07g0471000]]
| 9.278
| 18586
| 0.499
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os03g0170900|'''''OsSUT1''''']]
|[[Os03g0170900]]
| 9.272
| 19337
| 0.479
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os06g0610300|'''''MOC1''''']]
|[[Os06g0610300]]
| 9.171
| 11979
| 0.766
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0583400|'''''OsHDAC702''''']]
|[[Os06g0583400]]
| 9.15
| 11481
| 0.797
| 2
| 2
| 2015/6/12 16:16
|-
|[[Os02g0622100|'''''LTG1''''']]
|[[Os02g0622100]]
| 9.147
| 12303
| 0.743
| 2
| 2
| 2015/5/14 13:47
|-
|[[Os03g0203200|'''''HTD2''''']]
|[[Os03g0203200]]
| 9.128
| 17233
| 0.53
| 4
| 4
| 2015/6/12 13:06
|-
|[[Os06g0660200|'''''OsPIN2''''']]
|[[Os06g0660200]]
| 9.119
| 20530
| 0.444
| 5
| 6
| 2015/6/12 16:21
|-
|[[Os10g0403000|'''''PLA1 ''''']]
|[[Os10g0403000]]
| 9.104
| 15463
| 0.589
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os03g0112700|'''''Ehd4''''']]
|[[Os03g0112700]]
| 9.094
| 17122
| 0.531
| 3
| 3
| 2015/6/12 12:58
|-
|[[Os02g0799100|'''''Ossgo1''''']]
|[[Os02g0799100]]
| 9.068
| 16095
| 0.563
| 3
| 6
| 2015/5/14 14:02
|-
|[[Os09g0307800|'''''SDG724''''']]
|[[Os09g0307800]]
| 9.029
| 11279
| 0.801
| 4
| 15
| 2014/6/6 8:56
|-
|[[Os08g0424500|'''''Badh2''''']]
|[[Os08g0424500]]
| 9.021
| 17768
| 0.508
| 3
| 3
| 2015/6/12 17:30
|-
|[[Os11g0184900|'''''OsNAC5''''']]
|[[Os11g0184900]]
| 9.016
| 15182
| 0.594
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0203700|'''''SRZ1''''']]
|[[Os02g0203700]]
| 9.003
| 12324
| 0.731
| 2
| 2
| 2015/5/14 13:26
|-
|[[Os06g0125000|'''''RPM1''''']]
|[[Os06g0125000]]
| 8.97
| 12695
| 0.707
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os03g0128700|'''''OsCDPK13''''']]
|[[Os03g0128700]]
| 8.928
| 17882
| 0.499
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os03g0215200|'''''DL''''']]
|[[Os03g0215200]]
| 8.927
| 14196
| 0.629
| 3
| 3
| 2015/6/12 13:07
|-
|[[Os01g0952800|'''''OsIRO2''''']]
|[[Os01g0952800]]
| 8.922
| 8922
| 1
| 1
| 1
| 2014/6/10 21:52
|-
|[[Os06g0494100|'''''Pi-d2''''']]
|[[Os06g0494100]]
| 8.906
| 12742
| 0.699
| 3
| 3
| 2015/6/12 16:14
|-
|[[Os03g0149100|'''''OsCrl1''''']]
|[[Os03g0149100]]
| 8.897
| 13456
| 0.661
| 3
| 4
| 2015/6/12 11:15
|-
|'''''[[BZIP]]'''''
|
| 8.894
| 8924
| 0.997
| 2
| 2
| 2013/7/21 21:01
|-
|[[Os06g0625900|'''''OsHAK10''''']]
|[[Os06g0625900]]
| 8.872
| 13033
| 0.681
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0229800|'''''ALK''''']]
|[[Os06g0229800]]
| 8.835
| 16807
| 0.526
| 2
| 2
| 2015/6/12 16:11
|-
|[[Os07g0232900|'''''OsHMA3''''']]
|[[Os07g0232900]]
| 8.79
| 18004
| 0.488
| 3
| 8
| 2015/6/12 16:37
|-
|[[Os07g0129700|'''''OSH15''''']]
|[[Os07g0129700]]
| 8.789
| 18504
| 0.475
| 3
| 3
| 2015/6/12 16:32
|-
|[[Os12g0641400|'''''OsSUT2''''']]
|[[Os12g0641400]]
| 8.735
| 8735
| 1
| 1
| 1
| 2016/6/12 13:56
|-
|[[Os08g0137100|'''''OsFIE2''''']]
|[[Os08g0137100]]
| 8.717
| 8717
| 1
| 1
| 1
| 2015/6/12 17:25
|-
|'''''[[Htd1]]'''''
|
| 8.705
| 8705
| 1
| 1
| 1
| 2014/6/10 14:14
|-
|[[Os03g0707600|'''''GAI''''']]
|[[Os03g0707600]]
| 8.666
| 16659
| 0.52
| 2
| 5
| 2014/5/28 0:43
|-
|'''''[[Xa23]]'''''
|
| 8.641
| 8641
| 1
| 1
| 1
| 2014/5/31 21:49
|-
|[[Os11g0235200|'''''SP1''''']]
|[[Os11g0235200]]
| 8.563
| 17156
| 0.499
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os07g0100600|'''''OsPTR1''''']]
|[[Os07g0100600]]
| 8.559
| 15027
| 0.57
| 2
| 2
| 2015/6/12 16:30
|-
|[[Os06g0597000|'''''OsIAA23''''']]
|[[Os06g0597000]]
| 8.509
| 16209
| 0.525
| 4
| 11
| 2014/5/19 22:42
|-
|[[Os02g0232100|'''''HEI10''''']]
|[[Os02g0232100]]
| 8.485
| 15567
| 0.545
| 2
| 2
| 2015/5/14 13:36
|-
|[[Os04g0452500|'''''ZEP1''''']]
|[[Os04g0452500]]
| 8.484
| 8484
| 1
| 1
| 1
| 2014/5/31 16:56
|-
|[[Os09g0363900|'''''ONI3''''']]
|[[Os09g0363900]]
| 8.473
| 12412
| 0.683
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os09g0426800|'''''WSL2''''']]
|[[Os09g0426800]]
| 8.447
| 9634
| 0.877
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0253300|'''''alpha-1a''''']]
|[[Os01g0253300]]
| 8.439
| 17745
| 0.476
| 5
| 5
| 2015/5/13 15:07
|-
|[[Os06g0683400|'''''OsCCD1''''']]
|[[Os06g0683400]]
| 8.438
| 8438
| 1
| 1
| 1
| 2016/6/12 14:00
|-
|[[Os09g0522000|'''''OsDREB''''']]
|[[Os09g0522000]]
| 8.335
| 8335
| 1
| 1
| 1
| 2014/5/24 21:12
|-
|[[Os02g0580300|'''''GID2''''']]
|[[Os02g0580300]]
| 8.329
| 15752
| 0.529
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os08g0499300|'''''OsWRKY30''''']]
|[[Os08g0499300]]
| 8.324
| 17032
| 0.489
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0445700|'''''TPS''''']]
|[[Os08g0445700]]
| 8.317
| 10922
| 0.761
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os10g0505700|'''''LTPs''''']]
|[[Os10g0505700]]
| 8.312
| 16220
| 0.512
| 5
| 6
| 2015/6/13 16:46
|-
|[[Os11g0559200|'''''OsXa21''''']]
|[[Os11g0559200]]
| 8.294
| 15586
| 0.532
| 6
| 9
| 2015/6/13 17:08
|-
|[[Os03g0179400|'''''GUDK''''']]
|[[Os03g0179400]]
| 8.292
| 14840
| 0.559
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os02g0553200|'''''OsAPx8''''']]
|[[Os02g0553200]]
| 8.204
| 8204
| 1
| 1
| 1
| 2014/6/8 16:03
|-
|[[Os01g0571300|'''''OsHsfA7''''']]
|[[Os01g0571300]]
| 8.184
| 14946
| 0.548
| 2
| 2
| 2015/5/13 15:16
|-
|[[Os09g0401100|'''''STR1''''']]
|[[Os09g0401100]]
| 8.183
| 17216
| 0.475
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os02g0181300|'''''WRKY''''']]
|[[Os02g0181300]]
| 8.174
| 13252
| 0.617
| 2
| 2
| 2015/5/14 13:24
|-
|[[Os05g0346200|'''''OsDREB2B2''''']]
|[[Os05g0346200]]
| 8.14
| 8233
| 0.989
| 2
| 3
| 2014/6/5 17:14
|-
|[[Os09g0502100|'''''LGD1''''']]
|[[Os09g0502100]]
| 8.139
| 15501
| 0.525
| 2
| 2
| 2015/6/12 22:35
|-
|[[Os03g0820300|'''''ZFP182''''']]
|[[Os03g0820300]]
| 8.137
| 11604
| 0.701
| 2
| 2
| 2015/5/15 13:41
|-
|[[Os03g0230300|'''''OsSRO1c''''']]
|[[Os03g0230300]]
| 8.029
| 15193
| 0.528
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os07g0438800|'''''OsPHR2''''']]
|[[Os07g0438800]]
| 8.026
| 15610
| 0.514
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os02g0534400|'''''OsCIN1''''']]
|[[Os02g0534400]]
| 7.997
| 16635
| 0.481
| 2
| 2
| 2015/5/14 13:41
|-
|[[Os06g0165600|'''''OsDREB1D''''']]
|[[Os06g0165600]]
| 7.982
| 11937
| 0.669
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os11g0490600|'''''LAZY1''''']]
|[[Os11g0490600]]
| 7.98
| 16603
| 0.481
| 4
| 5
| 2015/6/13 17:07
|-
|[[Os07g0585700|'''''Sdr4''''']]
|[[Os07g0585700]]
| 7.966
| 7966
| 1
| 1
| 1
| 2014/6/9 23:14
|-
|[[Os01g0194300|'''''OsNPR1''''']]
|[[Os01g0194300]]
| 7.966
| 11111
| 0.717
| 2
| 2
| 2015/5/13 14:59
|-
|[[Os01g0869900|'''''SNF1''''']]
|[[Os01g0869900]]
| 7.964
| 16289
| 0.489
| 2
| 2
| 2015/5/13 15:42
|-
|[[Os06g0160700|'''''SSSl''''']]
|[[Os06g0160700]]
| 7.962
| 15027
| 0.53
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os09g0451500|'''''PDI''''']]
|[[Os09g0451500]]
| 7.903
| 10040
| 0.787
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os01g0759400|'''''OsCIPK12''''']]
|[[Os01g0759400]]
| 7.902
| 15742
| 0.502
| 2
| 2
| 2015/5/13 15:30
|-
|[[Os06g0205100|'''''OsC1-Myb''''']]
|[[Os06g0205100]]
| 7.891
| 12914
| 0.611
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os09g0244900|'''''Ypt1p''''']]
|[[Os09g0244900]]
| 7.89
| 11371
| 0.694
| 2
| 2
| 2015/6/12 17:38
|-
|'''''[[HTD2]]'''''
|
| 7.887
| 7887
| 1
| 1
| 1
| 2014/6/4 22:20
|-
|[[Os09g0482400|'''''HSP82''''']]
|[[Os09g0482400]]
| 7.873
| 11843
| 0.665
| 2
| 2
| 2015/6/12 17:47
|-
|[[Os10g0478000|'''''TAW1''''']]
|[[Os10g0478000]]
| 7.871
| 12275
| 0.641
| 4
| 5
| 2015/6/13 16:47
|-
|[[Os07g0258400|'''''OsNRAMP1''''']]
|[[Os07g0258400]]
| 7.866
| 13708
| 0.574
| 2
| 2
| 2015/6/12 16:38
|-
|[[Os10g0445400|'''''OsHCI1''''']]
|[[Os10g0445400]]
| 7.848
| 15652
| 0.501
| 6
| 15
| 2015/6/13 16:48
|-
|[[Os01g0273800|'''''OsYUC9''''']]
|[[Os01g0273800]]
| 7.843
| 9988
| 0.785
| 2
| 2
| 2015/5/13 15:10
|-
|[[Os01g0643300|'''''OsPIN10a''''']]
|[[Os01g0643300]]
| 7.839
| 16276
| 0.482
| 3
| 3
| 2015/5/13 15:22
|-
|[[Os06g0286700|'''''Pi9''''']]
|[[Os06g0286700]]
| 7.816
| 16653
| 0.469
| 6
| 9
| 2015/6/12 16:13
|-
|[[Os11g0104300|'''''DWARF53''''']]
|[[Os11g0104300]]
| 7.791
| 11682
| 0.667
| 4
| 4
| 2015/6/13 17:00
|-
|[[Os07g0150700|'''''Os-AKT1''''']]
|[[Os07g0150700]]
| 7.79
| 15994
| 0.487
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os09g0494200|'''''BC15''''']]
|[[Os09g0494200]]
| 7.776
| 7776
| 1
| 1
| 1
| 2014/6/3 23:51
|-
|[[Os03g0181500|'''''ONI1''''']]
|[[Os03g0181500]]
| 7.751
| 12230
| 0.634
| 3
| 4
| 2015/6/12 13:05
|-
|[[Os02g0814200|'''''OsGL1-6''''']]
|[[Os02g0814200]]
| 7.743
| 13379
| 0.579
| 2
| 2
| 2015/5/14 14:03
|-
|[[Os02g0103800|'''''OsLFNR1''''']]
|[[Os02g0103800]]
| 7.686
| 7686
| 1
| 1
| 1
| 2016/6/12 14:12
|-
|[[Os11g0225100|'''''Pia''''']]
|[[Os11g0225100]]
| 7.669
| 12296
| 0.624
| 3
| 3
| 2015/6/13 17:04
|-
|'''''[[Pi1]]'''''
|
| 7.644
| 7644
| 1
| 1
| 1
| 2014/6/5 17:02
|-
|[[Os01g0307500|'''''SKC1''''']]
|[[Os01g0307500]]
| 7.639
| 7639
| 1
| 1
| 1
| 2014/6/7 21:57
|-
|'''''[[Chalk5]]'''''
|
| 7.635
| 7635
| 1
| 1
| 1
| 2014/5/29 11:10
|-
|[[Os08g0140300|'''''TDC''''']]
|[[Os08g0140300]]
| 7.633
| 13769
| 0.554
| 2
| 2
| 2015/6/12 17:26
|-
|[[Os07g0622900|'''''DTM1''''']]
|[[Os07g0622900]]
| 7.632
| 14288
| 0.534
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os01g0292200|'''''OsCIPK1''''']]
|[[Os01g0292200]]
| 7.626
| 12859
| 0.593
| 2
| 2
| 2015/5/13 15:11
|-
|[[Os03g0230500|'''''DSM3''''']]
|[[Os03g0230500]]
| 7.618
| 14126
| 0.539
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os12g0472500|'''''OsTDL1A''''']]
|[[Os12g0472500]]
| 7.581
| 13819
| 0.549
| 4
| 4
| 2015/6/13 17:17
|-
|[[Os03g0262900|'''''glup6''''']]
|[[Os03g0262900]]
| 7.571
| 15719
| 0.482
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0107700|'''''OsLFNR2''''']]
|[[Os06g0107700]]
| 7.533
| 7533
| 1
| 1
| 1
| 2016/6/6 9:33
|-
|[[Os02g57310|'''''Pib''''']]
|[[Os02g57310]]
| 7.531
| 7531
| 1
| 1
| 1
| 2014/6/6 14:27
|-
|[[Os09g0104200|'''''OsRAD51D''''']]
|[[Os09g0104200]]
| 7.502
| 15399
| 0.487
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os06g0142600|'''''Hd17''''']]
|[[Os06g0142600]]
| 7.492
| 11545
| 0.649
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os03g0788500|'''''OsCPK10''''']]
|[[Os03g0788500]]
| 7.454
| 10159
| 0.734
| 2
| 2
| 2015/5/15 13:44
|-
|[[Os06g0139000|'''''F-box''''']]
|[[Os06g0139000]]
| 7.443
| 15282
| 0.487
| 3
| 4
| 2015/6/12 16:05
|-
|[[Os03g0168600|'''''CYP704B2''''']]
|[[Os03g0168600]]
| 7.43
| 12348
| 0.602
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os11g0117400|'''''OsWRKY89''''']]
|[[Os11g0117400]]
| 7.353
| 11607
| 0.633
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os03g0223400|'''''OsGLN1_2''''']]
|[[Os03g0223400]]
| 7.313
| 14417
| 0.507
| 3
| 3
| 2015/6/12 13:35
|-
|[[Os02g0731200|'''''MADS57''''']]
|[[Os02g0731200]]
| 7.311
| 14927
| 0.49
| 2
| 2
| 2015/5/14 13:56
|-
|[[Os09g02650|'''''BC12''''']]
|[[Os09g02650]]
| 7.302
| 7302
| 1
| 1
| 1
| 2014/6/1 19:01
|-
|[[Os01g0859300|'''''OsABI5''''']]
|[[Os01g0859300]]
| 7.265
| 12246
| 0.593
| 2
| 2
| 2015/5/13 15:41
|-
|[[Os08g0105000|'''''Ghd7''''']]
|[[Os08g0105000]]
| 7.237
| 15311
| 0.473
| 4
| 4
| 2015/6/12 17:23
|-
|[[Os03g0110800|'''''OsDRM2''''']]
|[[Os03g0110800]]
| 7.203
| 14838
| 0.485
| 2
| 2
| 2015/6/12 12:57
|-
|[[Os01g0367100|'''''PHD1''''']]
|[[Os01g0367100]]
| 7.2
| 12561
| 0.573
| 3
| 3
| 2015/6/9 9:53
|-
|[[Os02g0191600|'''''OsbZIP16''''']]
|[[Os02g0191600]]
| 7.2
| 13785
| 0.522
| 2
| 2
| 2015/5/14 13:25
|-
|[[Os08g0137250|'''''FIE1''''']]
|[[Os08g0137250]]
| 7.185
| 14660
| 0.49
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os02g0220400|'''''Cga1''''']]
|[[Os02g0220400]]
| 7.158
| 17791
| 0.402
| 6
| 8
| 2015/5/14 13:36
|-
|[[Os10g0404500|'''''SUTs''''']]
|[[Os10g0404500]]
| 7.151
| 7164
| 0.998
| 2
| 2
| 2014/6/7 23:34
|-
|[[Os10g0177200|'''''OsDSR-1''''']]
|[[Os10g0177200]]
| 7.15
| 9017
| 0.793
| 3
| 3
| 2015/6/13 16:45
|-
|[[Os10g0496900|'''''OsPORB''''']]
|[[Os10g0496900]]
| 7.143
| 14022
| 0.509
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os02g0313400|'''''API5''''']]
|[[Os02g0313400]]
| 7.12
| 14554
| 0.489
| 2
| 2
| 2015/5/14 13:39
|-
|[[Os08g0117000|'''''PSS1''''']]
|[[Os08g0117000]]
| 7.092
| 8202
| 0.865
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os08g0531700|'''''MADS-box''''']]
|[[Os08g0531700]]
| 7.054
| 13276
| 0.531
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os06g0499500|'''''GH3''''']]
|[[Os06g0499500]]
| 7.051
| 12958
| 0.544
| 3
| 4
| 2015/6/12 16:15
|-
|[[Os03g0188400|'''''OsSRT1''''']]
|[[Os03g0188400]]
| 7.05
| 12067
| 0.584
| 2
| 2
| 2015/6/12 13:06
|-
|[[Os02g0649900|'''''OsYSL2''''']]
|[[Os02g0649900]]
| 7.031
| 12503
| 0.562
| 2
| 2
| 2015/5/14 13:48
|-
|[[Os09g0442700|'''''OsDDM1''''']]
|[[Os09g0442700]]
| 7.028
| 10589
| 0.664
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os12g0438600|'''''AtCLC-a''''']]
|[[Os12g0438600]]
| 7.022
| 14835
| 0.473
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os07g0124700|'''''CRL5''''']]
|[[Os07g0124700]]
| 6.998
| 14469
| 0.484
| 2
| 2
| 2015/6/12 16:31
|-
|[[Os11g0639100|'''''Pi54''''']]
|[[Os11g0639100]]
| 6.934
| 11269
| 0.615
| 4
| 4
| 2015/6/13 17:09
|-
|[[Os01g0615050|'''''OCPI1''''']]
|[[Os01g0615050]]
| 6.92
| 9869
| 0.701
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os12g0610200|'''''OsPIL11''''']]
|[[Os12g0610200]]
| 6.911
| 12604
| 0.548
| 4
| 4
| 2015/6/13 17:18
|-
|[[Os03g0123300|'''''TAD1''''']]
|[[Os03g0123300]]
| 6.87
| 15272
| 0.45
| 4
| 8
| 2015/6/12 13:00
|-
|[[Os07g0682800|'''''rth1''''']]
|[[Os07g0682800]]
| 6.853
| 13550
| 0.506
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os11g0446000|'''''RSS3''''']]
|[[Os11g0446000]]
| 6.838
| 13942
| 0.49
| 5
| 5
| 2015/6/13 17:07
|-
|[[Os07g0182900|'''''OsMET1a''''']]
|[[Os07g0182900]]
| 6.821
| 13295
| 0.513
| 5
| 11
| 2015/6/12 16:33
|-
|[[Os01g0205700|'''''OsGSK1''''']]
|[[Os01g0205700]]
| 6.813
| 12490
| 0.545
| 2
| 2
| 2015/5/13 15:04
|-
|[[Os05g0333200|'''''GPA1''''']]
|[[Os05g0333200]]
| 6.778
| 8703
| 0.779
| 2
| 2
| 2014/6/9 9:17
|-
|[[Os10g0167600|'''''OsCPDP''''']]
|[[Os10g0167600]]
| 6.756
| 14570
| 0.464
| 4
| 4
| 2015/6/13 16:45
|-
|[[Os07g0227800|'''''OsABC1-9''''']]
|[[Os07g0227800]]
| 6.744
| 10826
| 0.623
| 2
| 2
| 2015/6/12 16:37
|-
|[[Os10g0567400|'''''OsCAO1''''']]
|[[Os10g0567400]]
| 6.732
| 13437
| 0.501
| 3
| 3
| 2015/6/13 16:58
|-
|'''''[[DEP2]]'''''
|
| 6.724
| 6763
| 0.994
| 3
| 7
| 2014/6/10 22:30
|-
|[[Os07g0592600|'''''OsMGH3''''']]
|[[Os07g0592600]]
| 6.72
| 15320
| 0.439
| 5
| 11
| 2015/6/12 16:46
|-
|[[Os11g0126900|'''''OsNAC10''''']]
|[[Os11g0126900]]
| 6.705
| 6705
| 1
| 1
| 1
| 2014/5/24 12:41
|-
|[[Os09g0561600|'''''OsDEES1''''']]
|[[Os09g0561600]]
| 6.699
| 11352
| 0.59
| 2
| 2
| 2015/6/13 16:42
|-
|'''''[[Sub1A]]'''''
|
| 6.679
| 6679
| 1
| 1
| 1
| 2014/6/4 16:03
|-
|[[Os08g0126300|'''''OsGAPDH''''']]
|[[Os08g0126300]]
| 6.658
| 13730
| 0.485
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os10g0533600|'''''OsMPK6''''']]
|[[Os10g0533600]]
| 6.522
| 8207
| 0.795
| 3
| 3
| 2015/6/13 16:46
|-
|[[Os10g0397400|'''''dwarf2''''']]
|[[Os10g0397400]]
| 6.52
| 11105
| 0.587
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os06g0712700|'''''OsMADS16''''']]
|[[Os06g0712700]]
| 6.51
| 7624
| 0.854
| 2
| 2
| 2014/6/9 16:43
|-
|[[Os08g0237000|'''''OsXTH8''''']]
|[[Os08g0237000]]
| 6.46
| 6460
| 1
| 1
| 1
| 2014/6/9 18:44
|-
|[[Os02g0811000|'''''TH1''''']]
|[[Os02g0811000]]
| 6.453
| 11487
| 0.562
| 2
| 2
| 2015/5/14 14:02
|-
|[[Os07g0505200|'''''OsSPL13''''']]
|[[Os07g0505200]]
| 6.444
| 6444
| 1
| 1
| 1
| 2016/6/13 9:49
|-
|[[Os11g0247300|'''''Srs5''''']]
|[[Os11g0247300]]
| 6.442
| 13081
| 0.492
| 4
| 4
| 2015/6/13 17:05
|-
|[[AY986492|'''''Xa27''''']]
|[[AY986492]]
| 6.408
| 6408
| 1
| 2
| 2
| 2014/6/10 21:12
|-
|[[Os06g0700700|'''''OsHMA2''''']]
|[[Os06g0700700]]
| 6.404
| 6404
| 1
| 1
| 1
| 2014/6/3 20:16
|-
|[[Os02g0771400|'''''OsPFA-DSP2''''']]
|[[Os02g0771400]]
| 6.399
| 6702
| 0.955
| 2
| 3
| 2014/5/12 16:03
|-
|[[Os06g0127800|'''''DLT''''']]
|[[Os06g0127800]]
| 6.393
| 10797
| 0.592
| 2
| 2
| 2015/6/12 16:03
|-
|[[Os02g0120500|'''''OsTDR''''']]
|[[Os02g0120500]]
| 6.372
| 6372
| 1
| 1
| 1
| 2015/5/14 13:19
|-
|[[Os03g0854500|'''''OsHsfs''''']]
|[[Os03g0854500]]
| 6.367
| 10086
| 0.631
| 2
| 2
| 2015/5/15 13:40
|-
|[[Os06g0275000|'''''Hd1''''']]
|[[Os06g0275000]]
| 6.307
| 11994
| 0.526
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os02g0759800|'''''OsSKIPa''''']]
|[[Os02g0759800]]
| 6.249
| 12883
| 0.485
| 2
| 2
| 2015/5/14 14:00
|-
|[[Os08g0101000|'''''IDEF1''''']]
|[[Os08g0101000]]
| 6.239
| 10862
| 0.574
| 2
| 2
| 2015/6/12 17:22
|-
|[[Os09g0456200|'''''OsbZIP72''''']]
|[[Os09g0456200]]
| 6.23
| 10901
| 0.572
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os12g0101600|'''''leaf2''''']]
|[[Os12g0101600]]
| 6.221
| 35095
| 0.177
| 2
| 3
| 2014/5/31 21:22
|-
|[[Os06g0695800|'''''STAR1''''']]
|[[Os06g0695800]]
| 6.213
| 8582
| 0.724
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0606700|'''''RSS1''''']]
|[[Os02g0606700]]
| 6.198
| 12432
| 0.499
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os11g0210300|'''''Adh1''''']]
|[[Os11g0210300]]
| 6.196
| 12384
| 0.5
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0736400|'''''OsDHODH''''']]
|[[Os02g0736400]]
| 6.183
| 11839
| 0.522
| 2
| 2
| 2015/5/14 13:57
|-
|[[Os08g0549100|'''''OsAPx4''''']]
|[[Os08g0549100]]
| 6.175
| 10093
| 0.612
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os09g0452200|'''''LYP4''''']]
|[[Os09g0452200]]
| 6.171
| 11987
| 0.515
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0170300|'''''OsMADS29''''']]
|[[Os02g0170300]]
| 6.166
| 12582
| 0.49
| 3
| 4
| 2015/5/14 13:23
|-
|[[Os03g0224700|'''''Hsfs''''']]
|[[Os03g0224700]]
| 6.166
| 11925
| 0.517
| 4
| 4
| 2015/6/12 13:35
|-
|[[Os07g0558500|'''''THF1''''']]
|[[Os07g0558500]]
| 6.078
| 12744
| 0.477
| 5
| 9
| 2015/6/12 16:45
|-
|[[Os09g0511000|'''''OsCERK1''''']]
|[[Os09g0511000]]
| 6.076
| 12097
| 0.502
| 2
| 2
| 2015/6/12 22:35
|-
|'''''[[OsWRKY13]]'''''
|
| 6.069
| 6101
| 0.995
| 2
| 3
| 2014/6/4 20:18
|-
|[[Os06g0308100|'''''OsIBR5''''']]
|[[Os06g0308100]]
| 6.062
| 12455
| 0.487
| 2
| 2
| 2015/6/12 16:13
|-
|[[Os11g0113700|'''''OsCIPK15''''']]
|[[Os11g0113700]]
| 5.961
| 12261
| 0.486
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os02g0656600|'''''GPA3''''']]
|[[Os02g0656600]]
| 5.915
| 10022
| 0.59
| 2
| 2
| 2015/5/14 13:50
|-
|[[Os01g0733200|'''''OsHsfC1b''''']]
|[[Os01g0733200]]
| 5.889
| 5889
| 1
| 1
| 1
| 2014/5/31 11:56
|-
|[[Os01g0785400|'''''GH3''''']]
|[[Os01g0785400]]
| 5.864
| 10600
| 0.553
| 2
| 2
| 2015/5/13 15:34
|-
|[[Os04g0541700|'''''Oshox22''''']]
|[[Os04g0541700]]
| 5.857
| 6037
| 0.97
| 2
| 3
| 2014/6/8 16:10
|-
|[[Os08g0140500|'''''TDC-3''''']]
|[[Os08g0140500]]
| 5.829
| 11343
| 0.514
| 2
| 2
| 2015/6/12 17:26
|-
|'''''[[IPK1]]'''''
|
| 5.803
| 5803
| 1
| 1
| 1
| 2014/6/8 16:55
|-
|[[Os09g0522100|'''''CBF''''']]
|[[Os09g0522100]]
| 5.713
| 9270
| 0.616
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os01g0177900|'''''OsABCG31''''']]
|[[Os01g0177900]]
| 5.693
| 11327
| 0.503
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os02g0149800|'''''OsPP18''''']]
|[[Os02g0149800]]
| 5.681
| 11452
| 0.496
| 2
| 2
| 2015/5/14 13:22
|-
|[[Os01g0831000|'''''LAX''''']]
|[[Os01g0831000]]
| 5.68
| 9517
| 0.597
| 2
| 2
| 2015/5/13 15:37
|-
|[[Os05g0580500|'''''OsRAD21-4''''']]
|[[Os05g0580500]]
| 5.66
| 5660
| 1
| 1
| 1
| 2014/5/23 11:03
|-
|'''''[[OsCERK1]]'''''
|
| 5.61
| 5610
| 1
| 1
| 1
| 2014/6/1 18:31
|-
|[[Os11g0116200|'''''LTPs''''']]
|[[Os11g0116200]]
| 5.602
| 7206
| 0.777
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os09g0567800|'''''Lipase''''']]
|[[Os09g0567800]]
| 5.558
| 5558
| 1
| 1
| 1
| 2014/6/6 16:24
|-
|[[Os06g0610350|'''''OsMOC1''''']]
|[[Os06g0610350]]
| 5.547
| 5547
| 1
| 1
| 1
| 2016/6/12 13:57
|-
|[[Os02g0657000|'''''ARAG1''''']]
|[[Os02g0657000]]
| 5.536
| 9210
| 0.601
| 2
| 2
| 2015/5/14 13:51
|-
|'''''[[Wbph8]]'''''
|
| 5.531
| 5531
| 1
| 1
| 1
| 2014/6/10 18:50
|-
|[[Os07g0563300|'''''GD1''''']]
|[[Os07g0563300]]
| 5.487
| 11105
| 0.494
| 2
| 2
| 2015/6/12 16:45
|-
|[[Os06g0701700|'''''OsHKT2;1''''']]
|[[Os06g0701700]]
| 5.432
| 8295
| 0.655
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os10g0419200|'''''RID1''''']]
|[[Os10g0419200]]
| 5.432
| 9118
| 0.596
| 3
| 3
| 2015/6/13 16:44
|-
|'''''[[OsCEBiP]]'''''
|
| 5.419
| 5419
| 1
| 1
| 1
| 2014/6/8 12:32
|-
|'''''[[Xa10]]'''''
|
| 5.416
| 5416
| 1
| 1
| 1
| 2014/6/1 16:52
|-
|[[Os03g0272300|'''''OsSDIR1''''']]
|[[Os03g0272300]]
| 5.41
| 9862
| 0.549
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os10g0528300|'''''GSTs''''']]
|[[Os10g0528300]]
| 5.364
| 9566
| 0.561
| 3
| 3
| 2015/6/13 16:46
|-
|'''''[[Badh2]]'''''
|
| 5.363
| 5363
| 1
| 1
| 1
| 2014/6/8 19:38
|-
|[[Os03g0233900|'''''Hbs''''']]
|[[Os03g0233900]]
| 5.348
| 9011
| 0.593
| 2
| 2
| 2015/6/12 13:38
|-
|'''''[[Xa21]]'''''
|
| 5.345
| 5345
| 1
| 1
| 1
| 2014/6/1 13:37
|-
|'''''[[Bls1]]'''''
|
| 5.308
| 5308
| 1
| 1
| 1
| 2014/5/24 15:17
|-
|[[Os06g0157700|'''''Hd3''''']]
|[[Os06g0157700]]
| 5.304
| 10277
| 0.516
| 2
| 2
| 2015/6/12 16:06
|-
|[[Os02g0260200|'''''LP''''']]
|[[Os02g0260200]]
| 5.302
| 7745
| 0.685
| 2
| 2
| 2015/5/14 13:37
|-
|[[Os03g0232600|'''''TUD1''''']]
|[[Os03g0232600]]
| 5.249
| 10595
| 0.495
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os03g0125100|'''''OsHYD3''''']]
|[[Os03g0125100]]
| 5.183
| 10331
| 0.502
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os06g0212900|'''''ORF3''''']]
|[[Os06g0212900]]
| 5.175
| 6651
| 0.778
| 3
| 3
| 2015/6/12 16:09
|-
|[[Os02g0491300|'''''MTR1''''']]
|[[Os02g0491300]]
| 5.166
| 10047
| 0.514
| 2
| 2
| 2015/5/14 13:40
|-
|[[Os09g0470500|'''''Oshox4''''']]
|[[Os09g0470500]]
| 5.144
| 9661
| 0.532
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os09g0439800|'''''DRO1''''']]
|[[Os09g0439800]]
| 5.122
| 8022
| 0.638
| 3
| 4
| 2015/6/12 17:43
|-
|[[Os12g0555500|'''''PBZ1''''']]
|[[Os12g0555500]]
| 5.108
| 8929
| 0.572
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os11g0508600|'''''Os-11N3''''']]
|[[Os11g0508600]]
| 5.066
| 7754
| 0.653
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os08g0174500|'''''OsDTH8''''']]
|[[Os08g0174500]]
| 5.017
| 9397
| 0.534
| 3
| 3
| 2015/6/12 17:28
|-
|[[Os03g0267200|'''''sHSP17.7''''']]
|[[Os03g0267200]]
| 5.008
| 7991
| 0.627
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os06g0622700|'''''OsbZIP50 ''''']]
|[[Os06g0622700]]
| 5
| 9868
| 0.507
| 2
| 2
| 2015/6/12 16:19
|-
|'''''[[SBP]]'''''
|
| 4.997
| 4997
| 1
| 1
| 1
| 2013/7/21 18:43
|-
|[[Os05g0465800|'''''PI3K''''']]
|[[Os05g0465800]]
| 4.939
| 4939
| 1
| 1
| 1
| 2014/6/6 16:19
|-
|[[Os10g0491000|'''''BSP''''']]
|[[Os10g0491000]]
| 4.912
| 8991
| 0.546
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os01g0206700|'''''OsCIPK05''''']]
|[[Os01g0206700]]
| 4.909
| 9664
| 0.508
| 2
| 2
| 2015/5/13 15:05
|-
|[[Os06g0643300|'''''RISBZ1''''']]
|[[Os06g0643300]]
| 4.869
| 7953
| 0.612
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os03g0180800|'''''OsTIFY11a''''']]
|[[Os03g0180800]]
| 4.859
| 8158
| 0.596
| 2
| 2
| 2015/6/12 13:04
|-
|'''''[[BPH_gene]]'''''
|
| 4.857
| 4857
| 1
| 2
| 2
| 2014/6/11 11:14
|-
|[[Os01g0805600|'''''CycB1''''']]
|[[Os01g0805600]]
| 4.842
| 4842
| 1
| 1
| 1
| 2014/6/5 18:11
|-
|[[Os06g0701600|'''''HKT''''']]
|[[Os06g0701600]]
| 4.831
| 7482
| 0.646
| 2
| 2
| 2015/6/12 16:25
|-
|[[Os08g0531600|'''''OsSPL16''''']]
|[[Os08g0531600]]
| 4.818
| 4825
| 0.999
| 2
| 2
| 2014/5/27 23:11
|-
|[[Os06g0254700|'''''OsCLO-6''''']]
|[[Os06g0254700]]
| 4.802
| 7514
| 0.639
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os01g0615100|'''''OCPI2''''']]
|[[Os01g0615100]]
| 4.794
| 7379
| 0.65
| 2
| 2
| 2015/5/13 15:19
|-
|'''''[[HSF]]'''''
|
| 4.772
| 4781
| 0.998
| 2
| 2
| 2013/7/21 20:57
|-
|[[Os06g0125800|'''''OsBBI1''''']]
|[[Os06g0125800]]
| 4.629
| 9410
| 0.492
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os07g0628500|'''''OsbHLH1''''']]
|[[Os07g0628500]]
| 4.606
| 8573
| 0.537
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os07g0694700|'''''APX''''']]
|[[Os07g0694700]]
| 4.569
| 8480
| 0.539
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os01g0293100|'''''TIP2''''']]
|[[Os01g0293100]]
| 4.568
| 8480
| 0.539
| 2
| 2
| 2015/5/13 15:12
|-
|'''''[[Rl14]]'''''
|
| 4.564
| 4764
| 0.958
| 2
| 2
| 2014/6/10 11:19
|-
|'''''[[OsRPA2]]'''''
|
| 4.552
| 4552
| 1
| 1
| 1
| 2014/6/6 9:13
|-
|[[Os06g0604000|'''''OsWR2''''']]
|[[Os06g0604000]]
| 4.53
| 8229
| 0.55
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os01g0192000|'''''OsDOS''''']]
|[[Os01g0192000]]
| 4.527
| 4527
| 1
| 1
| 1
| 2015/7/30 23:13
|-
|[[Os01g0922800|'''''OsMADS51''''']]
|[[Os01g0922800]]
| 4.506
| 4506
| 1
| 1
| 1
| 2014/5/24 18:45
|-
|[[Os02g0787300|'''''OsRac1''''']]
|[[Os02g0787300]]
| 4.483
| 6886
| 0.651
| 2
| 2
| 2015/5/14 14:01
|-
|[[Os09g0439200|'''''OsJAZ8''''']]
|[[Os09g0439200]]
| 4.477
| 8745
| 0.512
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0822900|'''''Dwarf1''''']]
|[[Os01g0822900]]
| 4.447
| 7550
| 0.589
| 3
| 4
| 2015/5/13 15:36
|-
|[[Os08g0167500|'''''CRR6''''']]
|[[Os08g0167500]]
| 4.432
| 8906
| 0.498
| 2
| 2
| 2015/6/12 17:27
|-
|'''''[[Sucrose_synthase]]'''''
|
| 4.428
| 4436
| 0.998
| 2
| 2
| 2013/7/18 11:20
|-
|'''''[[CL971152]]'''''
|
| 4.417
| 4472
| 0.988
| 2
| 2
| 2014/6/10 21:51
|-
|[[Os12g0603700|'''''OsCIPK04''''']]
|[[Os12g0603700]]
| 4.375
| 9322
| 0.469
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os02g0618400|'''''OsMPS''''']]
|[[Os02g0618400]]
| 4.347
| 8707
| 0.499
| 2
| 2
| 2015/5/14 13:45
|-
|[[Os03g0182800|'''''OsDERF1''''']]
|[[Os03g0182800]]
| 4.322
| 6519
| 0.663
| 2
| 2
| 2015/6/12 13:05
|-
|'''''[[ARF]]'''''
|
| 4.308
| 4308
| 1
| 1
| 1
| 2013/7/21 20:46
|-
|[[Os03g0183000|'''''OsRAF''''']]
|[[Os03g0183000]]
| 4.286
| 4286
| 1
| 1
| 1
| 2014/6/9 20:10
|-
|[[Os02g0654700|'''''AP59''''']]
|[[Os02g0654700]]
| 4.285
| 8306
| 0.516
| 2
| 2
| 2015/5/14 13:49
|-
|[[Os09g0466400|'''''OsZHD1''''']]
|[[Os09g0466400]]
| 4.265
| 8095
| 0.527
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os03g0103300|'''''qLTG3''''']]
|[[Os03g0103300]]
| 4.188
| 7457
| 0.562
| 2
| 2
| 2015/6/12 12:56
|-
|[[Os01g0834400|'''''OsHAP3A''''']]
|[[Os01g0834400]]
| 4.109
| 4109
| 1
| 1
| 1
| 2014/5/31 19:19
|-
|[[Os07g0512200|'''''OsAtg8''''']]
|[[Os07g0512200]]
| 4.095
| 7690
| 0.533
| 4
| 4
| 2015/6/12 16:43
|-
|'''''[[Bph9]]'''''
|
| 4.084
| 4084
| 1
| 1
| 1
| 2014/6/9 12:23
|-
|[[Os06g0181700|'''''OsWR1''''']]
|[[Os06g0181700]]
| 4.083
| 7433
| 0.549
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os06g0157500|'''''RFT1''''']]
|[[Os06g0157500]]
| 4.013
| 7888
| 0.509
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os09g0537700|'''''OsRNS4''''']]
|[[Os09g0537700]]
| 3.992
| 6731
| 0.593
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os02g0610500|'''''OsCOL4''''']]
|[[Os02g0610500]]
| 3.946
| 3946
| 1
| 1
| 1
| 2014/5/20 11:57
|-
|[[Os07g0529600|'''''OsDR8''''']]
|[[Os07g0529600]]
| 3.915
| 6908
| 0.567
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0106700|'''''AKT1''''']]
|[[Os09g0106700]]
| 3.845
| 6498
| 0.592
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os07g0568700|'''''OsFOR1''''']]
|[[Os07g0568700]]
| 3.845
| 6600
| 0.583
| 2
| 2
| 2015/6/12 16:46
|-
|'''''[[Pik-p]]'''''
|
| 3.816
| 3816
| 1
| 1
| 1
| 2014/6/6 10:16
|-
|[[Os06g0493100|'''''Bphi008a''''']]
|[[Os06g0493100]]
| 3.804
| 7241
| 0.525
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os02g0552700|'''''OsZFP6''''']]
|[[Os02g0552700]]
| 3.779
| 6604
| 0.572
| 2
| 2
| 2015/5/14 13:43
|-
|[[Os12g0100500|'''''COG2267''''']]
|[[Os12g0100500]]
| 3.729
| 5669
| 0.658
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os07g0129200|'''''OsPR1''''']]
|[[Os07g0129200]]
| 3.716
| 6629
| 0.561
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os10g0558900|'''''RL14''''']]
|[[Os10g0558900]]
| 3.699
| 7398
| 0.5
| 5
| 9
| 2015/6/13 16:57
|-
|[[Os01g0177400|'''''ACO1''''']]
|[[Os01g0177400]]
| 3.693
| 6293
| 0.587
| 3
| 3
| 2015/5/13 14:57
|-
|[[Os09g0380200|'''''YLC1''''']]
|[[Os09g0380200]]
| 3.69
| 6890
| 0.536
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os08g0163400|'''''OsSIG1''''']]
|[[Os08g0163400]]
| 3.662
| 3662
| 1
| 1
| 1
| 2014/6/9 20:52
|-
|[[Os09g0396900|'''''OsVIT2''''']]
|[[Os09g0396900]]
| 3.437
| 6527
| 0.527
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g0786400|'''''OsCKX2''''']]
|[[Os03g0786400]]
| 3.372
| 3372
| 1
| 1
| 1
| 2014/5/20 0:08
|-
|'''''[[Bhp-3]]'''''
|
| 3.33
| 3330
| 1
| 1
| 1
| 2014/5/31 23:33
|-
|[[Os07g0641200|'''''OsCCaMK''''']]
|[[Os07g0641200]]
| 3.212
| 6389
| 0.503
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0549600|'''''UDT1''''']]
|[[Os07g0549600]]
| 3.204
| 5875
| 0.545
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os11g0582500|'''''OsC6''''']]
|[[Os11g0582500]]
| 3.13
| 5666
| 0.552
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os03g0135700|'''''RAI1''''']]
|[[Os03g0135700]]
| 3.126
| 3126
| 1
| 1
| 1
| 2014/6/7 0:43
|-
|[[Os09g0459200|'''''SG1''''']]
|[[Os09g0459200]]
| 3.094
| 5090
| 0.608
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os11g0523700|'''''OsICE1''''']]
|[[Os11g0523700]]
| 3.071
| 3079
| 0.997
| 2
| 2
| 2014/6/3 13:41
|-
|[[Os09g0522200|'''''OsDREB1A''''']]
|[[Os09g0522200]]
| 3.031
| 5920
| 0.512
| 3
| 3
| 2015/6/12 22:36
|-
|[[Os06g0127100|'''''OsDREB1C''''']]
|[[Os06g0127100]]
| 3.015
| 5846
| 0.516
| 3
| 3
| 2015/6/12 16:02
|-
|[[Os10g0573400|'''''OsPYL10''''']]
|[[Os10g0573400]]
| 3.009
| 6148
| 0.489
| 4
| 4
| 2015/6/13 16:58
|-
|[[Os01g0274800|'''''CSA''''']]
|[[Os01g0274800]]
| 2.805
| 2805
| 1
| 1
| 1
| 2014/5/28 21:34
|-
|[[BGIOSGA033504|'''''csld4''''']]
|[[BGIOSGA033504]]
| 2.803
| 2818
| 0.995
| 2
| 2
| 2014/6/3 16:43
|-
|[[Os11g0454000|'''''rab16c''''']]
|[[Os11g0454000]]
| 2.786
| 5342
| 0.522
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os10g0148000|'''''OsDIL''''']]
|[[Os10g0148000]]
| 2.697
| 5106
| 0.528
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os08g0566600|'''''PGR5''''']]
|[[Os08g0566600]]
| 2.632
| 4314
| 0.61
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os03g0150200|'''''OsAP23''''']]
|[[Os03g0150200]]
| 2.621
| 5115
| 0.512
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os05g0341600|'''''RAB21''''']]
|[[Os05g0341600]]
| 2.592
| 2640
| 0.982
| 2
| 3
| 2014/6/1 17:02
|-
|[[Os07g0191600|'''''STR2''''']]
|[[Os07g0191600]]
| 2.541
| 2541
| 1
| 1
| 1
| 2014/6/11 19:08
|-
|[[Os11g0208900|'''''xa5''''']]
|[[Os11g0208900]]
| 2.152
| 2152
| 1
| 1
| 1
| 2014/6/8 17:23
|-
|[[Os07g0492000|'''''OsNDPK1''''']]
|[[Os07g0492000]]
| 1.777
| 1777
| 1
| 1
| 1
| 2014/6/9 23:45
|-
|[[Os03g0741100|'''''OsbHLH148''''']]
|[[Os03g0741100]]
| 1.578
| 1578
| 1
| 1
| 1
| 2014/5/19 3:18
|}

Os06g0493100

2017-03-08T06:22:46Z

Xysj1981: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The ''Brown planthopper induced008a'' (''Bphi008a''; AY256682) gene of rice (''Oryza sativa'') enhances the plant’s resistance to the brown planthopper (BPH; ''Nilaparvata lugens''). BPH feeding rapidly initiated the ethylene (ET) signaling pathway and up-regulated ''Bphi008a'' transcript levels after 6 to 96 h of feeding. In contrast, blocking ethylene transduction (using 1-methylcyclopropene) reduced ''Bphi008a'' transcript levels in wild-type plants fed upon by BPH. Because ''Bphi008a'' is a downstream gene of the Et signaling pathway in rice. The overexpressed (OE) plants had greater resistance to the BPH than wildtype plants (Fig. 1wD). In contrast, the change in susceptibility of rice to the BPH caused by RNAi of ''Bphi008a'' was not obvious. The level of ''Bphi008a'' expression affects BPH feeding on the phloem of rice (Fig. 1wE). The ''Bphi008a'' expression enhances rice resistance to the BPH by impairing BPH feeding (Fig.1wF). The ''Bphi008a'' can be phosphorylated by rice Mitogen-activated Protein Kinase5 (OsMPK5). Yeast two-hybrid assays demonstrated that the carboxyl-terminal proline-rich region of ''Bphi008a'' interacts directly with this kinase, and this interaction occurs in the nucleus. Subsequently, we found that ''Bphi008a'' up-regulation and down-regulation were accompanied by different changes in transcription levels of OsMPK5, OsMPK12, OsMPK13, and OsMPK17 in transgenic plants (Fig. 2w). Immunoblot analysis also showed that the OsMPK5 protein level increased in overexpressing plants and decreased in RNA interference plants after BPH feeding(Fig. 3w, A and B). The ''Bphi008a'' Overexpression Enhances Levels of AP2/ERF Transcription Factors and Defense-Related Genes. Yeast two-hybrid screening results showed that a clear interaction between ''Bphi008a''and a b-ZIP transcription factor (OsbZIP60), but a weak interaction between ''Bphi008a'' and a RNA polymerase polypeptide (SDRP) (Fig. 4wB). Furthermore, analysis of OsbZIP60 expression levels in wild-type and transgenic plants after BPH feeding from 0 to 96 h (Fig. 4wD) indicated that ''Bphi008a'' (possibly phosphorylated) might form a transcriptional complex with OsbZIP60 and SDRP in vivo that activates the transcription of target genes.<ref name="ref1" />

===Expression===
In a previous study, ''Bphi008a'' expression was found to be induced by both BPH feeding and spraying plants with ethephon, which slowly releases Et.<ref name="ref2" />.In rice, a large gene family controls Et biosynthesis, composed of six 1-aminocyclopropane-1-carboxylic acid (ACC) synthase genes (designated OsACS1–OsACS6) and
seven ACC oxidase genes (designated OsACO1–OsACO7)<ref name="ref3" /><ref name="ref4" />. Experimental results indicate that Bphi008a transcription is stimulated by active Et(Fig. 5w).Bphi008a expression levels were highest in the roots of seedlings, followed (in order) by leaf blades and leaf sheaths at the heading stage, then leaf sheaths, leaf blades, and stems of seedlings. The lowest detected level of Bphi008a expression was in the flowers (Fig. 6w).

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
State Key Laboratory of Hybrid Rice, College of Life Sciences, Wuhan University, China.

College of Life Sciences, Xinyang Normal University, China.

==References==
<references>
<ref name="ref1">Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.
</ref>
<ref name="ref2">Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.
</ref>
<ref name="ref3">Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189.
</ref>
<ref name="ref4">Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215.
</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 6]]
[[Category:Chromosome 6]]

Os06g0493100

2017-03-08T06:22:36Z

Xysj1981:

Please input one-sentence summary here.

==Annotated Information==
===Function===
The ''Brown planthopper induced008a'' (''Bphi008a''; AY256682) gene of rice (''Oryza sativa'') enhances the plant’s resistance to the brown planthopper (BPH; ''Nilaparvata lugens''). BPH feeding rapidly initiated the ethylene (ET) signaling pathway and up-regulated ''Bphi008a'' transcript levels after 6 to 96 h of feeding. In contrast, blocking ethylene transduction (using 1-methylcyclopropene) reduced ''Bphi008a'' transcript levels in wild-type plants fed upon by BPH. Because ''Bphi008a'' is a downstream gene of the Et signaling pathway in rice. The overexpressed (OE) plants had greater resistance to the BPH than wildtype plants (Fig. 1wD). In contrast, the change in susceptibility of rice to the BPH caused by RNAi of ''Bphi008a'' was not obvious. The level of ''Bphi008a'' expression affects BPH feeding on the phloem of rice (Fig. 1wE). The ''Bphi008a'' expression enhances rice resistance to the BPH by impairing BPH feeding (Fig.1wF). The ''Bphi008a'' can be phosphorylated by rice Mitogen-activated Protein Kinase5 (OsMPK5). Yeast two-hybrid assays demonstrated that the carboxyl-terminal proline-rich region of ''Bphi008a'' interacts directly with this kinase, and this interaction occurs in the nucleus. Subsequently, we found that ''Bphi008a'' up-regulation and down-regulation were accompanied by different changes in transcription levels of OsMPK5, OsMPK12, OsMPK13, and OsMPK17 in transgenic plants (Fig. 2w). Immunoblot analysis also showed that the OsMPK5 protein level increased in overexpressing plants and decreased in RNA interference plants after BPH feeding(Fig. 3w, A and B). The ''Bphi008a'' Overexpression Enhances Levels of AP2/ERF Transcription Factors and Defense-Related Genes. Yeast two-hybrid screening results showed that a clear interaction between ''Bphi008a''and a b-ZIP transcription factor (OsbZIP60), but a weak interaction between ''Bphi008a'' and a RNA polymerase polypeptide (SDRP) (Fig. 4wB). Furthermore, analysis of OsbZIP60 expression levels in wild-type and transgenic plants after BPH feeding from 0 to 96 h (Fig. 4wD) indicated that ''Bphi008a'' (possibly phosphorylated) might form a transcriptional complex with OsbZIP60 and SDRP in vivo that activates the transcription of target genes.<ref name="ref1" />[[File:Fig.1w.png]][[File:Fig.2w.png]]

===Expression===
In a previous study, ''Bphi008a'' expression was found to be induced by both BPH feeding and spraying plants with ethephon, which slowly releases Et.<ref name="ref2" />.In rice, a large gene family controls Et biosynthesis, composed of six 1-aminocyclopropane-1-carboxylic acid (ACC) synthase genes (designated OsACS1–OsACS6) and
seven ACC oxidase genes (designated OsACO1–OsACO7)<ref name="ref3" /><ref name="ref4" />. Experimental results indicate that Bphi008a transcription is stimulated by active Et(Fig. 5w).Bphi008a expression levels were highest in the roots of seedlings, followed (in order) by leaf blades and leaf sheaths at the heading stage, then leaf sheaths, leaf blades, and stems of seedlings. The lowest detected level of Bphi008a expression was in the flowers (Fig. 6w).

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
State Key Laboratory of Hybrid Rice, College of Life Sciences, Wuhan University, China.

College of Life Sciences, Xinyang Normal University, China.

==References==
<references>
<ref name="ref1">Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.
</ref>
<ref name="ref2">Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.
</ref>
<ref name="ref3">Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189.
</ref>
<ref name="ref4">Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215.
</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 6]]
[[Category:Chromosome 6]]

Os02g0552700

2017-03-08T06:22:12Z

Xysj1981:

Please input one-sentence summary here.

==Annotated Information==
===Function===
This gene encodes a novel CCHC-type zinc finger pronein called OsZFP6. OsZFP6 is structurally and functionally conserved, mainly localised in nucleus, and can play an important role in stress tolerance responses to salt (NaCl), alkali (NaHCO3), and H2O2 treatment in rice. Functional analysis also showed overexpression of this gene in transgenic Arabidopsis and yeast to NaHCO3 and H2O2.

Fig. 1. OsZFP6 expression after treatment with 150 mM NaCl, 60 mM NaHCO3, or 5 mM H2O2 for 0, 12, 24, and 48 h, respectively. Bars with different letters showed significant differences at P < 0.01 (Means ± SD, n = 6).

===Construction===
Sequencing results confirmed that the OsZFP6 sequence was identical to Os02g0552700. The OsZFP6 gene is a single-copy gene in the rice genome. It is 1559 bp in length with a 458 bp 5' UTR and a 186 bp 3' UTR. The ORF encodes a 304 amino acid with a molecular weight of 33.6 kDa and an isoelectric point of 7.35. Based on structural properties indicated by the SMART programs, the predicted protein contains two conserved domains: a Pfam retrotrans-gag domain from amino acid 48 to 146 and a ZnF C2HC domain from amino acid 216 to 232.

===Expression===
Using the online analysis tool Psort to predict the subcellular localisation of rice OsZFP6, OsZFP6 was localised to the nucleus with a 73.9% probability. To validate the predicted result, a PBI121-OsZFP6:GFP plasmid was transformed into onion epidermal cells. After culture for 18-24 h in the dark, green fluorescence was observed in the nucleus (as shown in figure), suggesting the OsZFP6 protein, driven by the 35S promoter, was localized in the nucleus.
Tissue distribution of OsZFP6 gene expression is still unknown yet.

===Evolution===
The CysCysHisCys (CCHC)-type zinc finger domains contain the sequence C-X2-C-X4-H-X4-C, where X can be any amino acid, and the numbers indicate the number of residues. This domain is conserved in Arabidopsis, yeast and rice, as shown in table.

==Labs working on this gene==
Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin, Heilongjiang 150081, China.

==References==
Guan QJ, Wang LF, Bu QY, Wang ZY. (2014) The rice gene OsZFP6 functions in multiple stress tolerance responses in yeast and Arabidopsis. Plant Physiol Bioch 82: 1-8.

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 2]]
[[Category:Chromosome 2]]

Os07g0129200

2017-03-08T06:21:25Z

Xysj1981:

Please input one-sentence summary here.

==Annotated Information==
===Function===
Pathogenesis-related proteins(PR) have production/accumulation represents an essential component of the active plant defence repertoire.And they have been used as markers of plant defense responses.The dicot PR1 are recognized as reliable marker genes in defence/stress responses[http://ac.els-cdn.com/S098194280101333X/1-s2.0-S098194280101333X-main.pdf?_tid=63c95770-e4c3-11e3-8966-00000aab0f26&acdnat=1401101539_8905c05f1e1ed53663506bdbbcdfa6eb].

They are defined as plant proteins that are induced specifically in pathological or related situations.

Activation of OsPR1 genes is an important part of the defence/stress response(s) in rice.

===Expression===
The responses of individual genes to salicylic acid, jasmonic acid, and ethylene induced defense signaling pathways in rice are likely to be different from those in dicot plants. Transcript levels in healthy leaves, roots, and flowers varied according to each gene[http://www.ncbi.nlm.nih.gov/pubmed/18247056].

OsPR1a and OsPR1b genes were primarily characterized against jasmonic acid, ethylene and protein phosphatase 2A inhibitors. The dicot PR1 are recognized as reliable marker genes in defence/stress responses.SA, ABA and H2O2 up-regulate the expression of OsPR1a and OsPR1b genes(fig1)

===Evolution===
Alignment of the deduced rice PR1 protein sequence (OsPR1a) with homologous sequences(fig3). The most homologous monocot sequences were identified by database searches with the Blast algorithm, whereas the Arabidopsis thaliana and tobacco sequences are shown as examples of dicot PR1 genes.An arrowhead indicates the putative processing site and boxes indicate the consensus regions I and II. Asterisks represent identical amino acid residues and dashes indicate gaps introduced to optimize alignment.

==Labs working on this gene==
* Research Laboratory for Agricultural Biotechnology and Biochemistry (RLABB), Kathmandu, GPO Box 8207, Nepal
* Department of Agricultural Biology, College of Agriculture and Life Science, Seoul National University
* Core Research for Evolutional Science and Technology (CREST), Honcho 4-1-8, Kawaguchi, Saitama 332, Japan
* National Institute of Agrobiological Sciences (NIAS), Kannon-dai 2-1-2, Tsukuba, Ibaraki, 305-8602, Japan

==References==
[1]Kamrun Nahar, Tina Kyndt, David De Vleesschauwer, Monica Hö, fte, Godelieve Gheysen.The Jasmonate Pathway Is a Key Player in Systemically Induced Defense against Root Knot Nematodes in Rice.Plant Physiology, 2011, 157(1): 305-316

[2]Ichiro Mitsuhara; Takayoshi Iwai; Shigemi Seo; Yuki Yanagawa; Hiroyuki Kawahigasi; Sakino Hirose; Yasunobu Ohkawa; Yuko Ohashi.Characteristic expression of twelve rice PR1 family genes in response to pathogen infection, wounding, and defense-related signal compounds (121/180).Molecular Genetics and Genomics, 2008, 279(4): 415-427 DOI: 10.1007/s00438-008-0322-9

[3]Ganesh Kumar Agrawal; Nam-Soo Jwa; Randeep Rakwal.A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones, and Protein Phosphatase Inhibitors.Biochemical and Biophysical Research Communications, 2000, 274(1): 157-165

[4]Ganesh Kumar Agrawala§, Randeep Rakwalb§‡*, Nam-Soo Jwac, Vishwanath Prasad Agrawala.Signalling molecules and blast pathogen attack activates rice OsPR1a and OsPR1b genes: A model illustrating omponents participating during defence/stress response.Plant Physiol. Biochem. 39 (2001) 1095−1103

[5]Ganesh Kumar Agrawal,*,1 Nam-Soo Jwa,† and Randeep Rakwal. A Novel Rice (Oryza sativa L.) Acidic PR1 Gene Highly Responsive to Cut, Phytohormones,and Protein Phosphatase Inhibitors. Biochemical and Biophysical Research Communications 274, 157–165 (2000)

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

Os10g0558900

2017-03-08T06:20:27Z

Xysj1981:

Please input one-sentence summary here.

==Annotated Information==
===Function===

As an important agronomic trait, leaf rolling in rice (Oryza sativa L.) has attracted much attention from plant biologists and breeders. Moderate leaf rolling increases the amount of photosynthesis in cultivars and hence raises grain yield.
RL14 (rolling leaf 14) regulates leaf rolling, which is found to encode a 2OG-Fe (II) oxygenase of unknown function. the RL14 gene affects water transport in leaves by affecting the composition of the secondary cell wall. This change in water transport results in water deficiency, which is the major reason for the abnormal shape of the bulliform cells.
RL14 mutant plants displayed smaller stomatal complexes and decreased transpiration rates, as compared with the wild type. Defective development could be rescued functionally by the expression of wild-type RL14.

===Expression===

Histochemistry, as well as qRT-PCR analysis, showed that RL14 was highly transcribed in leaves, leaf sheaths and roots. It was also detected in stems and glumes, although its expression in these organs was not as intense as that in the mature leaves, leaf sheaths and roots (Figure 1b).
Expression of RL14 mRNA was detected in the sclerenchymal cell layer of underemerged leaves and sheaths. In the mature leaf, RL14 mRNA accumulated mainly in the mesophyll cells that surrounded the vasculature (Figure 1c).Independent transgenic lines were identified through qRT-PCR analysis of RL14 expression using primers that matched sequences in the coding region. The results showed that the expression of RL14 was restored to the WT level in the transgenic plants.Comparison with the corresponding genomic sequence revealed that the RL14 gene consisted of three exons and two introns, and the coding sequence was 834-bp long and encoded a protein of 278 amino acids (Figure 2a). Protein sequence analysis revealed that the RL14 protein had a 2OG-Fe(II) oxygenase domain(amino acids 128–228).

===Evolution===

The RL14 gene was mapped first to an interval between the simple sequence repeat (SSR) markers RM3123 and RM1162 on the long arm of chromosome 10.
Finally, the RL14 locus was mapped to a 24.5-kb DNA region between the InDel marker SID2 and SSR marker SW24 on a single bacterial artificial chromosome, AC079874.
Four annotated candidate genes, which encoded a polyol transporter (Os10g40950.1), a 2OG-Fe (II) oxygenase family protein (Os10g40960.1), a flavonol synthase (Os10g40990.1) and a retrotransposon protein (Os10g41000), were located in the 24.5-kb DNA region.
RL14 was related most closely to members of the 2OG-Fe (II) oxygenase family from rice and sorghum (Figure 2b). Orthologous of RL14 was identified in other species, such as maize, Arabidopsis, Papaver somniferum, Vitis spp and Ricinus communis (Figure 2b).

==Labs working on this gene==
Rice Research Institute, Chongqing Key Laboratory of Application and Safety Control of Genetically Modified Crops, Southwest University, Chongqing, China.
==References==
Fang L, Zhao F, Cong Y, et al. Rolling‐leaf14 is a 2OG‐Fe (II) oxygenase family protein that modulates rice leaf rolling by affecting secondary cell wall formation in leaves[J]. Plant biotechnology journal, 2012, 10(5): 524-532.

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]
==Structured Information==

Os09g0380200

2017-03-08T06:19:52Z

Xysj1981: /* Labs working on this gene */

The rice '''''Os09g0380200''''' was reported as '''''ylc1''''' in 2013 <ref name="ref1" /> by researchers from China.

==Annotated Information==
[[File:198-Os09g0380200.png|right|thumb|427px|'''Figure 8.''' ''Subcellular localization of YLC1, ylc1 and truncated YLC1s in rice protoplasts..<ref name="ref1" />.'']]
===Gene Symbol===
*'''''Os09g0380200''''' '''''<=>''''' '''''OsYCL1''''','''''ylc1'''''
===Function===
* The Young Leaf Chlorosis 1 ('''''YLC1''''') gene was isolated via map-based cloning and identified to encode a protein of unknown function belonging to the DUF3353 superfamily.
* The rice'''''OsYLC1''''' may be involved in Chl and lutein accumulation and chloroplast development at early leaf development in rice.
===Phenotypic analysis===
* The researchers characterized a rice mutant named young leaf chlorosis 1 (ylc1) from a 60 Co-irradiated population.
* Young leaves of the ylc1 mutant showed decreased levels of Chl and lutein compared to those of wild type, and transmission electron microscopy analysis revealed that the thylakoid lamellar structures were obviously loosely arranged.
* Whereas, the mutant turns green gradually and approaches normal green at the maximum tillering stage.

===Subcellular localization===
* Subcellular localization analysis in rice protoplasts demonstrated that the first 50 N-terminal amino acid residues are essential and sufficient for the protein localization to the chloroplast.

==Labs working on this gene==
* National Key Laboratory for Crop Genetics and Germplasm Enhancement, Jiangsu Plant Gene Engineering Research Center, Nanjing Agricultural University, Nanjing 210095, China
* National Key Facility for Crop Gene Resources and Genetic Improvement, Institute of Crop Science, Chinese Academy of Agricultural Sciences, Beijing 100081, China

==References==
<references>
<ref name="ref1"> Kunneng Zhou;Yulong Ren;Jia Lv;Yihua Wang;Feng Liu;Feng Zhou;Shaolu Zhao;Saihua Chen;Cheng Peng;Xin Zhang;Xiuping Guo;Zhijun Cheng;Jiulin Wang;Fuqing Wu;Ling Jiang;Jianmin Wan. Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lutein accumulation during early leaf development in rice. Planta, 2013, 237(1): 279-292 </ref>
</references>
==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 9]]
[[Category:Chromosome 9]]

Os08g0163400

2017-03-08T06:19:38Z

Xysj1981:

RAP-DB：Os08g0163400 have an another name :OsSIG1..<ref name="ref2" />

==Annotated Information==
===Function===
Sigma factors encoded by the nucleus of plants confer promoter specificity on the bacterial-type RNA polymerase in chloroplasts. We previously showed that transcripts of OsSIG1, which encodes one such sigma factor in rice, accumulate relatively late during leaf development. We have now isolated and characterized two allelic mutants of OsSIG1, in which OsSIG1 is disrupted by insertion of the retrotransposon Tos17, in order to characterize the functions of OsSIG1. The OsSIG1)/) plants were found to be fertile but they manifested an approximately one-third reduction in the chlorophyll content of mature leaves. Quantitative RT-PCR and northern blot analyses of chloroplast gene expression revealed that the abundance of transcripts derived from the psaA operon was markedly reduced in OsSIG1)/) plants compared with that in wild-type homozygotes. This effect was accompanied by a reduction in the abundance of the core protein complex (PsaA–PsaB) of photosystem I. Analysis of chlorophyll fluorescence also revealed a substantial reduction in the rate of electron transfer from photosystem II to photosystem I in the OsSIG1 mutants. Our results thus indicate that OsSIG1 plays an important role in the maintenance of photosynthetic activity in mature chloroplasts of rice by regulating expression of chloroplast genes for components of photosystem I..<ref name="ref1" />

===Expression===
We isolated and characterized two rice nuclear genes, OsSIG2A and OsSIG2B, encoding the putative sigma-factor of the plastid RNA polymerase. Deduced protein sequences predicted a plastid-localizing signal in the N-terminus and subsequent polypeptides similar to known SIG2 proteins. Gene expression analysis revealed that the OsSIG2A transcript is more abundant than the OsSIG2B transcript in all tissues tested and that both rice SIG2s are expressed from earlier stages of leaf development than that in the case of OsSIG1. These results indicate differential expression of SIG genes in leaf morphogenesis, suggesting the existence of tissue- and stage-specific functions of SIG proteins for transcriptional regulation of chloroplast genes in plant development.<ref name="ref3" />

We previously showed that the maximal level of OsSIG1 expression occurs at a later stage of leaf development than does that of OsSIG2A or OsSIG2B expression (Kasai et al., 2004). To characterize further the expression of OsSIG1, we performed northern analysis with total RNA isolated from three portions of the expanded leaves of 20-day-old Nipponbare (WT) plants. The amount of OsSIG1 mRNA was highest in the middle region of the leaf blades (Figure 2)<ref name="ref1" />

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
1 Cell-Free Science and Technology Research Center, Ehime University, Matsuyama 790-8577, Japan,

2 Experimental Farm, Kyoto University, Takatsuki, Osaka 569-0096, Japan,

3 The Venture Business Laboratory, Ehime University, Matsuyama 790-8577, Japan,

4 Department of Integrated Biosciences, University of Tokyo, Kashiwa, Chiba 277-8562, Japan,

5 Institute for Advanced Biosciences, Keio University, Tsuruoka, Yamagata 997-0017, Japan,

6 National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan

==References==
<references>
<ref name="ref1"> Tozawa, Y, Masayoshi Teraishi., et al. (2007). "The plastid sigma factor SIG1 maintains photosystem I activity via regulated expression of the psaA operon in rice chloroplasts." The Plant Journal 52(1): 124-132.</ref>
<ref name="ref2"> http://www.ricedata.cn/gene/list/1260.htm</ref>
<ref name="ref3">Kasai K , Kawagishi-Kobayashi M ., et al. (2004). "Differential expression of three plastidial sigma factors, OsSIG1, OsSIG2A, and OsSIG2B, during leaf development in rice.." Biosci Biotechnol Biochem 2004 Apr;68 (4):973-7.</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 8]]
[[Category:Chromosome 8]]

RiceWiki:Curated Genes

2017-03-08T06:18:51Z

Xysj1981:

{|class="wikitable sortable" style="width:90%;text-align:center"
|-
!'''Gene Symbol'''
!'''RAP-DB-ID'''
!'''Total Contribution Score'''
!'''Summed Edit Quantity'''
!'''Averaged Edit Quality'''
!'''Contributor Count'''
!'''Edit Count*'''
!'''Last Edit Time'''
|-
|[[Os09g0114500|'''''BC12''''']]
|[[Os09g0114500]]
| 14.854
| 23746
| 0.626
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os10g0405500|'''''PAIR3''''']]
|[[Os10g0405500]]
| 10.742
| 10877
| 0.988
| 3
| 3
| 2014/6/8 23:39
|-
|[[Os09g0286400|'''''OsNHX5''''']]
|[[Os09g0286400]]
| 12.133
| 24113
| 0.503
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0306400|'''''OsbZIP71''''']]
|[[Os09g0306400]]
| 7.71
| 12551
| 0.614
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0417600|'''''OsWRKY76''''']]
|[[Os09g0417600]]
| 5.713
| 10209
| 0.56
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os09g0434200|'''''OsDSG1''''']]
|[[Os09g0434200]]
| 5.792
| 11879
| 0.488
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os10g0553300|'''''OsTPP2''''']]
|[[Os10g0553300]]
| 8.403
| 35721
| 0.235
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os10g0563600|'''''OsMSRA4.1''''']]
|[[Os10g0563600]]
| 7.778
| 13380
| 0.581
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0127600|'''''ONAC045''''']]
|[[Os11g0127600]]
| 7.065
| 12576
| 0.562
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os11g0648000|'''''OsNHX3''''']]
|[[Os11g0648000]]
| 7.638
| 15767
| 0.484
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os12g0569700|'''''OsHsp23.7''''']]
|[[Os12g0569700]]
| 6.412
| 13859
| 0.463
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os12g0583700|'''''ZFP252''''']]
|[[Os12g0583700]]
| 8.489
| 12862
| 0.66
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os08g0139000|'''''OsDEG10''''']]
|[[Os08g0139000]]
| 4.811
| 9008
| 0.534
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os08g0323700|'''''OsCCC1''''']]
|[[Os08g0323700]]
| 6.709
| 11315
| 0.593
| 2
| 2
| 2015/6/12 17:29
|-
|[[Os08g0441100|'''''OsCIPK06''''']]
|[[Os08g0441100]]
| 3.819
| 7418
| 0.515
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os08g0504700|'''''OsSAP11''''']]
|[[Os08g0504700]]
| 7.149
| 10763
| 0.664
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0540400|'''''OsCPK21''''']]
|[[Os08g0540400]]
| 10.561
| 19732
| 0.535
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os08g0546800|'''''OsHsfB2b''''']]
|[[Os08g0546800]]
| 12.399
| 23039
| 0.538
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os07g0186000|'''''OsTRXh1''''']]
|[[Os07g0186000]]
| 7.817
| 12275
| 0.637
| 2
| 2
| 2015/6/12 16:34
|-
|[[Os07g0556800|'''''OSRIP18''''']]
|[[Os07g0556800]]
| 8.473
| 12924
| 0.656
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os07g0666900|'''''OsNHX1''''']]
|[[Os07g0666900]]
| 11.455
| 21522
| 0.532
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0678600|'''''OsCIPK2''''']]
|[[Os07g0678600]]
| 5.575
| 11240
| 0.496
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0693800|'''''OsFAD8''''']]
|[[Os07g0693800]]
| 5.613
| 11290
| 0.497
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os06g0130100|'''''OsSIK1''''']]
|[[Os06g0130100]]
| 11.48
| 22964
| 0.5
| 2
| 2
| 2015/6/12 16:04
|-
|[[Os06g0472000|'''''OsMSRB1.1''''']]
|[[Os06g0472000]]
| 6.592
| 12098
| 0.545
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os06g0561000|'''''OsMIOX''''']]
|[[Os06g0561000]]
| 6.249
| 12468
| 0.501
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os06g0603600|'''''OsSPX1''''']]
|[[Os06g0603600]]
| 7.774
| 15383
| 0.505
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os06g0612800|'''''OsiSAP8''''']]
|[[Os06g0612800]]
| 8.934
| 14002
| 0.638
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0644200|'''''OVP1''''']]
|[[Os06g0644200]]
| 10.007
| 15443
| 0.648
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0651100|'''''YK1''''']]
|[[Os06g0651100]]
| 8.803
| 18547
| 0.475
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0662200|'''''OsbZIP52''''']]
|[[Os06g0662200]]
| 6.942
| 12388
| 0.56
| 2
| 2
| 2015/6/12 16:22
|-
|[[Os06g0727200|'''''OsCATB''''']]
|[[Os06g0727200]]
| 6.864
| 13184
| 0.521
| 2
| 2
| 2015/6/12 16:27
|-
|[[Os03g0117900|'''''HYR''''']]
|[[Os03g0117900]]
| 5.381
| 8815
| 0.61
| 2
| 2
| 2015/6/12 12:59
|-
|[[Os09g0457900|'''''OsEATB''''']]
|[[Os09g0457900]]
| 42.219
| 42219
| 1
| 1
| 1
| 2014/6/6 14:12
|-
|[[Os06g0208800|'''''LYP6''''']]
|[[Os06g0208800]]
| 35.205
| 40853
| 0.862
| 2
| 2
| 2015/6/12 16:09
|-
|[[Os11g0587000|'''''DWARF27''''']]
|[[Os11g0587000]]
| 31.862
| 34044
| 0.936
| 2
| 4
| 2014/6/9 2:23
|-
|'''''[[GW5]]'''''
|
| 31.812
| 31817
| 1
| 2
| 2
| 2014/6/8 22:47
|-
|[[Os03g0122600|'''''OsMADS50''''']]
|[[Os03g0122600]]
| 31.778
| 36672
| 0.867
| 2
| 2
| 2015/6/12 13:00
|-
|'''''[[Du1]]'''''
|
| 26.789
| 26797
| 1
| 2
| 2
| 2014/6/5 11:51
|-
|[[Os01g0771200|'''''XB24''''']]
|[[Os01g0771200]]
| 25.112
| 106499
| 0.236
| 3
| 14
| 2015/5/13 15:32
|-
|'''''[[IPA1]]'''''
|
| 22.636
| 22636
| 1
| 1
| 1
| 2014/6/1 14:57
|-
|'''''[[AB013448]]'''''
|
| 21.65
| 21650
| 1
| 1
| 1
| 2014/6/8 17:24
|-
|[[Os10g0542100|'''''MT''''']]
|[[Os10g0542100]]
| 21.515
| 25382
| 0.848
| 3
| 3
| 2015/6/13 16:56
|-
|'''''[[MADS]]'''''
|
| 21.305
| 21310
| 1
| 3
| 3
| 2014/6/7 19:11
|-
|'''''[[MYB]]'''''
|
| 21.082
| 21418
| 0.984
| 2
| 2
| 2013/7/16 10:48
|-
|[[Os09g0272900|'''''PB''''']]
|[[Os09g0272900]]
| 21.033
| 24405
| 0.862
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os01g0848400|'''''qSH1''''']]
|[[Os01g0848400]]
| 20.688
| 31733
| 0.652
| 2
| 2
| 2015/5/13 15:40
|-
|[[Os09g0441900|'''''OsDEP1''''']]
|[[Os09g0441900]]
| 18.815
| 18855
| 0.998
| 5
| 5
| 2014/6/11 0:23
|-
|[[Os09g0240200|'''''CONSTANS''''']]
|[[Os09g0240200]]
| 18.077
| 26433
| 0.684
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os04g0271200|'''''SRT701''''']]
|[[Os04g0271200]]
| 18.041
| 18413
| 0.98
| 5
| 9
| 2014/6/10 16:01
|-
|[[Os01g0678500|'''''OsTPC1''''']]
|[[Os01g0678500]]
| 17.989
| 29118
| 0.618
| 6
| 7
| 2015/5/13 15:24
|-
|[[Os03g0332400|'''''OsGLYII-2''''']]
|[[Os03g0332400]]
| 17.603
| 17603
| 1
| 1
| 1
| 2014/12/27 21:46
|-
|[[Os06g0196700|'''''OsARF16'''''']]
|[[Os06g0196700]]
| 17.411
| 28849
| 0.604
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os07g0261200|'''''Ghd7''''']]
|[[Os07g0261200]]
| 17.077
| 17414
| 0.981
| 2
| 2
| 2014/6/1 17:56
|-
|'''''[[Xa7]]'''''
|
| 16.58
| 16580
| 1
| 1
| 1
| 2014/5/30 14:34
|-
|[[Os03g0227700|'''''OsDWARF4''''']]
|[[Os03g0227700]]
| 16.238
| 28577
| 0.568
| 4
| 6
| 2015/6/12 13:36
|-
|'''''[[Pb1]]'''''
|
| 15.987
| 15987
| 1
| 1
| 1
| 2014/6/3 15:06
|-
|[[Os12g0597000|'''''CBL''''']]
|[[Os12g0597000]]
| 15.897
| 25737
| 0.618
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os01g0841500|'''''OsMYB3R2''''']]
|[[Os01g0841500]]
| 15.635
| 27885
| 0.561
| 3
| 4
| 2015/5/13 15:39
|-
|[[Os01g0182600|'''''GI''''']]
|[[Os01g0182600]]
| 14.75
| 22705
| 0.65
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os08g0162100|'''''ASP1''''']]
|[[Os08g0162100]]
| 14.743
| 14743
| 1
| 1
| 1
| 2015/6/12 17:26
|-
|[[Os02g0738900|'''''OsDRP2B''''']]
|[[Os02g0738900]]
| 14.365
| 21439
| 0.67
| 2
| 2
| 2015/5/14 13:58
|-
|[[Os06g0594600|'''''OsAt10''''']]
|[[Os06g0594600]]
| 14.147
| 19008
| 0.744
| 3
| 4
| 2015/6/12 16:17
|-
|[[Os01g57340|'''''Npi37''''']]
|[[Os01g57340]]
| 14.08
| 14080
| 1
| 1
| 1
| 2014/5/27 20:22
|-
|[[Os01g0718300|'''''OsBRI1''''']]
|[[Os01g0718300]]
| 14.008
| 25923
| 0.54
| 3
| 3
| 2015/5/13 15:26
|-
|'''''[[Du2]]'''''
|
| 13.964
| 13964
| 1
| 2
| 2
| 2014/6/5 11:53
|-
|'''''[[OsMYB103L]]'''''
|
| 13.96
| 13960
| 1
| 1
| 1
| 2014/6/11 16:14
|-
|[[Os01g0782100|''''' Pi-sh''''']]
|[[Os01g0782100]]
| 13.897
| 27151
| 0.512
| 3
| 3
| 2015/5/13 15:34

|-
|[[Os06g0706400|'''''OsPTR9''''']]
|[[Os06g0706400]]
| 13.739
| 20020
| 0.686
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os08g0398400|'''''OsHIR1''''']]
|[[Os08g0398400]]
| 13.721
| 13748
| 0.998
| 3
| 6
| 2014/6/3 16:40
|-
|[[Os02g0141300|'''''CAP1''''']]
|[[Os02g0141300]]
| 13.71
| 28137
| 0.487
| 5
| 10
| 2015/5/14 13:21
|-
|[[Os07g0214100|'''''RAG1''''']]
|[[Os07g0214100]]
| 13.62
| 31302
| 0.435
| 2
| 2
| 2015/6/12 16:36
|-
|'''''[[DWT1]]'''''
|
| 13.275
| 13275
| 1
| 1
| 1
| 2014/5/31 12:55
|-
|[[Os01g0797600|'''''OsERF3''''']]
|[[Os01g0797600]]
| 13.247
| 13247
| 1
| 1
| 1
| 2014/5/25 15:17
|-
|[[Os01g0883800|'''''semidwarf-1''''']]
|[[Os01g0883800]]
| 13.17
| 24896
| 0.529
| 16
| 41
| 2016/6/17 17:22
|-
|[[Os08g0524100|'''''OsSRT1''''']]
|[[Os08g0524100]]
| 13.001
| 18711
| 0.695
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os08g0559300|'''''SPINDLY''''']]
|[[Os08g0559300]]
| 12.718
| 21018
| 0.605
| 3
| 6
| 2015/6/12 17:35
|-
|[[Os11g0225300|'''''PAMP''''']]
|[[Os11g0225300]]
| 12.691
| 23520
| 0.54
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os07g0155600|'''''OsEIN2''''']]
|[[Os07g0155600]]
| 12.605
| 18316
| 0.688
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os01g0607200|'''''OsBAT1''''']]
|[[Os01g0607200]]
| 12.553
| 19986
| 0.628
| 2
| 2
| 2015/5/13 15:17
|-
|[[Os07g0616800|'''''SUS''''']]
|[[Os07g0616800]]
| 12.42
| 26693
| 0.465
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os12g0102400|'''''OsRINGC2-2''''']]
|[[Os12g0102400]]
| 12.278
| 17739
| 0.692
| 3
| 3
| 2015/6/13 17:13
|-
|'''''[[WRKY]]'''''
|
| 12.226
| 12233
| 0.999
| 2
| 2
| 2014/5/31 12:44
|-
|[[Os10g0536100|'''''OsMADS50''''']]
|[[Os10g0536100]]
| 11.96
| 19080
| 0.627
| 3
| 3
| 2015/6/13 16:52
|-
|[[Os02g0725900|'''''HAP3''''']]
|[[Os02g0725900]]
| 11.931
| 16469
| 0.724
| 2
| 2
| 2015/5/14 13:55
|-
|[[Os01g0626400|'''''OsWRKY11''''']]
|[[Os01g0626400]]
| 11.902
| 18881
| 0.63
| 2
| 2
| 2015/5/13 15:20
|-
|[[Os01g0726400|'''''CFO1''''']]
|[[Os01g0726400]]
| 11.891
| 17625
| 0.675
| 2
| 2
| 2015/5/13 15:27
|-
|[[Os09g0422500|'''''OsCESA9''''']]
|[[Os09g0422500]]
| 11.747
| 23511
| 0.5
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os09g0250700|'''''OsABC1-12''''']]
|[[Os09g0250700]]
| 11.742
| 15681
| 0.749
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os06g0701300|'''''OsABC1-8''''']]
|[[Os06g0701300]]
| 11.604
| 15691
| 0.74
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0126400|'''''OsCPK4''''']]
|[[Os02g0126400]]
| 11.6
| 22962
| 0.505
| 2
| 2
| 2015/5/14 13:20
|-
|[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]
|[[Os06g0570100]]
| 11.586
| 15710
| 0.737
| 3
| 3
| 2015/6/12 16:16
|-
|[[Os03g0793500|'''''Hd16''''']]
|[[Os03g0793500]]
| 11.531
| 15843
| 0.728
| 2
| 2
| 2015/5/15 13:43
|-
|[[Os01g0536000|'''''OsCIPK08''''']]
|[[Os01g0536000]]
| 11.52
| 15150
| 0.76
| 2
| 2
| 2015/5/13 15:15
|-
|[[Os03g0848700|'''''Bph14''''']]
|[[Os03g0848700]]
| 11.486
| 21573
| 0.532
| 4
| 4
| 2015/5/15 13:41
|-
|[[Os01g0907900|'''''PLA2''''']]
|[[Os01g0907900]]
| 11.483
| 11485
| 1
| 2
| 2
| 2014/6/2 17:56
|-
|[[Os07g0459200|'''''OsABC1-10''''']]
|[[Os07g0459200]]
| 11.449
| 15381
| 0.744
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os07g0102300|'''''SRL1''''']]
|[[Os07g0102300]]
| 11.423
| 22326
| 0.512
| 3
| 3
| 2015/6/12 16:30
|-
|[[Os07g0186200|'''''OsSIK2''''']]
|[[Os07g0186200]]
| 11.413
| 20165
| 0.566
| 3
| 3
| 2015/6/12 16:34
|-
|[[Os03g0226800|'''''CMT3''''']]
|[[Os03g0226800]]
| 11.245
| 21415
| 0.525
| 3
| 3
| 2015/6/12 13:36
|-
|[[Os08g0114200|'''''OsGLU3''''']]
|[[Os08g0114200]]
| 11.137
| 17754
| 0.627
| 2
| 2
| 2015/6/12 17:23
|-
|[[Os07g0596300|'''''FH5''''']]
|[[Os07g0596300]]
| 11.085
| 15490
| 0.716
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os02g0178800|'''''OsGL1-2''''']]
|[[Os02g0178800]]
| 11.079
| 14720
| 0.753
| 2
| 2
| 2015/5/14 13:23
|-
|[[Os03g0811100|''''' Chl1''''']]
|[[Os03g0811100]]
| 11.068
| 14957
| 0.74
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os09g0395300|'''''SLL1''''']]
|[[Os09g0395300]]
| 11.063
| 16461
| 0.672
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g03150|'''''TAD1''''']]
|[[Os03g03150]]
| 10.972
| 10972
| 1
| 1
| 1
| 2014/6/9 12:35
|-
|[[Os12g0189500|'''''OsYUC11''''']]
|[[Os12g0189500]]
| 10.931
| 20645
| 0.529
| 7
| 7
| 2015/6/13 17:16
|-
|[[Os06g0211200|'''''OsAREB1''''']]
|[[Os06g0211200]]
| 10.925
| 19995
| 0.546
| 5
| 6
| 2015/6/12 16:09
|-
|[[Os02g0100200|'''''HSP''''']]
|[[Os02g0100200]]
| 10.917
| 21797
| 0.501
| 2
| 2
| 2015/5/14 13:17
|-
|'''''[[BHLH]]'''''
|
| 10.829
| 10829
| 1
| 1
| 1
| 2013/7/21 20:47
|-
|[[Os11g0703900|'''''Hsp70''''']]
|[[Os11g0703900]]
| 10.813
| 10898
| 0.992
| 4
| 5
| 2014/6/9 23:54
|-
|[[Os01g44260|'''''OsDfr''''']]
|[[Os01g44260]]
| 10.787
| 10787
| 1
| 1
| 1
| 2014/6/9 21:48
|-
|[[Os03g0815100|'''''SNAC1''''']]
|[[Os03g0815100]]
| 10.722
| 15783
| 0.679
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os10g0561400|'''''OsMYBS3''''']]
|[[Os10g0561400]]
| 10.656
| 22236
| 0.479
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0523800|'''''OsARF1''''']]
|[[Os11g0523800]]
| 10.633
| 21943
| 0.485
| 6
| 6
| 2015/6/13 17:08
|-
|[[Os07g0257200|'''''OsNRAMP5''''']]
|[[Os07g0257200]]
| 10.556
| 10556
| 1
| 1
| 1
| 2015/6/12 16:38
|-
|[[Os02g0661100|'''''OsTPP1''''']]
|[[Os02g0661100]]
| 10.544
| 18837
| 0.56
| 2
| 2
| 2015/5/14 13:51
|-
|[[Os07g0164000|'''''WAF1''''']]
|[[Os07g0164000]]
| 10.534
| 11864
| 0.888
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os12g0476200|'''''Xa25''''']]
|[[Os12g0476200]]
| 10.44
| 17073
| 0.611
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os10g0497300|'''''Rf1a''''']]
|[[Os10g0497300]]
| 10.431
| 18232
| 0.572
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os07g0108900|'''''OsMADS15''''']]
|[[Os07g0108900]]
| 10.425
| 20545
| 0.507
| 4
| 5
| 2015/6/12 16:31
|-
|[[Os03g0215400|'''''MADS1''''']]
|[[Os03g0215400]]
| 10.412
| 14715
| 0.708
| 2
| 2
| 2015/6/12 13:34
|-
|[[Os08g0174700|'''''OsSERK1''''']]
|[[Os08g0174700]]
| 10.335
| 21519
| 0.48
| 2
| 2
| 2015/6/12 17:28
|-
|[[Os01g0121700|'''''OsWBC1''''']]
|[[Os01g0121700]]
| 10.278
| 14300
| 0.719
| 2
| 2
| 2015/5/13 14:49
|-
|[[Os01g0201700|'''''OsMADS3''''']]
|[[Os01g0201700]]
| 10.276
| 20440
| 0.503
| 2
| 2
| 2015/5/13 15:03
|-
|[[Os10g0577600|'''''JMJ706''''']]
|[[Os10g0577600]]
| 10.16
| 18081
| 0.562
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0839100|'''''ZFP179''''']]
|[[Os01g0839100]]
| 10.128
| 13298
| 0.762
| 2
| 2
| 2015/5/13 15:38
|-
|[[Os03g0237250|'''''LPA1''''']]
|[[Os03g0237250]]
| 10.125
| 14184
| 0.714
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0133000|'''''Waxy''''']]
|[[Os06g0133000]]
| 10.084
| 22204
| 0.454
| 3
| 3
| 2015/6/12 16:04
|-
|[[Os03g0805100|'''''SQS''']]
|[[Os03g0805100]]
| 10.051
| 13542
| 0.742
| 2
| 2
| 2015/5/15 13:42
|-
|'''''[[AB013449]]'''''
|
| 10.03
| 10030
| 1
| 1
| 1
| 2014/6/10 22:14
|-
|[[Os07g0605200|'''''OsMADS18''''']]
|[[Os07g0605200]]
| 10.027
| 19041
| 0.527
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os06g0194900|'''''Sus''''']]
|[[Os06g0194900]]
| 10.026
| 20580
| 0.487
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os01g0764800|'''''GH3''''']]
|[[Os01g0764800]]
| 10.024
| 18674
| 0.537
| 2
| 2
| 2015/5/13 15:32
|-
|[[Os03g0111300|'''''NsLTPs''''']]
|[[Os03g0111300]]
| 10.013
| 12909
| 0.776
| 4
| 4
| 2015/6/12 12:57
|-
|[[Os10g0127900|'''''OsFbx352''''']]
|[[Os10g0127900]]
| 10.013
| 20618
| 0.486
| 4
| 8
| 2015/6/13 16:43
|-
|[[Os06g0662000|'''''OsVHA-A''''']]
|[[Os06g0662000]]
| 9.949
| 19796
| 0.503
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0254600|'''''CALEOSIN''''']]
|[[Os06g0254600]]
| 9.94
| 12129
| 0.82
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os06g0330100|'''''Pi-25''''']]
|[[Os06g0330100]]
| 9.935
| 18990
| 0.523
| 4
| 5
| 2015/6/12 16:13
|-
|[[Os06g0603000|'''''SE5''''']]
|[[Os06g0603000]]
| 9.889
| 9889
| 1
| 1
| 1
| 2014/6/9 17:03
|-
|[[Os08g0535200|'''''xa13''''']]
|[[Os08g0535200]]
| 9.858
| 18774
| 0.525
| 3
| 3
| 2015/6/12 17:34
|-
|[[Os12g0281300|'''''Pi-ta''''']]
|[[Os12g0281300]]
| 9.857
| 21855
| 0.451
| 4
| 4
| 2015/6/13 17:16
|-
|[[Os01g0919400|'''''SPS''''']]
|[[Os01g0919400]]
| 9.837
| 9837
| 1
| 1
| 1
| 2016/6/6 17:48
|-
|[[Os10g0573900|'''''OsNMD3''''']]
|[[Os10g0573900]]
| 9.818
| 16399
| 0.599
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0197100|'''''dwarf2''''']]
|[[Os01g0197100]]
| 9.81
| 19279
| 0.509
| 5
| 6
| 2015/5/13 14:59
|-
|[[Os11g0216300|'''''OsABC1-13''''']]
|[[Os11g0216300]]
| 9.795
| 13761
| 0.712
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os01g0102900|'''''Os-LIR1''''']]
|[[Os01g0102900]]
| 9.726
| 9726
| 1
| 1
| 1
| 2016/6/12 14:04
|-
|[[Os11g0249000|'''''NLS1''''']]
|[[Os11g0249000]]
| 9.718
| 17393
| 0.559
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os10g0467800|'''''OsCesA7''''']]
|[[Os10g0467800]]
| 9.68
| 22133
| 0.437
| 5
| 6
| 2015/6/13 16:48
|-
|[[Os02g0682200|'''''MADS6''''']]
|[[Os02g0682200]]
| 9.577
| 17192
| 0.557
| 3
| 13
| 2015/5/14 13:53
|-
|[[Os06g0569500|'''''GAs''''']]
|[[Os06g0569500]]
| 9.526
| 18834
| 0.506
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os09g0456800|'''''OsHsfs''''']]
|[[Os09g0456800]]
| 9.468
| 13735
| 0.689
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0274900|'''''OsGMST1''''']]
|[[Os02g0274900]]
| 9.449
| 18241
| 0.518
| 2
| 2
| 2015/5/14 13:38
|-
|[[Os06g0724900|'''''ILA1''''']]
|[[Os06g0724900]]
| 9.361
| 19950
| 0.469
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os01g0611100|'''''OsRAN1''''']]
|[[Os01g0611100]]
| 9.349
| 15330
| 0.61
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os08g0509600|'''''OsSPL14''''']]
|[[Os08g0509600]]
| 9.346
| 17625
| 0.53
| 3
| 4
| 2015/6/12 17:32
|-
|[[Os07g0558000|'''''OsABC1-11''''']]
|[[Os07g0558000]]
| 9.337
| 13289
| 0.703
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0449000|'''''PTC1''''']]
|[[Os09g0449000]]
| 9.33
| 16966
| 0.55
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os04g0415000|'''''BY240''''']]
|[[Os04g0415000]]
| 9.31
| 9310
| 1
| 1
| 1
| 2014/6/6 19:55
|-
|[[Os07g0471000|'''''OsIRE1''''']]
|[[Os07g0471000]]
| 9.278
| 18586
| 0.499
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os03g0170900|'''''OsSUT1''''']]
|[[Os03g0170900]]
| 9.272
| 19337
| 0.479
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os06g0610300|'''''MOC1''''']]
|[[Os06g0610300]]
| 9.171
| 11979
| 0.766
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0583400|'''''OsHDAC702''''']]
|[[Os06g0583400]]
| 9.15
| 11481
| 0.797
| 2
| 2
| 2015/6/12 16:16
|-
|[[Os02g0622100|'''''LTG1''''']]
|[[Os02g0622100]]
| 9.147
| 12303
| 0.743
| 2
| 2
| 2015/5/14 13:47
|-
|[[Os03g0203200|'''''HTD2''''']]
|[[Os03g0203200]]
| 9.128
| 17233
| 0.53
| 4
| 4
| 2015/6/12 13:06
|-
|[[Os06g0660200|'''''OsPIN2''''']]
|[[Os06g0660200]]
| 9.119
| 20530
| 0.444
| 5
| 6
| 2015/6/12 16:21
|-
|[[Os10g0403000|'''''PLA1 ''''']]
|[[Os10g0403000]]
| 9.104
| 15463
| 0.589
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os03g0112700|'''''Ehd4''''']]
|[[Os03g0112700]]
| 9.094
| 17122
| 0.531
| 3
| 3
| 2015/6/12 12:58
|-
|[[Os02g0799100|'''''Ossgo1''''']]
|[[Os02g0799100]]
| 9.068
| 16095
| 0.563
| 3
| 6
| 2015/5/14 14:02
|-
|[[Os09g0307800|'''''SDG724''''']]
|[[Os09g0307800]]
| 9.029
| 11279
| 0.801
| 4
| 15
| 2014/6/6 8:56
|-
|[[Os08g0424500|'''''Badh2''''']]
|[[Os08g0424500]]
| 9.021
| 17768
| 0.508
| 3
| 3
| 2015/6/12 17:30
|-
|[[Os11g0184900|'''''OsNAC5''''']]
|[[Os11g0184900]]
| 9.016
| 15182
| 0.594
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0203700|'''''SRZ1''''']]
|[[Os02g0203700]]
| 9.003
| 12324
| 0.731
| 2
| 2
| 2015/5/14 13:26
|-
|[[Os06g0125000|'''''RPM1''''']]
|[[Os06g0125000]]
| 8.97
| 12695
| 0.707
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os03g0128700|'''''OsCDPK13''''']]
|[[Os03g0128700]]
| 8.928
| 17882
| 0.499
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os03g0215200|'''''DL''''']]
|[[Os03g0215200]]
| 8.927
| 14196
| 0.629
| 3
| 3
| 2015/6/12 13:07
|-
|[[Os01g0952800|'''''OsIRO2''''']]
|[[Os01g0952800]]
| 8.922
| 8922
| 1
| 1
| 1
| 2014/6/10 21:52
|-
|[[Os06g0494100|'''''Pi-d2''''']]
|[[Os06g0494100]]
| 8.906
| 12742
| 0.699
| 3
| 3
| 2015/6/12 16:14
|-
|[[Os03g0149100|'''''OsCrl1''''']]
|[[Os03g0149100]]
| 8.897
| 13456
| 0.661
| 3
| 4
| 2015/6/12 11:15
|-
|'''''[[BZIP]]'''''
|
| 8.894
| 8924
| 0.997
| 2
| 2
| 2013/7/21 21:01
|-
|[[Os06g0625900|'''''OsHAK10''''']]
|[[Os06g0625900]]
| 8.872
| 13033
| 0.681
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0229800|'''''ALK''''']]
|[[Os06g0229800]]
| 8.835
| 16807
| 0.526
| 2
| 2
| 2015/6/12 16:11
|-
|[[Os07g0232900|'''''OsHMA3''''']]
|[[Os07g0232900]]
| 8.79
| 18004
| 0.488
| 3
| 8
| 2015/6/12 16:37
|-
|[[Os07g0129700|'''''OSH15''''']]
|[[Os07g0129700]]
| 8.789
| 18504
| 0.475
| 3
| 3
| 2015/6/12 16:32
|-
|[[Os12g0641400|'''''OsSUT2''''']]
|[[Os12g0641400]]
| 8.735
| 8735
| 1
| 1
| 1
| 2016/6/12 13:56
|-
|[[Os08g0137100|'''''OsFIE2''''']]
|[[Os08g0137100]]
| 8.717
| 8717
| 1
| 1
| 1
| 2015/6/12 17:25
|-
|'''''[[Htd1]]'''''
|
| 8.705
| 8705
| 1
| 1
| 1
| 2014/6/10 14:14
|-
|[[Os03g0707600|'''''GAI''''']]
|[[Os03g0707600]]
| 8.666
| 16659
| 0.52
| 2
| 5
| 2014/5/28 0:43
|-
|'''''[[Xa23]]'''''
|
| 8.641
| 8641
| 1
| 1
| 1
| 2014/5/31 21:49
|-
|[[Os11g0235200|'''''SP1''''']]
|[[Os11g0235200]]
| 8.563
| 17156
| 0.499
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os07g0100600|'''''OsPTR1''''']]
|[[Os07g0100600]]
| 8.559
| 15027
| 0.57
| 2
| 2
| 2015/6/12 16:30
|-
|[[Os06g0597000|'''''OsIAA23''''']]
|[[Os06g0597000]]
| 8.509
| 16209
| 0.525
| 4
| 11
| 2014/5/19 22:42
|-
|[[Os02g0232100|'''''HEI10''''']]
|[[Os02g0232100]]
| 8.485
| 15567
| 0.545
| 2
| 2
| 2015/5/14 13:36
|-
|[[Os04g0452500|'''''ZEP1''''']]
|[[Os04g0452500]]
| 8.484
| 8484
| 1
| 1
| 1
| 2014/5/31 16:56
|-
|[[Os09g0363900|'''''ONI3''''']]
|[[Os09g0363900]]
| 8.473
| 12412
| 0.683
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os09g0426800|'''''WSL2''''']]
|[[Os09g0426800]]
| 8.447
| 9634
| 0.877
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0253300|'''''alpha-1a''''']]
|[[Os01g0253300]]
| 8.439
| 17745
| 0.476
| 5
| 5
| 2015/5/13 15:07
|-
|[[Os06g0683400|'''''OsCCD1''''']]
|[[Os06g0683400]]
| 8.438
| 8438
| 1
| 1
| 1
| 2016/6/12 14:00
|-
|[[Os09g0522000|'''''OsDREB''''']]
|[[Os09g0522000]]
| 8.335
| 8335
| 1
| 1
| 1
| 2014/5/24 21:12
|-
|[[Os02g0580300|'''''GID2''''']]
|[[Os02g0580300]]
| 8.329
| 15752
| 0.529
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os08g0499300|'''''OsWRKY30''''']]
|[[Os08g0499300]]
| 8.324
| 17032
| 0.489
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0445700|'''''TPS''''']]
|[[Os08g0445700]]
| 8.317
| 10922
| 0.761
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os10g0505700|'''''LTPs''''']]
|[[Os10g0505700]]
| 8.312
| 16220
| 0.512
| 5
| 6
| 2015/6/13 16:46
|-
|[[Os11g0559200|'''''OsXa21''''']]
|[[Os11g0559200]]
| 8.294
| 15586
| 0.532
| 6
| 9
| 2015/6/13 17:08
|-
|[[Os03g0179400|'''''GUDK''''']]
|[[Os03g0179400]]
| 8.292
| 14840
| 0.559
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os02g0553200|'''''OsAPx8''''']]
|[[Os02g0553200]]
| 8.204
| 8204
| 1
| 1
| 1
| 2014/6/8 16:03
|-
|[[Os01g0571300|'''''OsHsfA7''''']]
|[[Os01g0571300]]
| 8.184
| 14946
| 0.548
| 2
| 2
| 2015/5/13 15:16
|-
|[[Os09g0401100|'''''STR1''''']]
|[[Os09g0401100]]
| 8.183
| 17216
| 0.475
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os02g0181300|'''''WRKY''''']]
|[[Os02g0181300]]
| 8.174
| 13252
| 0.617
| 2
| 2
| 2015/5/14 13:24
|-
|[[Os05g0346200|'''''OsDREB2B2''''']]
|[[Os05g0346200]]
| 8.14
| 8233
| 0.989
| 2
| 3
| 2014/6/5 17:14
|-
|[[Os09g0502100|'''''LGD1''''']]
|[[Os09g0502100]]
| 8.139
| 15501
| 0.525
| 2
| 2
| 2015/6/12 22:35
|-
|[[Os03g0820300|'''''ZFP182''''']]
|[[Os03g0820300]]
| 8.137
| 11604
| 0.701
| 2
| 2
| 2015/5/15 13:41
|-
|[[Os03g0230300|'''''OsSRO1c''''']]
|[[Os03g0230300]]
| 8.029
| 15193
| 0.528
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os07g0438800|'''''OsPHR2''''']]
|[[Os07g0438800]]
| 8.026
| 15610
| 0.514
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os02g0534400|'''''OsCIN1''''']]
|[[Os02g0534400]]
| 7.997
| 16635
| 0.481
| 2
| 2
| 2015/5/14 13:41
|-
|[[Os06g0165600|'''''OsDREB1D''''']]
|[[Os06g0165600]]
| 7.982
| 11937
| 0.669
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os11g0490600|'''''LAZY1''''']]
|[[Os11g0490600]]
| 7.98
| 16603
| 0.481
| 4
| 5
| 2015/6/13 17:07
|-
|[[Os07g0585700|'''''Sdr4''''']]
|[[Os07g0585700]]
| 7.966
| 7966
| 1
| 1
| 1
| 2014/6/9 23:14
|-
|[[Os01g0194300|'''''OsNPR1''''']]
|[[Os01g0194300]]
| 7.966
| 11111
| 0.717
| 2
| 2
| 2015/5/13 14:59
|-
|[[Os01g0869900|'''''SNF1''''']]
|[[Os01g0869900]]
| 7.964
| 16289
| 0.489
| 2
| 2
| 2015/5/13 15:42
|-
|[[Os06g0160700|'''''SSSl''''']]
|[[Os06g0160700]]
| 7.962
| 15027
| 0.53
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os09g0451500|'''''PDI''''']]
|[[Os09g0451500]]
| 7.903
| 10040
| 0.787
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os01g0759400|'''''OsCIPK12''''']]
|[[Os01g0759400]]
| 7.902
| 15742
| 0.502
| 2
| 2
| 2015/5/13 15:30
|-
|[[Os06g0205100|'''''OsC1-Myb''''']]
|[[Os06g0205100]]
| 7.891
| 12914
| 0.611
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os09g0244900|'''''Ypt1p''''']]
|[[Os09g0244900]]
| 7.89
| 11371
| 0.694
| 2
| 2
| 2015/6/12 17:38
|-
|'''''[[HTD2]]'''''
|
| 7.887
| 7887
| 1
| 1
| 1
| 2014/6/4 22:20
|-
|[[Os09g0482400|'''''HSP82''''']]
|[[Os09g0482400]]
| 7.873
| 11843
| 0.665
| 2
| 2
| 2015/6/12 17:47
|-
|[[Os10g0478000|'''''TAW1''''']]
|[[Os10g0478000]]
| 7.871
| 12275
| 0.641
| 4
| 5
| 2015/6/13 16:47
|-
|[[Os07g0258400|'''''OsNRAMP1''''']]
|[[Os07g0258400]]
| 7.866
| 13708
| 0.574
| 2
| 2
| 2015/6/12 16:38
|-
|[[Os10g0445400|'''''OsHCI1''''']]
|[[Os10g0445400]]
| 7.848
| 15652
| 0.501
| 6
| 15
| 2015/6/13 16:48
|-
|[[Os01g0273800|'''''OsYUC9''''']]
|[[Os01g0273800]]
| 7.843
| 9988
| 0.785
| 2
| 2
| 2015/5/13 15:10
|-
|[[Os01g0643300|'''''OsPIN10a''''']]
|[[Os01g0643300]]
| 7.839
| 16276
| 0.482
| 3
| 3
| 2015/5/13 15:22
|-
|[[Os06g0286700|'''''Pi9''''']]
|[[Os06g0286700]]
| 7.816
| 16653
| 0.469
| 6
| 9
| 2015/6/12 16:13
|-
|[[Os11g0104300|'''''DWARF53''''']]
|[[Os11g0104300]]
| 7.791
| 11682
| 0.667
| 4
| 4
| 2015/6/13 17:00
|-
|[[Os07g0150700|'''''Os-AKT1''''']]
|[[Os07g0150700]]
| 7.79
| 15994
| 0.487
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os09g0494200|'''''BC15''''']]
|[[Os09g0494200]]
| 7.776
| 7776
| 1
| 1
| 1
| 2014/6/3 23:51
|-
|[[Os03g0181500|'''''ONI1''''']]
|[[Os03g0181500]]
| 7.751
| 12230
| 0.634
| 3
| 4
| 2015/6/12 13:05
|-
|[[Os02g0814200|'''''OsGL1-6''''']]
|[[Os02g0814200]]
| 7.743
| 13379
| 0.579
| 2
| 2
| 2015/5/14 14:03
|-
|[[Os02g0103800|'''''OsLFNR1''''']]
|[[Os02g0103800]]
| 7.686
| 7686
| 1
| 1
| 1
| 2016/6/12 14:12
|-
|[[Os11g0225100|'''''Pia''''']]
|[[Os11g0225100]]
| 7.669
| 12296
| 0.624
| 3
| 3
| 2015/6/13 17:04
|-
|'''''[[Pi1]]'''''
|
| 7.644
| 7644
| 1
| 1
| 1
| 2014/6/5 17:02
|-
|[[Os01g0307500|'''''SKC1''''']]
|[[Os01g0307500]]
| 7.639
| 7639
| 1
| 1
| 1
| 2014/6/7 21:57
|-
|'''''[[Chalk5]]'''''
|
| 7.635
| 7635
| 1
| 1
| 1
| 2014/5/29 11:10
|-
|[[Os08g0140300|'''''TDC''''']]
|[[Os08g0140300]]
| 7.633
| 13769
| 0.554
| 2
| 2
| 2015/6/12 17:26
|-
|[[Os07g0622900|'''''DTM1''''']]
|[[Os07g0622900]]
| 7.632
| 14288
| 0.534
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os01g0292200|'''''OsCIPK1''''']]
|[[Os01g0292200]]
| 7.626
| 12859
| 0.593
| 2
| 2
| 2015/5/13 15:11
|-
|[[Os03g0230500|'''''DSM3''''']]
|[[Os03g0230500]]
| 7.618
| 14126
| 0.539
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os12g0472500|'''''OsTDL1A''''']]
|[[Os12g0472500]]
| 7.581
| 13819
| 0.549
| 4
| 4
| 2015/6/13 17:17
|-
|[[Os03g0262900|'''''glup6''''']]
|[[Os03g0262900]]
| 7.571
| 15719
| 0.482
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0107700|'''''OsLFNR2''''']]
|[[Os06g0107700]]
| 7.533
| 7533
| 1
| 1
| 1
| 2016/6/6 9:33
|-
|[[Os02g57310|'''''Pib''''']]
|[[Os02g57310]]
| 7.531
| 7531
| 1
| 1
| 1
| 2014/6/6 14:27
|-
|[[Os09g0104200|'''''OsRAD51D''''']]
|[[Os09g0104200]]
| 7.502
| 15399
| 0.487
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os06g0142600|'''''Hd17''''']]
|[[Os06g0142600]]
| 7.492
| 11545
| 0.649
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os03g0788500|'''''OsCPK10''''']]
|[[Os03g0788500]]
| 7.454
| 10159
| 0.734
| 2
| 2
| 2015/5/15 13:44
|-
|[[Os06g0139000|'''''F-box''''']]
|[[Os06g0139000]]
| 7.443
| 15282
| 0.487
| 3
| 4
| 2015/6/12 16:05
|-
|[[Os03g0168600|'''''CYP704B2''''']]
|[[Os03g0168600]]
| 7.43
| 12348
| 0.602
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os11g0117400|'''''OsWRKY89''''']]
|[[Os11g0117400]]
| 7.353
| 11607
| 0.633
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os03g0223400|'''''OsGLN1_2''''']]
|[[Os03g0223400]]
| 7.313
| 14417
| 0.507
| 3
| 3
| 2015/6/12 13:35
|-
|[[Os02g0731200|'''''MADS57''''']]
|[[Os02g0731200]]
| 7.311
| 14927
| 0.49
| 2
| 2
| 2015/5/14 13:56
|-
|[[Os09g02650|'''''BC12''''']]
|[[Os09g02650]]
| 7.302
| 7302
| 1
| 1
| 1
| 2014/6/1 19:01
|-
|[[Os01g0859300|'''''OsABI5''''']]
|[[Os01g0859300]]
| 7.265
| 12246
| 0.593
| 2
| 2
| 2015/5/13 15:41
|-
|[[Os08g0105000|'''''Ghd7''''']]
|[[Os08g0105000]]
| 7.237
| 15311
| 0.473
| 4
| 4
| 2015/6/12 17:23
|-
|[[Os03g0110800|'''''OsDRM2''''']]
|[[Os03g0110800]]
| 7.203
| 14838
| 0.485
| 2
| 2
| 2015/6/12 12:57
|-
|[[Os01g0367100|'''''PHD1''''']]
|[[Os01g0367100]]
| 7.2
| 12561
| 0.573
| 3
| 3
| 2015/6/9 9:53
|-
|[[Os02g0191600|'''''OsbZIP16''''']]
|[[Os02g0191600]]
| 7.2
| 13785
| 0.522
| 2
| 2
| 2015/5/14 13:25
|-
|[[Os08g0137250|'''''FIE1''''']]
|[[Os08g0137250]]
| 7.185
| 14660
| 0.49
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os02g0220400|'''''Cga1''''']]
|[[Os02g0220400]]
| 7.158
| 17791
| 0.402
| 6
| 8
| 2015/5/14 13:36
|-
|[[Os10g0404500|'''''SUTs''''']]
|[[Os10g0404500]]
| 7.151
| 7164
| 0.998
| 2
| 2
| 2014/6/7 23:34
|-
|[[Os10g0177200|'''''OsDSR-1''''']]
|[[Os10g0177200]]
| 7.15
| 9017
| 0.793
| 3
| 3
| 2015/6/13 16:45
|-
|[[Os10g0496900|'''''OsPORB''''']]
|[[Os10g0496900]]
| 7.143
| 14022
| 0.509
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os02g0313400|'''''API5''''']]
|[[Os02g0313400]]
| 7.12
| 14554
| 0.489
| 2
| 2
| 2015/5/14 13:39
|-
|[[Os08g0117000|'''''PSS1''''']]
|[[Os08g0117000]]
| 7.092
| 8202
| 0.865
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os08g0531700|'''''MADS-box''''']]
|[[Os08g0531700]]
| 7.054
| 13276
| 0.531
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os06g0499500|'''''GH3''''']]
|[[Os06g0499500]]
| 7.051
| 12958
| 0.544
| 3
| 4
| 2015/6/12 16:15
|-
|[[Os03g0188400|'''''OsSRT1''''']]
|[[Os03g0188400]]
| 7.05
| 12067
| 0.584
| 2
| 2
| 2015/6/12 13:06
|-
|[[Os02g0649900|'''''OsYSL2''''']]
|[[Os02g0649900]]
| 7.031
| 12503
| 0.562
| 2
| 2
| 2015/5/14 13:48
|-
|[[Os09g0442700|'''''OsDDM1''''']]
|[[Os09g0442700]]
| 7.028
| 10589
| 0.664
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os12g0438600|'''''AtCLC-a''''']]
|[[Os12g0438600]]
| 7.022
| 14835
| 0.473
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os07g0124700|'''''CRL5''''']]
|[[Os07g0124700]]
| 6.998
| 14469
| 0.484
| 2
| 2
| 2015/6/12 16:31
|-
|[[Os11g0639100|'''''Pi54''''']]
|[[Os11g0639100]]
| 6.934
| 11269
| 0.615
| 4
| 4
| 2015/6/13 17:09
|-
|[[Os01g0615050|'''''OCPI1''''']]
|[[Os01g0615050]]
| 6.92
| 9869
| 0.701
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os12g0610200|'''''OsPIL11''''']]
|[[Os12g0610200]]
| 6.911
| 12604
| 0.548
| 4
| 4
| 2015/6/13 17:18
|-
|[[Os03g0123300|'''''TAD1''''']]
|[[Os03g0123300]]
| 6.87
| 15272
| 0.45
| 4
| 8
| 2015/6/12 13:00
|-
|[[Os07g0682800|'''''rth1''''']]
|[[Os07g0682800]]
| 6.853
| 13550
| 0.506
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os11g0446000|'''''RSS3''''']]
|[[Os11g0446000]]
| 6.838
| 13942
| 0.49
| 5
| 5
| 2015/6/13 17:07
|-
|[[Os07g0182900|'''''OsMET1a''''']]
|[[Os07g0182900]]
| 6.821
| 13295
| 0.513
| 5
| 11
| 2015/6/12 16:33
|-
|[[Os01g0205700|'''''OsGSK1''''']]
|[[Os01g0205700]]
| 6.813
| 12490
| 0.545
| 2
| 2
| 2015/5/13 15:04
|-
|[[Os05g0333200|'''''GPA1''''']]
|[[Os05g0333200]]
| 6.778
| 8703
| 0.779
| 2
| 2
| 2014/6/9 9:17
|-
|[[Os10g0167600|'''''OsCPDP''''']]
|[[Os10g0167600]]
| 6.756
| 14570
| 0.464
| 4
| 4
| 2015/6/13 16:45
|-
|[[Os07g0227800|'''''OsABC1-9''''']]
|[[Os07g0227800]]
| 6.744
| 10826
| 0.623
| 2
| 2
| 2015/6/12 16:37
|-
|[[Os10g0567400|'''''OsCAO1''''']]
|[[Os10g0567400]]
| 6.732
| 13437
| 0.501
| 3
| 3
| 2015/6/13 16:58
|-
|'''''[[DEP2]]'''''
|
| 6.724
| 6763
| 0.994
| 3
| 7
| 2014/6/10 22:30
|-
|[[Os07g0592600|'''''OsMGH3''''']]
|[[Os07g0592600]]
| 6.72
| 15320
| 0.439
| 5
| 11
| 2015/6/12 16:46
|-
|[[Os11g0126900|'''''OsNAC10''''']]
|[[Os11g0126900]]
| 6.705
| 6705
| 1
| 1
| 1
| 2014/5/24 12:41
|-
|[[Os09g0561600|'''''OsDEES1''''']]
|[[Os09g0561600]]
| 6.699
| 11352
| 0.59
| 2
| 2
| 2015/6/13 16:42
|-
|'''''[[Sub1A]]'''''
|
| 6.679
| 6679
| 1
| 1
| 1
| 2014/6/4 16:03
|-
|[[Os08g0126300|'''''OsGAPDH''''']]
|[[Os08g0126300]]
| 6.658
| 13730
| 0.485
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os10g0533600|'''''OsMPK6''''']]
|[[Os10g0533600]]
| 6.522
| 8207
| 0.795
| 3
| 3
| 2015/6/13 16:46
|-
|[[Os10g0397400|'''''dwarf2''''']]
|[[Os10g0397400]]
| 6.52
| 11105
| 0.587
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os06g0712700|'''''OsMADS16''''']]
|[[Os06g0712700]]
| 6.51
| 7624
| 0.854
| 2
| 2
| 2014/6/9 16:43
|-
|[[Os08g0237000|'''''OsXTH8''''']]
|[[Os08g0237000]]
| 6.46
| 6460
| 1
| 1
| 1
| 2014/6/9 18:44
|-
|[[Os02g0811000|'''''TH1''''']]
|[[Os02g0811000]]
| 6.453
| 11487
| 0.562
| 2
| 2
| 2015/5/14 14:02
|-
|[[Os07g0505200|'''''OsSPL13''''']]
|[[Os07g0505200]]
| 6.444
| 6444
| 1
| 1
| 1
| 2016/6/13 9:49
|-
|[[Os11g0247300|'''''Srs5''''']]
|[[Os11g0247300]]
| 6.442
| 13081
| 0.492
| 4
| 4
| 2015/6/13 17:05
|-
|[[AY986492|'''''Xa27''''']]
|[[AY986492]]
| 6.408
| 6408
| 1
| 2
| 2
| 2014/6/10 21:12
|-
|[[Os06g0700700|'''''OsHMA2''''']]
|[[Os06g0700700]]
| 6.404
| 6404
| 1
| 1
| 1
| 2014/6/3 20:16
|-
|[[Os02g0771400|'''''OsPFA-DSP2''''']]
|[[Os02g0771400]]
| 6.399
| 6702
| 0.955
| 2
| 3
| 2014/5/12 16:03
|-
|[[Os06g0127800|'''''DLT''''']]
|[[Os06g0127800]]
| 6.393
| 10797
| 0.592
| 2
| 2
| 2015/6/12 16:03
|-
|[[Os02g0120500|'''''OsTDR''''']]
|[[Os02g0120500]]
| 6.372
| 6372
| 1
| 1
| 1
| 2015/5/14 13:19
|-
|[[Os03g0854500|'''''OsHsfs''''']]
|[[Os03g0854500]]
| 6.367
| 10086
| 0.631
| 2
| 2
| 2015/5/15 13:40
|-
|[[Os06g0275000|'''''Hd1''''']]
|[[Os06g0275000]]
| 6.307
| 11994
| 0.526
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os02g0759800|'''''OsSKIPa''''']]
|[[Os02g0759800]]
| 6.249
| 12883
| 0.485
| 2
| 2
| 2015/5/14 14:00
|-
|[[Os08g0101000|'''''IDEF1''''']]
|[[Os08g0101000]]
| 6.239
| 10862
| 0.574
| 2
| 2
| 2015/6/12 17:22
|-
|[[Os09g0456200|'''''OsbZIP72''''']]
|[[Os09g0456200]]
| 6.23
| 10901
| 0.572
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os12g0101600|'''''leaf2''''']]
|[[Os12g0101600]]
| 6.221
| 35095
| 0.177
| 2
| 3
| 2014/5/31 21:22
|-
|[[Os06g0695800|'''''STAR1''''']]
|[[Os06g0695800]]
| 6.213
| 8582
| 0.724
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0606700|'''''RSS1''''']]
|[[Os02g0606700]]
| 6.198
| 12432
| 0.499
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os11g0210300|'''''Adh1''''']]
|[[Os11g0210300]]
| 6.196
| 12384
| 0.5
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0736400|'''''OsDHODH''''']]
|[[Os02g0736400]]
| 6.183
| 11839
| 0.522
| 2
| 2
| 2015/5/14 13:57
|-
|[[Os08g0549100|'''''OsAPx4''''']]
|[[Os08g0549100]]
| 6.175
| 10093
| 0.612
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os09g0452200|'''''LYP4''''']]
|[[Os09g0452200]]
| 6.171
| 11987
| 0.515
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0170300|'''''OsMADS29''''']]
|[[Os02g0170300]]
| 6.166
| 12582
| 0.49
| 3
| 4
| 2015/5/14 13:23
|-
|[[Os03g0224700|'''''Hsfs''''']]
|[[Os03g0224700]]
| 6.166
| 11925
| 0.517
| 4
| 4
| 2015/6/12 13:35
|-
|[[Os07g0558500|'''''THF1''''']]
|[[Os07g0558500]]
| 6.078
| 12744
| 0.477
| 5
| 9
| 2015/6/12 16:45
|-
|[[Os09g0511000|'''''OsCERK1''''']]
|[[Os09g0511000]]
| 6.076
| 12097
| 0.502
| 2
| 2
| 2015/6/12 22:35
|-
|'''''[[OsWRKY13]]'''''
|
| 6.069
| 6101
| 0.995
| 2
| 3
| 2014/6/4 20:18
|-
|[[Os06g0308100|'''''OsIBR5''''']]
|[[Os06g0308100]]
| 6.062
| 12455
| 0.487
| 2
| 2
| 2015/6/12 16:13
|-
|[[Os11g0113700|'''''OsCIPK15''''']]
|[[Os11g0113700]]
| 5.961
| 12261
| 0.486
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os02g0656600|'''''GPA3''''']]
|[[Os02g0656600]]
| 5.915
| 10022
| 0.59
| 2
| 2
| 2015/5/14 13:50
|-
|[[Os01g0733200|'''''OsHsfC1b''''']]
|[[Os01g0733200]]
| 5.889
| 5889
| 1
| 1
| 1
| 2014/5/31 11:56
|-
|[[Os01g0785400|'''''GH3''''']]
|[[Os01g0785400]]
| 5.864
| 10600
| 0.553
| 2
| 2
| 2015/5/13 15:34
|-
|[[Os04g0541700|'''''Oshox22''''']]
|[[Os04g0541700]]
| 5.857
| 6037
| 0.97
| 2
| 3
| 2014/6/8 16:10
|-
|[[Os08g0140500|'''''TDC-3''''']]
|[[Os08g0140500]]
| 5.829
| 11343
| 0.514
| 2
| 2
| 2015/6/12 17:26
|-
|'''''[[IPK1]]'''''
|
| 5.803
| 5803
| 1
| 1
| 1
| 2014/6/8 16:55
|-
|[[Os09g0522100|'''''CBF''''']]
|[[Os09g0522100]]
| 5.713
| 9270
| 0.616
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os01g0177900|'''''OsABCG31''''']]
|[[Os01g0177900]]
| 5.693
| 11327
| 0.503
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os02g0149800|'''''OsPP18''''']]
|[[Os02g0149800]]
| 5.681
| 11452
| 0.496
| 2
| 2
| 2015/5/14 13:22
|-
|[[Os01g0831000|'''''LAX''''']]
|[[Os01g0831000]]
| 5.68
| 9517
| 0.597
| 2
| 2
| 2015/5/13 15:37
|-
|[[Os05g0580500|'''''OsRAD21-4''''']]
|[[Os05g0580500]]
| 5.66
| 5660
| 1
| 1
| 1
| 2014/5/23 11:03
|-
|'''''[[OsCERK1]]'''''
|
| 5.61
| 5610
| 1
| 1
| 1
| 2014/6/1 18:31
|-
|[[Os11g0116200|'''''LTPs''''']]
|[[Os11g0116200]]
| 5.602
| 7206
| 0.777
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os09g0567800|'''''Lipase''''']]
|[[Os09g0567800]]
| 5.558
| 5558
| 1
| 1
| 1
| 2014/6/6 16:24
|-
|[[Os06g0610350|'''''OsMOC1''''']]
|[[Os06g0610350]]
| 5.547
| 5547
| 1
| 1
| 1
| 2016/6/12 13:57
|-
|[[Os02g0657000|'''''ARAG1''''']]
|[[Os02g0657000]]
| 5.536
| 9210
| 0.601
| 2
| 2
| 2015/5/14 13:51
|-
|'''''[[Wbph8]]'''''
|
| 5.531
| 5531
| 1
| 1
| 1
| 2014/6/10 18:50
|-
|[[Os07g0563300|'''''GD1''''']]
|[[Os07g0563300]]
| 5.487
| 11105
| 0.494
| 2
| 2
| 2015/6/12 16:45
|-
|[[Os06g0701700|'''''OsHKT2;1''''']]
|[[Os06g0701700]]
| 5.432
| 8295
| 0.655
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os10g0419200|'''''RID1''''']]
|[[Os10g0419200]]
| 5.432
| 9118
| 0.596
| 3
| 3
| 2015/6/13 16:44
|-
|'''''[[OsCEBiP]]'''''
|
| 5.419
| 5419
| 1
| 1
| 1
| 2014/6/8 12:32
|-
|'''''[[Xa10]]'''''
|
| 5.416
| 5416
| 1
| 1
| 1
| 2014/6/1 16:52
|-
|[[Os03g0272300|'''''OsSDIR1''''']]
|[[Os03g0272300]]
| 5.41
| 9862
| 0.549
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os10g0528300|'''''GSTs''''']]
|[[Os10g0528300]]
| 5.364
| 9566
| 0.561
| 3
| 3
| 2015/6/13 16:46
|-
|'''''[[Badh2]]'''''
|
| 5.363
| 5363
| 1
| 1
| 1
| 2014/6/8 19:38
|-
|[[Os03g0233900|'''''Hbs''''']]
|[[Os03g0233900]]
| 5.348
| 9011
| 0.593
| 2
| 2
| 2015/6/12 13:38
|-
|'''''[[Xa21]]'''''
|
| 5.345
| 5345
| 1
| 1
| 1
| 2014/6/1 13:37
|-
|'''''[[Bls1]]'''''
|
| 5.308
| 5308
| 1
| 1
| 1
| 2014/5/24 15:17
|-
|[[Os06g0157700|'''''Hd3''''']]
|[[Os06g0157700]]
| 5.304
| 10277
| 0.516
| 2
| 2
| 2015/6/12 16:06
|-
|[[Os02g0260200|'''''LP''''']]
|[[Os02g0260200]]
| 5.302
| 7745
| 0.685
| 2
| 2
| 2015/5/14 13:37
|-
|[[Os03g0232600|'''''TUD1''''']]
|[[Os03g0232600]]
| 5.249
| 10595
| 0.495
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os03g0125100|'''''OsHYD3''''']]
|[[Os03g0125100]]
| 5.183
| 10331
| 0.502
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os06g0212900|'''''ORF3''''']]
|[[Os06g0212900]]
| 5.175
| 6651
| 0.778
| 3
| 3
| 2015/6/12 16:09
|-
|[[Os02g0491300|'''''MTR1''''']]
|[[Os02g0491300]]
| 5.166
| 10047
| 0.514
| 2
| 2
| 2015/5/14 13:40
|-
|[[Os09g0470500|'''''Oshox4''''']]
|[[Os09g0470500]]
| 5.144
| 9661
| 0.532
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os09g0439800|'''''DRO1''''']]
|[[Os09g0439800]]
| 5.122
| 8022
| 0.638
| 3
| 4
| 2015/6/12 17:43
|-
|[[Os12g0555500|'''''PBZ1''''']]
|[[Os12g0555500]]
| 5.108
| 8929
| 0.572
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os11g0508600|'''''Os-11N3''''']]
|[[Os11g0508600]]
| 5.066
| 7754
| 0.653
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os08g0174500|'''''OsDTH8''''']]
|[[Os08g0174500]]
| 5.017
| 9397
| 0.534
| 3
| 3
| 2015/6/12 17:28
|-
|[[Os03g0267200|'''''sHSP17.7''''']]
|[[Os03g0267200]]
| 5.008
| 7991
| 0.627
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os06g0622700|'''''OsbZIP50 ''''']]
|[[Os06g0622700]]
| 5
| 9868
| 0.507
| 2
| 2
| 2015/6/12 16:19
|-
|'''''[[SBP]]'''''
|
| 4.997
| 4997
| 1
| 1
| 1
| 2013/7/21 18:43
|-
|[[Os05g0465800|'''''PI3K''''']]
|[[Os05g0465800]]
| 4.939
| 4939
| 1
| 1
| 1
| 2014/6/6 16:19
|-
|[[Os10g0491000|'''''BSP''''']]
|[[Os10g0491000]]
| 4.912
| 8991
| 0.546
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os01g0206700|'''''OsCIPK05''''']]
|[[Os01g0206700]]
| 4.909
| 9664
| 0.508
| 2
| 2
| 2015/5/13 15:05
|-
|[[Os06g0643300|'''''RISBZ1''''']]
|[[Os06g0643300]]
| 4.869
| 7953
| 0.612
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os03g0180800|'''''OsTIFY11a''''']]
|[[Os03g0180800]]
| 4.859
| 8158
| 0.596
| 2
| 2
| 2015/6/12 13:04
|-
|'''''[[BPH_gene]]'''''
|
| 4.857
| 4857
| 1
| 2
| 2
| 2014/6/11 11:14
|-
|[[Os01g0805600|'''''CycB1''''']]
|[[Os01g0805600]]
| 4.842
| 4842
| 1
| 1
| 1
| 2014/6/5 18:11
|-
|[[Os06g0701600|'''''HKT''''']]
|[[Os06g0701600]]
| 4.831
| 7482
| 0.646
| 2
| 2
| 2015/6/12 16:25
|-
|[[Os08g0531600|'''''OsSPL16''''']]
|[[Os08g0531600]]
| 4.818
| 4825
| 0.999
| 2
| 2
| 2014/5/27 23:11
|-
|[[Os06g0254700|'''''OsCLO-6''''']]
|[[Os06g0254700]]
| 4.802
| 7514
| 0.639
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os01g0615100|'''''OCPI2''''']]
|[[Os01g0615100]]
| 4.794
| 7379
| 0.65
| 2
| 2
| 2015/5/13 15:19
|-
|'''''[[HSF]]'''''
|
| 4.772
| 4781
| 0.998
| 2
| 2
| 2013/7/21 20:57
|-
|[[Os06g0125800|'''''OsBBI1''''']]
|[[Os06g0125800]]
| 4.629
| 9410
| 0.492
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os07g0628500|'''''OsbHLH1''''']]
|[[Os07g0628500]]
| 4.606
| 8573
| 0.537
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os07g0694700|'''''APX''''']]
|[[Os07g0694700]]
| 4.569
| 8480
| 0.539
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os01g0293100|'''''TIP2''''']]
|[[Os01g0293100]]
| 4.568
| 8480
| 0.539
| 2
| 2
| 2015/5/13 15:12
|-
|'''''[[Rl14]]'''''
|
| 4.564
| 4764
| 0.958
| 2
| 2
| 2014/6/10 11:19
|-
|'''''[[OsRPA2]]'''''
|
| 4.552
| 4552
| 1
| 1
| 1
| 2014/6/6 9:13
|-
|[[Os06g0604000|'''''OsWR2''''']]
|[[Os06g0604000]]
| 4.53
| 8229
| 0.55
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os01g0192000|'''''OsDOS''''']]
|[[Os01g0192000]]
| 4.527
| 4527
| 1
| 1
| 1
| 2015/7/30 23:13
|-
|[[Os01g0922800|'''''OsMADS51''''']]
|[[Os01g0922800]]
| 4.506
| 4506
| 1
| 1
| 1
| 2014/5/24 18:45
|-
|[[Os02g0787300|'''''OsRac1''''']]
|[[Os02g0787300]]
| 4.483
| 6886
| 0.651
| 2
| 2
| 2015/5/14 14:01
|-
|[[Os09g0439200|'''''OsJAZ8''''']]
|[[Os09g0439200]]
| 4.477
| 8745
| 0.512
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0822900|'''''Dwarf1''''']]
|[[Os01g0822900]]
| 4.447
| 7550
| 0.589
| 3
| 4
| 2015/5/13 15:36
|-
|[[Os08g0167500|'''''CRR6''''']]
|[[Os08g0167500]]
| 4.432
| 8906
| 0.498
| 2
| 2
| 2015/6/12 17:27
|-
|'''''[[Sucrose_synthase]]'''''
|
| 4.428
| 4436
| 0.998
| 2
| 2
| 2013/7/18 11:20
|-
|'''''[[CL971152]]'''''
|
| 4.417
| 4472
| 0.988
| 2
| 2
| 2014/6/10 21:51
|-
|[[Os12g0603700|'''''OsCIPK04''''']]
|[[Os12g0603700]]
| 4.375
| 9322
| 0.469
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os02g0618400|'''''OsMPS''''']]
|[[Os02g0618400]]
| 4.347
| 8707
| 0.499
| 2
| 2
| 2015/5/14 13:45
|-
|[[Os03g0182800|'''''OsDERF1''''']]
|[[Os03g0182800]]
| 4.322
| 6519
| 0.663
| 2
| 2
| 2015/6/12 13:05
|-
|'''''[[ARF]]'''''
|
| 4.308
| 4308
| 1
| 1
| 1
| 2013/7/21 20:46
|-
|[[Os03g0183000|'''''OsRAF''''']]
|[[Os03g0183000]]
| 4.286
| 4286
| 1
| 1
| 1
| 2014/6/9 20:10
|-
|[[Os02g0654700|'''''AP59''''']]
|[[Os02g0654700]]
| 4.285
| 8306
| 0.516
| 2
| 2
| 2015/5/14 13:49
|-
|[[Os09g0466400|'''''OsZHD1''''']]
|[[Os09g0466400]]
| 4.265
| 8095
| 0.527
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os03g0103300|'''''qLTG3''''']]
|[[Os03g0103300]]
| 4.188
| 7457
| 0.562
| 2
| 2
| 2015/6/12 12:56
|-
|[[Os01g0834400|'''''OsHAP3A''''']]
|[[Os01g0834400]]
| 4.109
| 4109
| 1
| 1
| 1
| 2014/5/31 19:19
|-
|[[Os07g0512200|'''''OsAtg8''''']]
|[[Os07g0512200]]
| 4.095
| 7690
| 0.533
| 4
| 4
| 2015/6/12 16:43
|-
|'''''[[Bph9]]'''''
|
| 4.084
| 4084
| 1
| 1
| 1
| 2014/6/9 12:23
|-
|[[Os06g0181700|'''''OsWR1''''']]
|[[Os06g0181700]]
| 4.083
| 7433
| 0.549
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os06g0157500|'''''RFT1''''']]
|[[Os06g0157500]]
| 4.013
| 7888
| 0.509
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os09g0537700|'''''OsRNS4''''']]
|[[Os09g0537700]]
| 3.992
| 6731
| 0.593
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os02g0610500|'''''OsCOL4''''']]
|[[Os02g0610500]]
| 3.946
| 3946
| 1
| 1
| 1
| 2014/5/20 11:57
|-
|[[Os07g0529600|'''''OsDR8''''']]
|[[Os07g0529600]]
| 3.915
| 6908
| 0.567
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0106700|'''''AKT1''''']]
|[[Os09g0106700]]
| 3.845
| 6498
| 0.592
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os07g0568700|'''''OsFOR1''''']]
|[[Os07g0568700]]
| 3.845
| 6600
| 0.583
| 2
| 2
| 2015/6/12 16:46
|-
|[[Os12g0123700|'''''NAC''''']]
|[[Os12g0123700]]
| 3.826
| 6076
| 0.63
| 4
| 4
| 2015/6/13 17:16
|-
|'''''[[Pik-p]]'''''
|
| 3.816
| 3816
| 1
| 1
| 1
| 2014/6/6 10:16
|-
|[[Os06g0493100|'''''Bphi008a''''']]
|[[Os06g0493100]]
| 3.804
| 7241
| 0.525
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os02g0552700|'''''OsZFP6''''']]
|[[Os02g0552700]]
| 3.779
| 6604
| 0.572
| 2
| 2
| 2015/5/14 13:43
|-
|[[Os12g0100500|'''''COG2267''''']]
|[[Os12g0100500]]
| 3.729
| 5669
| 0.658
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os07g0129200|'''''OsPR1''''']]
|[[Os07g0129200]]
| 3.716
| 6629
| 0.561
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os10g0558900|'''''RL14''''']]
|[[Os10g0558900]]
| 3.699
| 7398
| 0.5
| 5
| 9
| 2015/6/13 16:57
|-
|[[Os01g0177400|'''''ACO1''''']]
|[[Os01g0177400]]
| 3.693
| 6293
| 0.587
| 3
| 3
| 2015/5/13 14:57
|-
|[[Os09g0380200|'''''YLC1''''']]
|[[Os09g0380200]]
| 3.69
| 6890
| 0.536
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os08g0163400|'''''OsSIG1''''']]
|[[Os08g0163400]]
| 3.662
| 3662
| 1
| 1
| 1
| 2014/6/9 20:52
|-
|[[Os09g0396900|'''''OsVIT2''''']]
|[[Os09g0396900]]
| 3.437
| 6527
| 0.527
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g0786400|'''''OsCKX2''''']]
|[[Os03g0786400]]
| 3.372
| 3372
| 1
| 1
| 1
| 2014/5/20 0:08
|-
|'''''[[Bhp-3]]'''''
|
| 3.33
| 3330
| 1
| 1
| 1
| 2014/5/31 23:33
|-
|[[Os07g0641200|'''''OsCCaMK''''']]
|[[Os07g0641200]]
| 3.212
| 6389
| 0.503
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0549600|'''''UDT1''''']]
|[[Os07g0549600]]
| 3.204
| 5875
| 0.545
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os11g0582500|'''''OsC6''''']]
|[[Os11g0582500]]
| 3.13
| 5666
| 0.552
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os03g0135700|'''''RAI1''''']]
|[[Os03g0135700]]
| 3.126
| 3126
| 1
| 1
| 1
| 2014/6/7 0:43
|-
|[[Os09g0459200|'''''SG1''''']]
|[[Os09g0459200]]
| 3.094
| 5090
| 0.608
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os11g0523700|'''''OsICE1''''']]
|[[Os11g0523700]]
| 3.071
| 3079
| 0.997
| 2
| 2
| 2014/6/3 13:41
|-
|[[Os09g0522200|'''''OsDREB1A''''']]
|[[Os09g0522200]]
| 3.031
| 5920
| 0.512
| 3
| 3
| 2015/6/12 22:36
|-
|[[Os06g0127100|'''''OsDREB1C''''']]
|[[Os06g0127100]]
| 3.015
| 5846
| 0.516
| 3
| 3
| 2015/6/12 16:02
|-
|[[Os10g0573400|'''''OsPYL10''''']]
|[[Os10g0573400]]
| 3.009
| 6148
| 0.489
| 4
| 4
| 2015/6/13 16:58
|-
|[[Os01g0274800|'''''CSA''''']]
|[[Os01g0274800]]
| 2.805
| 2805
| 1
| 1
| 1
| 2014/5/28 21:34
|-
|[[BGIOSGA033504|'''''csld4''''']]
|[[BGIOSGA033504]]
| 2.803
| 2818
| 0.995
| 2
| 2
| 2014/6/3 16:43
|-
|[[Os11g0454000|'''''rab16c''''']]
|[[Os11g0454000]]
| 2.786
| 5342
| 0.522
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os10g0148000|'''''OsDIL''''']]
|[[Os10g0148000]]
| 2.697
| 5106
| 0.528
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os08g0566600|'''''PGR5''''']]
|[[Os08g0566600]]
| 2.632
| 4314
| 0.61
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os03g0150200|'''''OsAP23''''']]
|[[Os03g0150200]]
| 2.621
| 5115
| 0.512
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os05g0341600|'''''RAB21''''']]
|[[Os05g0341600]]
| 2.592
| 2640
| 0.982
| 2
| 3
| 2014/6/1 17:02
|-
|[[Os07g0191600|'''''STR2''''']]
|[[Os07g0191600]]
| 2.541
| 2541
| 1
| 1
| 1
| 2014/6/11 19:08
|-
|[[Os11g0208900|'''''xa5''''']]
|[[Os11g0208900]]
| 2.152
| 2152
| 1
| 1
| 1
| 2014/6/8 17:23
|-
|[[Os07g0492000|'''''OsNDPK1''''']]
|[[Os07g0492000]]
| 1.777
| 1777
| 1
| 1
| 1
| 2014/6/9 23:45
|-
|[[Os03g0741100|'''''OsbHLH148''''']]
|[[Os03g0741100]]
| 1.578
| 1578
| 1
| 1
| 1
| 2014/5/19 3:18
|}

Os06g0665800

2017-03-08T06:18:33Z

Xysj1981: Replaced content with "Please input one-sentence summary here. ==Annotated Information== ===Function=== ===Expression=== ===Evolution=== Please input evolution information here. ==Labs wor..."

Please input one-sentence summary here.

==Annotated Information==
===Function===

===Expression===

===Evolution===
Please input evolution information here.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 6]]
[[Category:Chromosome 6]]

RiceWiki:Curated Genes

2017-03-08T06:17:46Z

Xysj1981:

{|class="wikitable sortable" style="width:90%;text-align:center"
|-
!'''Gene Symbol'''
!'''RAP-DB-ID'''
!'''Total Contribution Score'''
!'''Summed Edit Quantity'''
!'''Averaged Edit Quality'''
!'''Contributor Count'''
!'''Edit Count*'''
!'''Last Edit Time'''
|-
|[[Os09g0114500|'''''BC12''''']]
|[[Os09g0114500]]
| 14.854
| 23746
| 0.626
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os10g0405500|'''''PAIR3''''']]
|[[Os10g0405500]]
| 10.742
| 10877
| 0.988
| 3
| 3
| 2014/6/8 23:39
|-
|[[Os09g0286400|'''''OsNHX5''''']]
|[[Os09g0286400]]
| 12.133
| 24113
| 0.503
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0306400|'''''OsbZIP71''''']]
|[[Os09g0306400]]
| 7.71
| 12551
| 0.614
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0417600|'''''OsWRKY76''''']]
|[[Os09g0417600]]
| 5.713
| 10209
| 0.56
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os09g0434200|'''''OsDSG1''''']]
|[[Os09g0434200]]
| 5.792
| 11879
| 0.488
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os10g0553300|'''''OsTPP2''''']]
|[[Os10g0553300]]
| 8.403
| 35721
| 0.235
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os10g0563600|'''''OsMSRA4.1''''']]
|[[Os10g0563600]]
| 7.778
| 13380
| 0.581
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0127600|'''''ONAC045''''']]
|[[Os11g0127600]]
| 7.065
| 12576
| 0.562
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os11g0648000|'''''OsNHX3''''']]
|[[Os11g0648000]]
| 7.638
| 15767
| 0.484
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os12g0569700|'''''OsHsp23.7''''']]
|[[Os12g0569700]]
| 6.412
| 13859
| 0.463
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os12g0583700|'''''ZFP252''''']]
|[[Os12g0583700]]
| 8.489
| 12862
| 0.66
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os08g0139000|'''''OsDEG10''''']]
|[[Os08g0139000]]
| 4.811
| 9008
| 0.534
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os08g0323700|'''''OsCCC1''''']]
|[[Os08g0323700]]
| 6.709
| 11315
| 0.593
| 2
| 2
| 2015/6/12 17:29
|-
|[[Os08g0441100|'''''OsCIPK06''''']]
|[[Os08g0441100]]
| 3.819
| 7418
| 0.515
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os08g0504700|'''''OsSAP11''''']]
|[[Os08g0504700]]
| 7.149
| 10763
| 0.664
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0540400|'''''OsCPK21''''']]
|[[Os08g0540400]]
| 10.561
| 19732
| 0.535
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os08g0546800|'''''OsHsfB2b''''']]
|[[Os08g0546800]]
| 12.399
| 23039
| 0.538
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os07g0186000|'''''OsTRXh1''''']]
|[[Os07g0186000]]
| 7.817
| 12275
| 0.637
| 2
| 2
| 2015/6/12 16:34
|-
|[[Os07g0556800|'''''OSRIP18''''']]
|[[Os07g0556800]]
| 8.473
| 12924
| 0.656
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os07g0666900|'''''OsNHX1''''']]
|[[Os07g0666900]]
| 11.455
| 21522
| 0.532
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0678600|'''''OsCIPK2''''']]
|[[Os07g0678600]]
| 5.575
| 11240
| 0.496
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0693800|'''''OsFAD8''''']]
|[[Os07g0693800]]
| 5.613
| 11290
| 0.497
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os06g0130100|'''''OsSIK1''''']]
|[[Os06g0130100]]
| 11.48
| 22964
| 0.5
| 2
| 2
| 2015/6/12 16:04
|-
|[[Os06g0472000|'''''OsMSRB1.1''''']]
|[[Os06g0472000]]
| 6.592
| 12098
| 0.545
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os06g0561000|'''''OsMIOX''''']]
|[[Os06g0561000]]
| 6.249
| 12468
| 0.501
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os06g0603600|'''''OsSPX1''''']]
|[[Os06g0603600]]
| 7.774
| 15383
| 0.505
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os06g0612800|'''''OsiSAP8''''']]
|[[Os06g0612800]]
| 8.934
| 14002
| 0.638
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0644200|'''''OVP1''''']]
|[[Os06g0644200]]
| 10.007
| 15443
| 0.648
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0651100|'''''YK1''''']]
|[[Os06g0651100]]
| 8.803
| 18547
| 0.475
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0662200|'''''OsbZIP52''''']]
|[[Os06g0662200]]
| 6.942
| 12388
| 0.56
| 2
| 2
| 2015/6/12 16:22
|-
|[[Os06g0727200|'''''OsCATB''''']]
|[[Os06g0727200]]
| 6.864
| 13184
| 0.521
| 2
| 2
| 2015/6/12 16:27
|-
|[[Os03g0117900|'''''HYR''''']]
|[[Os03g0117900]]
| 5.381
| 8815
| 0.61
| 2
| 2
| 2015/6/12 12:59
|-
|[[Os09g0457900|'''''OsEATB''''']]
|[[Os09g0457900]]
| 42.219
| 42219
| 1
| 1
| 1
| 2014/6/6 14:12
|-
|[[Os06g0208800|'''''LYP6''''']]
|[[Os06g0208800]]
| 35.205
| 40853
| 0.862
| 2
| 2
| 2015/6/12 16:09
|-
|[[Os11g0587000|'''''DWARF27''''']]
|[[Os11g0587000]]
| 31.862
| 34044
| 0.936
| 2
| 4
| 2014/6/9 2:23
|-
|'''''[[GW5]]'''''
|
| 31.812
| 31817
| 1
| 2
| 2
| 2014/6/8 22:47
|-
|[[Os03g0122600|'''''OsMADS50''''']]
|[[Os03g0122600]]
| 31.778
| 36672
| 0.867
| 2
| 2
| 2015/6/12 13:00
|-
|'''''[[Du1]]'''''
|
| 26.789
| 26797
| 1
| 2
| 2
| 2014/6/5 11:51
|-
|[[Os01g0771200|'''''XB24''''']]
|[[Os01g0771200]]
| 25.112
| 106499
| 0.236
| 3
| 14
| 2015/5/13 15:32
|-
|'''''[[IPA1]]'''''
|
| 22.636
| 22636
| 1
| 1
| 1
| 2014/6/1 14:57
|-
|'''''[[AB013448]]'''''
|
| 21.65
| 21650
| 1
| 1
| 1
| 2014/6/8 17:24
|-
|[[Os10g0542100|'''''MT''''']]
|[[Os10g0542100]]
| 21.515
| 25382
| 0.848
| 3
| 3
| 2015/6/13 16:56
|-
|'''''[[MADS]]'''''
|
| 21.305
| 21310
| 1
| 3
| 3
| 2014/6/7 19:11
|-
|'''''[[MYB]]'''''
|
| 21.082
| 21418
| 0.984
| 2
| 2
| 2013/7/16 10:48
|-
|[[Os09g0272900|'''''PB''''']]
|[[Os09g0272900]]
| 21.033
| 24405
| 0.862
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os01g0848400|'''''qSH1''''']]
|[[Os01g0848400]]
| 20.688
| 31733
| 0.652
| 2
| 2
| 2015/5/13 15:40
|-
|[[Os09g0441900|'''''OsDEP1''''']]
|[[Os09g0441900]]
| 18.815
| 18855
| 0.998
| 5
| 5
| 2014/6/11 0:23
|-
|[[Os09g0240200|'''''CONSTANS''''']]
|[[Os09g0240200]]
| 18.077
| 26433
| 0.684
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os04g0271200|'''''SRT701''''']]
|[[Os04g0271200]]
| 18.041
| 18413
| 0.98
| 5
| 9
| 2014/6/10 16:01
|-
|[[Os01g0678500|'''''OsTPC1''''']]
|[[Os01g0678500]]
| 17.989
| 29118
| 0.618
| 6
| 7
| 2015/5/13 15:24
|-
|[[Os03g0332400|'''''OsGLYII-2''''']]
|[[Os03g0332400]]
| 17.603
| 17603
| 1
| 1
| 1
| 2014/12/27 21:46
|-
|[[Os06g0196700|'''''OsARF16'''''']]
|[[Os06g0196700]]
| 17.411
| 28849
| 0.604
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os07g0261200|'''''Ghd7''''']]
|[[Os07g0261200]]
| 17.077
| 17414
| 0.981
| 2
| 2
| 2014/6/1 17:56
|-
|'''''[[Xa7]]'''''
|
| 16.58
| 16580
| 1
| 1
| 1
| 2014/5/30 14:34
|-
|[[Os03g0227700|'''''OsDWARF4''''']]
|[[Os03g0227700]]
| 16.238
| 28577
| 0.568
| 4
| 6
| 2015/6/12 13:36
|-
|'''''[[Pb1]]'''''
|
| 15.987
| 15987
| 1
| 1
| 1
| 2014/6/3 15:06
|-
|[[Os12g0597000|'''''CBL''''']]
|[[Os12g0597000]]
| 15.897
| 25737
| 0.618
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os01g0841500|'''''OsMYB3R2''''']]
|[[Os01g0841500]]
| 15.635
| 27885
| 0.561
| 3
| 4
| 2015/5/13 15:39
|-
|[[Os01g0182600|'''''GI''''']]
|[[Os01g0182600]]
| 14.75
| 22705
| 0.65
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os08g0162100|'''''ASP1''''']]
|[[Os08g0162100]]
| 14.743
| 14743
| 1
| 1
| 1
| 2015/6/12 17:26
|-
|[[Os02g0738900|'''''OsDRP2B''''']]
|[[Os02g0738900]]
| 14.365
| 21439
| 0.67
| 2
| 2
| 2015/5/14 13:58
|-
|[[Os06g0594600|'''''OsAt10''''']]
|[[Os06g0594600]]
| 14.147
| 19008
| 0.744
| 3
| 4
| 2015/6/12 16:17
|-
|[[Os01g57340|'''''Npi37''''']]
|[[Os01g57340]]
| 14.08
| 14080
| 1
| 1
| 1
| 2014/5/27 20:22
|-
|[[Os01g0718300|'''''OsBRI1''''']]
|[[Os01g0718300]]
| 14.008
| 25923
| 0.54
| 3
| 3
| 2015/5/13 15:26
|-
|'''''[[Du2]]'''''
|
| 13.964
| 13964
| 1
| 2
| 2
| 2014/6/5 11:53
|-
|'''''[[OsMYB103L]]'''''
|
| 13.96
| 13960
| 1
| 1
| 1
| 2014/6/11 16:14
|-
|[[Os01g0782100|''''' Pi-sh''''']]
|[[Os01g0782100]]
| 13.897
| 27151
| 0.512
| 3
| 3
| 2015/5/13 15:34

|-
|[[Os06g0706400|'''''OsPTR9''''']]
|[[Os06g0706400]]
| 13.739
| 20020
| 0.686
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os08g0398400|'''''OsHIR1''''']]
|[[Os08g0398400]]
| 13.721
| 13748
| 0.998
| 3
| 6
| 2014/6/3 16:40
|-
|[[Os02g0141300|'''''CAP1''''']]
|[[Os02g0141300]]
| 13.71
| 28137
| 0.487
| 5
| 10
| 2015/5/14 13:21
|-
|[[Os07g0214100|'''''RAG1''''']]
|[[Os07g0214100]]
| 13.62
| 31302
| 0.435
| 2
| 2
| 2015/6/12 16:36
|-
|'''''[[DWT1]]'''''
|
| 13.275
| 13275
| 1
| 1
| 1
| 2014/5/31 12:55
|-
|[[Os01g0797600|'''''OsERF3''''']]
|[[Os01g0797600]]
| 13.247
| 13247
| 1
| 1
| 1
| 2014/5/25 15:17
|-
|[[Os01g0883800|'''''semidwarf-1''''']]
|[[Os01g0883800]]
| 13.17
| 24896
| 0.529
| 16
| 41
| 2016/6/17 17:22
|-
|[[Os08g0524100|'''''OsSRT1''''']]
|[[Os08g0524100]]
| 13.001
| 18711
| 0.695
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os08g0559300|'''''SPINDLY''''']]
|[[Os08g0559300]]
| 12.718
| 21018
| 0.605
| 3
| 6
| 2015/6/12 17:35
|-
|[[Os11g0225300|'''''PAMP''''']]
|[[Os11g0225300]]
| 12.691
| 23520
| 0.54
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os07g0155600|'''''OsEIN2''''']]
|[[Os07g0155600]]
| 12.605
| 18316
| 0.688
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os01g0607200|'''''OsBAT1''''']]
|[[Os01g0607200]]
| 12.553
| 19986
| 0.628
| 2
| 2
| 2015/5/13 15:17
|-
|[[Os07g0616800|'''''SUS''''']]
|[[Os07g0616800]]
| 12.42
| 26693
| 0.465
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os12g0102400|'''''OsRINGC2-2''''']]
|[[Os12g0102400]]
| 12.278
| 17739
| 0.692
| 3
| 3
| 2015/6/13 17:13
|-
|'''''[[WRKY]]'''''
|
| 12.226
| 12233
| 0.999
| 2
| 2
| 2014/5/31 12:44
|-
|[[Os10g0536100|'''''OsMADS50''''']]
|[[Os10g0536100]]
| 11.96
| 19080
| 0.627
| 3
| 3
| 2015/6/13 16:52
|-
|[[Os02g0725900|'''''HAP3''''']]
|[[Os02g0725900]]
| 11.931
| 16469
| 0.724
| 2
| 2
| 2015/5/14 13:55
|-
|[[Os01g0626400|'''''OsWRKY11''''']]
|[[Os01g0626400]]
| 11.902
| 18881
| 0.63
| 2
| 2
| 2015/5/13 15:20
|-
|[[Os01g0726400|'''''CFO1''''']]
|[[Os01g0726400]]
| 11.891
| 17625
| 0.675
| 2
| 2
| 2015/5/13 15:27
|-
|[[Os09g0422500|'''''OsCESA9''''']]
|[[Os09g0422500]]
| 11.747
| 23511
| 0.5
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os09g0250700|'''''OsABC1-12''''']]
|[[Os09g0250700]]
| 11.742
| 15681
| 0.749
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os06g0701300|'''''OsABC1-8''''']]
|[[Os06g0701300]]
| 11.604
| 15691
| 0.74
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0126400|'''''OsCPK4''''']]
|[[Os02g0126400]]
| 11.6
| 22962
| 0.505
| 2
| 2
| 2015/5/14 13:20
|-
|[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]
|[[Os06g0570100]]
| 11.586
| 15710
| 0.737
| 3
| 3
| 2015/6/12 16:16
|-
|[[Os03g0793500|'''''Hd16''''']]
|[[Os03g0793500]]
| 11.531
| 15843
| 0.728
| 2
| 2
| 2015/5/15 13:43
|-
|[[Os01g0536000|'''''OsCIPK08''''']]
|[[Os01g0536000]]
| 11.52
| 15150
| 0.76
| 2
| 2
| 2015/5/13 15:15
|-
|[[Os03g0848700|'''''Bph14''''']]
|[[Os03g0848700]]
| 11.486
| 21573
| 0.532
| 4
| 4
| 2015/5/15 13:41
|-
|[[Os01g0907900|'''''PLA2''''']]
|[[Os01g0907900]]
| 11.483
| 11485
| 1
| 2
| 2
| 2014/6/2 17:56
|-
|[[Os07g0459200|'''''OsABC1-10''''']]
|[[Os07g0459200]]
| 11.449
| 15381
| 0.744
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os07g0102300|'''''SRL1''''']]
|[[Os07g0102300]]
| 11.423
| 22326
| 0.512
| 3
| 3
| 2015/6/12 16:30
|-
|[[Os07g0186200|'''''OsSIK2''''']]
|[[Os07g0186200]]
| 11.413
| 20165
| 0.566
| 3
| 3
| 2015/6/12 16:34
|-
|[[Os03g0226800|'''''CMT3''''']]
|[[Os03g0226800]]
| 11.245
| 21415
| 0.525
| 3
| 3
| 2015/6/12 13:36
|-
|[[Os08g0114200|'''''OsGLU3''''']]
|[[Os08g0114200]]
| 11.137
| 17754
| 0.627
| 2
| 2
| 2015/6/12 17:23
|-
|[[Os07g0596300|'''''FH5''''']]
|[[Os07g0596300]]
| 11.085
| 15490
| 0.716
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os02g0178800|'''''OsGL1-2''''']]
|[[Os02g0178800]]
| 11.079
| 14720
| 0.753
| 2
| 2
| 2015/5/14 13:23
|-
|[[Os03g0811100|''''' Chl1''''']]
|[[Os03g0811100]]
| 11.068
| 14957
| 0.74
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os09g0395300|'''''SLL1''''']]
|[[Os09g0395300]]
| 11.063
| 16461
| 0.672
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g03150|'''''TAD1''''']]
|[[Os03g03150]]
| 10.972
| 10972
| 1
| 1
| 1
| 2014/6/9 12:35
|-
|[[Os12g0189500|'''''OsYUC11''''']]
|[[Os12g0189500]]
| 10.931
| 20645
| 0.529
| 7
| 7
| 2015/6/13 17:16
|-
|[[Os06g0211200|'''''OsAREB1''''']]
|[[Os06g0211200]]
| 10.925
| 19995
| 0.546
| 5
| 6
| 2015/6/12 16:09
|-
|[[Os02g0100200|'''''HSP''''']]
|[[Os02g0100200]]
| 10.917
| 21797
| 0.501
| 2
| 2
| 2015/5/14 13:17
|-
|'''''[[BHLH]]'''''
|
| 10.829
| 10829
| 1
| 1
| 1
| 2013/7/21 20:47
|-
|[[Os11g0703900|'''''Hsp70''''']]
|[[Os11g0703900]]
| 10.813
| 10898
| 0.992
| 4
| 5
| 2014/6/9 23:54
|-
|[[Os01g44260|'''''OsDfr''''']]
|[[Os01g44260]]
| 10.787
| 10787
| 1
| 1
| 1
| 2014/6/9 21:48
|-
|[[Os03g0815100|'''''SNAC1''''']]
|[[Os03g0815100]]
| 10.722
| 15783
| 0.679
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os10g0561400|'''''OsMYBS3''''']]
|[[Os10g0561400]]
| 10.656
| 22236
| 0.479
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0523800|'''''OsARF1''''']]
|[[Os11g0523800]]
| 10.633
| 21943
| 0.485
| 6
| 6
| 2015/6/13 17:08
|-
|[[Os07g0257200|'''''OsNRAMP5''''']]
|[[Os07g0257200]]
| 10.556
| 10556
| 1
| 1
| 1
| 2015/6/12 16:38
|-
|[[Os02g0661100|'''''OsTPP1''''']]
|[[Os02g0661100]]
| 10.544
| 18837
| 0.56
| 2
| 2
| 2015/5/14 13:51
|-
|[[Os07g0164000|'''''WAF1''''']]
|[[Os07g0164000]]
| 10.534
| 11864
| 0.888
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os12g0476200|'''''Xa25''''']]
|[[Os12g0476200]]
| 10.44
| 17073
| 0.611
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os10g0497300|'''''Rf1a''''']]
|[[Os10g0497300]]
| 10.431
| 18232
| 0.572
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os07g0108900|'''''OsMADS15''''']]
|[[Os07g0108900]]
| 10.425
| 20545
| 0.507
| 4
| 5
| 2015/6/12 16:31
|-
|[[Os03g0215400|'''''MADS1''''']]
|[[Os03g0215400]]
| 10.412
| 14715
| 0.708
| 2
| 2
| 2015/6/12 13:34
|-
|[[Os08g0174700|'''''OsSERK1''''']]
|[[Os08g0174700]]
| 10.335
| 21519
| 0.48
| 2
| 2
| 2015/6/12 17:28
|-
|[[Os01g0121700|'''''OsWBC1''''']]
|[[Os01g0121700]]
| 10.278
| 14300
| 0.719
| 2
| 2
| 2015/5/13 14:49
|-
|[[Os01g0201700|'''''OsMADS3''''']]
|[[Os01g0201700]]
| 10.276
| 20440
| 0.503
| 2
| 2
| 2015/5/13 15:03
|-
|[[Os10g0577600|'''''JMJ706''''']]
|[[Os10g0577600]]
| 10.16
| 18081
| 0.562
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0839100|'''''ZFP179''''']]
|[[Os01g0839100]]
| 10.128
| 13298
| 0.762
| 2
| 2
| 2015/5/13 15:38
|-
|[[Os03g0237250|'''''LPA1''''']]
|[[Os03g0237250]]
| 10.125
| 14184
| 0.714
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0133000|'''''Waxy''''']]
|[[Os06g0133000]]
| 10.084
| 22204
| 0.454
| 3
| 3
| 2015/6/12 16:04
|-
|[[Os03g0805100|'''''SQS''']]
|[[Os03g0805100]]
| 10.051
| 13542
| 0.742
| 2
| 2
| 2015/5/15 13:42
|-
|'''''[[AB013449]]'''''
|
| 10.03
| 10030
| 1
| 1
| 1
| 2014/6/10 22:14
|-
|[[Os07g0605200|'''''OsMADS18''''']]
|[[Os07g0605200]]
| 10.027
| 19041
| 0.527
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os06g0194900|'''''Sus''''']]
|[[Os06g0194900]]
| 10.026
| 20580
| 0.487
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os01g0764800|'''''GH3''''']]
|[[Os01g0764800]]
| 10.024
| 18674
| 0.537
| 2
| 2
| 2015/5/13 15:32
|-
|[[Os03g0111300|'''''NsLTPs''''']]
|[[Os03g0111300]]
| 10.013
| 12909
| 0.776
| 4
| 4
| 2015/6/12 12:57
|-
|[[Os10g0127900|'''''OsFbx352''''']]
|[[Os10g0127900]]
| 10.013
| 20618
| 0.486
| 4
| 8
| 2015/6/13 16:43
|-
|[[Os06g0662000|'''''OsVHA-A''''']]
|[[Os06g0662000]]
| 9.949
| 19796
| 0.503
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0254600|'''''CALEOSIN''''']]
|[[Os06g0254600]]
| 9.94
| 12129
| 0.82
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os06g0330100|'''''Pi-25''''']]
|[[Os06g0330100]]
| 9.935
| 18990
| 0.523
| 4
| 5
| 2015/6/12 16:13
|-
|[[Os06g0603000|'''''SE5''''']]
|[[Os06g0603000]]
| 9.889
| 9889
| 1
| 1
| 1
| 2014/6/9 17:03
|-
|[[Os08g0535200|'''''xa13''''']]
|[[Os08g0535200]]
| 9.858
| 18774
| 0.525
| 3
| 3
| 2015/6/12 17:34
|-
|[[Os12g0281300|'''''Pi-ta''''']]
|[[Os12g0281300]]
| 9.857
| 21855
| 0.451
| 4
| 4
| 2015/6/13 17:16
|-
|[[Os01g0919400|'''''SPS''''']]
|[[Os01g0919400]]
| 9.837
| 9837
| 1
| 1
| 1
| 2016/6/6 17:48
|-
|[[Os10g0573900|'''''OsNMD3''''']]
|[[Os10g0573900]]
| 9.818
| 16399
| 0.599
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0197100|'''''dwarf2''''']]
|[[Os01g0197100]]
| 9.81
| 19279
| 0.509
| 5
| 6
| 2015/5/13 14:59
|-
|[[Os11g0216300|'''''OsABC1-13''''']]
|[[Os11g0216300]]
| 9.795
| 13761
| 0.712
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os01g0102900|'''''Os-LIR1''''']]
|[[Os01g0102900]]
| 9.726
| 9726
| 1
| 1
| 1
| 2016/6/12 14:04
|-
|[[Os11g0249000|'''''NLS1''''']]
|[[Os11g0249000]]
| 9.718
| 17393
| 0.559
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os10g0467800|'''''OsCesA7''''']]
|[[Os10g0467800]]
| 9.68
| 22133
| 0.437
| 5
| 6
| 2015/6/13 16:48
|-
|[[Os02g0682200|'''''MADS6''''']]
|[[Os02g0682200]]
| 9.577
| 17192
| 0.557
| 3
| 13
| 2015/5/14 13:53
|-
|[[Os06g0569500|'''''GAs''''']]
|[[Os06g0569500]]
| 9.526
| 18834
| 0.506
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os09g0456800|'''''OsHsfs''''']]
|[[Os09g0456800]]
| 9.468
| 13735
| 0.689
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0274900|'''''OsGMST1''''']]
|[[Os02g0274900]]
| 9.449
| 18241
| 0.518
| 2
| 2
| 2015/5/14 13:38
|-
|[[Os06g0724900|'''''ILA1''''']]
|[[Os06g0724900]]
| 9.361
| 19950
| 0.469
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os01g0611100|'''''OsRAN1''''']]
|[[Os01g0611100]]
| 9.349
| 15330
| 0.61
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os08g0509600|'''''OsSPL14''''']]
|[[Os08g0509600]]
| 9.346
| 17625
| 0.53
| 3
| 4
| 2015/6/12 17:32
|-
|[[Os07g0558000|'''''OsABC1-11''''']]
|[[Os07g0558000]]
| 9.337
| 13289
| 0.703
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0449000|'''''PTC1''''']]
|[[Os09g0449000]]
| 9.33
| 16966
| 0.55
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os04g0415000|'''''BY240''''']]
|[[Os04g0415000]]
| 9.31
| 9310
| 1
| 1
| 1
| 2014/6/6 19:55
|-
|[[Os07g0471000|'''''OsIRE1''''']]
|[[Os07g0471000]]
| 9.278
| 18586
| 0.499
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os03g0170900|'''''OsSUT1''''']]
|[[Os03g0170900]]
| 9.272
| 19337
| 0.479
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os06g0610300|'''''MOC1''''']]
|[[Os06g0610300]]
| 9.171
| 11979
| 0.766
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0583400|'''''OsHDAC702''''']]
|[[Os06g0583400]]
| 9.15
| 11481
| 0.797
| 2
| 2
| 2015/6/12 16:16
|-
|[[Os02g0622100|'''''LTG1''''']]
|[[Os02g0622100]]
| 9.147
| 12303
| 0.743
| 2
| 2
| 2015/5/14 13:47
|-
|[[Os03g0203200|'''''HTD2''''']]
|[[Os03g0203200]]
| 9.128
| 17233
| 0.53
| 4
| 4
| 2015/6/12 13:06
|-
|[[Os06g0660200|'''''OsPIN2''''']]
|[[Os06g0660200]]
| 9.119
| 20530
| 0.444
| 5
| 6
| 2015/6/12 16:21
|-
|[[Os10g0403000|'''''PLA1 ''''']]
|[[Os10g0403000]]
| 9.104
| 15463
| 0.589
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os03g0112700|'''''Ehd4''''']]
|[[Os03g0112700]]
| 9.094
| 17122
| 0.531
| 3
| 3
| 2015/6/12 12:58
|-
|[[Os02g0799100|'''''Ossgo1''''']]
|[[Os02g0799100]]
| 9.068
| 16095
| 0.563
| 3
| 6
| 2015/5/14 14:02
|-
|[[Os09g0307800|'''''SDG724''''']]
|[[Os09g0307800]]
| 9.029
| 11279
| 0.801
| 4
| 15
| 2014/6/6 8:56
|-
|[[Os08g0424500|'''''Badh2''''']]
|[[Os08g0424500]]
| 9.021
| 17768
| 0.508
| 3
| 3
| 2015/6/12 17:30
|-
|[[Os11g0184900|'''''OsNAC5''''']]
|[[Os11g0184900]]
| 9.016
| 15182
| 0.594
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0203700|'''''SRZ1''''']]
|[[Os02g0203700]]
| 9.003
| 12324
| 0.731
| 2
| 2
| 2015/5/14 13:26
|-
|[[Os06g0125000|'''''RPM1''''']]
|[[Os06g0125000]]
| 8.97
| 12695
| 0.707
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os03g0128700|'''''OsCDPK13''''']]
|[[Os03g0128700]]
| 8.928
| 17882
| 0.499
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os03g0215200|'''''DL''''']]
|[[Os03g0215200]]
| 8.927
| 14196
| 0.629
| 3
| 3
| 2015/6/12 13:07
|-
|[[Os01g0952800|'''''OsIRO2''''']]
|[[Os01g0952800]]
| 8.922
| 8922
| 1
| 1
| 1
| 2014/6/10 21:52
|-
|[[Os06g0494100|'''''Pi-d2''''']]
|[[Os06g0494100]]
| 8.906
| 12742
| 0.699
| 3
| 3
| 2015/6/12 16:14
|-
|[[Os03g0149100|'''''OsCrl1''''']]
|[[Os03g0149100]]
| 8.897
| 13456
| 0.661
| 3
| 4
| 2015/6/12 11:15
|-
|'''''[[BZIP]]'''''
|
| 8.894
| 8924
| 0.997
| 2
| 2
| 2013/7/21 21:01
|-
|[[Os06g0625900|'''''OsHAK10''''']]
|[[Os06g0625900]]
| 8.872
| 13033
| 0.681
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0229800|'''''ALK''''']]
|[[Os06g0229800]]
| 8.835
| 16807
| 0.526
| 2
| 2
| 2015/6/12 16:11
|-
|[[Os07g0232900|'''''OsHMA3''''']]
|[[Os07g0232900]]
| 8.79
| 18004
| 0.488
| 3
| 8
| 2015/6/12 16:37
|-
|[[Os07g0129700|'''''OSH15''''']]
|[[Os07g0129700]]
| 8.789
| 18504
| 0.475
| 3
| 3
| 2015/6/12 16:32
|-
|[[Os12g0641400|'''''OsSUT2''''']]
|[[Os12g0641400]]
| 8.735
| 8735
| 1
| 1
| 1
| 2016/6/12 13:56
|-
|[[Os08g0137100|'''''OsFIE2''''']]
|[[Os08g0137100]]
| 8.717
| 8717
| 1
| 1
| 1
| 2015/6/12 17:25
|-
|'''''[[Htd1]]'''''
|
| 8.705
| 8705
| 1
| 1
| 1
| 2014/6/10 14:14
|-
|[[Os03g0707600|'''''GAI''''']]
|[[Os03g0707600]]
| 8.666
| 16659
| 0.52
| 2
| 5
| 2014/5/28 0:43
|-
|'''''[[Xa23]]'''''
|
| 8.641
| 8641
| 1
| 1
| 1
| 2014/5/31 21:49
|-
|[[Os11g0235200|'''''SP1''''']]
|[[Os11g0235200]]
| 8.563
| 17156
| 0.499
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os07g0100600|'''''OsPTR1''''']]
|[[Os07g0100600]]
| 8.559
| 15027
| 0.57
| 2
| 2
| 2015/6/12 16:30
|-
|[[Os06g0597000|'''''OsIAA23''''']]
|[[Os06g0597000]]
| 8.509
| 16209
| 0.525
| 4
| 11
| 2014/5/19 22:42
|-
|[[Os02g0232100|'''''HEI10''''']]
|[[Os02g0232100]]
| 8.485
| 15567
| 0.545
| 2
| 2
| 2015/5/14 13:36
|-
|[[Os04g0452500|'''''ZEP1''''']]
|[[Os04g0452500]]
| 8.484
| 8484
| 1
| 1
| 1
| 2014/5/31 16:56
|-
|[[Os09g0363900|'''''ONI3''''']]
|[[Os09g0363900]]
| 8.473
| 12412
| 0.683
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os09g0426800|'''''WSL2''''']]
|[[Os09g0426800]]
| 8.447
| 9634
| 0.877
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0253300|'''''alpha-1a''''']]
|[[Os01g0253300]]
| 8.439
| 17745
| 0.476
| 5
| 5
| 2015/5/13 15:07
|-
|[[Os06g0683400|'''''OsCCD1''''']]
|[[Os06g0683400]]
| 8.438
| 8438
| 1
| 1
| 1
| 2016/6/12 14:00
|-
|[[Os09g0522000|'''''OsDREB''''']]
|[[Os09g0522000]]
| 8.335
| 8335
| 1
| 1
| 1
| 2014/5/24 21:12
|-
|[[Os02g0580300|'''''GID2''''']]
|[[Os02g0580300]]
| 8.329
| 15752
| 0.529
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os08g0499300|'''''OsWRKY30''''']]
|[[Os08g0499300]]
| 8.324
| 17032
| 0.489
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0445700|'''''TPS''''']]
|[[Os08g0445700]]
| 8.317
| 10922
| 0.761
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os10g0505700|'''''LTPs''''']]
|[[Os10g0505700]]
| 8.312
| 16220
| 0.512
| 5
| 6
| 2015/6/13 16:46
|-
|[[Os11g0559200|'''''OsXa21''''']]
|[[Os11g0559200]]
| 8.294
| 15586
| 0.532
| 6
| 9
| 2015/6/13 17:08
|-
|[[Os03g0179400|'''''GUDK''''']]
|[[Os03g0179400]]
| 8.292
| 14840
| 0.559
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os02g0553200|'''''OsAPx8''''']]
|[[Os02g0553200]]
| 8.204
| 8204
| 1
| 1
| 1
| 2014/6/8 16:03
|-
|[[Os01g0571300|'''''OsHsfA7''''']]
|[[Os01g0571300]]
| 8.184
| 14946
| 0.548
| 2
| 2
| 2015/5/13 15:16
|-
|[[Os09g0401100|'''''STR1''''']]
|[[Os09g0401100]]
| 8.183
| 17216
| 0.475
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os02g0181300|'''''WRKY''''']]
|[[Os02g0181300]]
| 8.174
| 13252
| 0.617
| 2
| 2
| 2015/5/14 13:24
|-
|[[Os05g0346200|'''''OsDREB2B2''''']]
|[[Os05g0346200]]
| 8.14
| 8233
| 0.989
| 2
| 3
| 2014/6/5 17:14
|-
|[[Os09g0502100|'''''LGD1''''']]
|[[Os09g0502100]]
| 8.139
| 15501
| 0.525
| 2
| 2
| 2015/6/12 22:35
|-
|[[Os03g0820300|'''''ZFP182''''']]
|[[Os03g0820300]]
| 8.137
| 11604
| 0.701
| 2
| 2
| 2015/5/15 13:41
|-
|[[Os03g0230300|'''''OsSRO1c''''']]
|[[Os03g0230300]]
| 8.029
| 15193
| 0.528
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os07g0438800|'''''OsPHR2''''']]
|[[Os07g0438800]]
| 8.026
| 15610
| 0.514
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os02g0534400|'''''OsCIN1''''']]
|[[Os02g0534400]]
| 7.997
| 16635
| 0.481
| 2
| 2
| 2015/5/14 13:41
|-
|[[Os06g0165600|'''''OsDREB1D''''']]
|[[Os06g0165600]]
| 7.982
| 11937
| 0.669
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os11g0490600|'''''LAZY1''''']]
|[[Os11g0490600]]
| 7.98
| 16603
| 0.481
| 4
| 5
| 2015/6/13 17:07
|-
|[[Os07g0585700|'''''Sdr4''''']]
|[[Os07g0585700]]
| 7.966
| 7966
| 1
| 1
| 1
| 2014/6/9 23:14
|-
|[[Os01g0194300|'''''OsNPR1''''']]
|[[Os01g0194300]]
| 7.966
| 11111
| 0.717
| 2
| 2
| 2015/5/13 14:59
|-
|[[Os01g0869900|'''''SNF1''''']]
|[[Os01g0869900]]
| 7.964
| 16289
| 0.489
| 2
| 2
| 2015/5/13 15:42
|-
|[[Os06g0160700|'''''SSSl''''']]
|[[Os06g0160700]]
| 7.962
| 15027
| 0.53
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os09g0451500|'''''PDI''''']]
|[[Os09g0451500]]
| 7.903
| 10040
| 0.787
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os01g0759400|'''''OsCIPK12''''']]
|[[Os01g0759400]]
| 7.902
| 15742
| 0.502
| 2
| 2
| 2015/5/13 15:30
|-
|[[Os06g0205100|'''''OsC1-Myb''''']]
|[[Os06g0205100]]
| 7.891
| 12914
| 0.611
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os09g0244900|'''''Ypt1p''''']]
|[[Os09g0244900]]
| 7.89
| 11371
| 0.694
| 2
| 2
| 2015/6/12 17:38
|-
|'''''[[HTD2]]'''''
|
| 7.887
| 7887
| 1
| 1
| 1
| 2014/6/4 22:20
|-
|[[Os09g0482400|'''''HSP82''''']]
|[[Os09g0482400]]
| 7.873
| 11843
| 0.665
| 2
| 2
| 2015/6/12 17:47
|-
|[[Os10g0478000|'''''TAW1''''']]
|[[Os10g0478000]]
| 7.871
| 12275
| 0.641
| 4
| 5
| 2015/6/13 16:47
|-
|[[Os07g0258400|'''''OsNRAMP1''''']]
|[[Os07g0258400]]
| 7.866
| 13708
| 0.574
| 2
| 2
| 2015/6/12 16:38
|-
|[[Os10g0445400|'''''OsHCI1''''']]
|[[Os10g0445400]]
| 7.848
| 15652
| 0.501
| 6
| 15
| 2015/6/13 16:48
|-
|[[Os01g0273800|'''''OsYUC9''''']]
|[[Os01g0273800]]
| 7.843
| 9988
| 0.785
| 2
| 2
| 2015/5/13 15:10
|-
|[[Os01g0643300|'''''OsPIN10a''''']]
|[[Os01g0643300]]
| 7.839
| 16276
| 0.482
| 3
| 3
| 2015/5/13 15:22
|-
|[[Os06g0286700|'''''Pi9''''']]
|[[Os06g0286700]]
| 7.816
| 16653
| 0.469
| 6
| 9
| 2015/6/12 16:13
|-
|[[Os11g0104300|'''''DWARF53''''']]
|[[Os11g0104300]]
| 7.791
| 11682
| 0.667
| 4
| 4
| 2015/6/13 17:00
|-
|[[Os07g0150700|'''''Os-AKT1''''']]
|[[Os07g0150700]]
| 7.79
| 15994
| 0.487
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os09g0494200|'''''BC15''''']]
|[[Os09g0494200]]
| 7.776
| 7776
| 1
| 1
| 1
| 2014/6/3 23:51
|-
|[[Os03g0181500|'''''ONI1''''']]
|[[Os03g0181500]]
| 7.751
| 12230
| 0.634
| 3
| 4
| 2015/6/12 13:05
|-
|[[Os02g0814200|'''''OsGL1-6''''']]
|[[Os02g0814200]]
| 7.743
| 13379
| 0.579
| 2
| 2
| 2015/5/14 14:03
|-
|[[Os02g0103800|'''''OsLFNR1''''']]
|[[Os02g0103800]]
| 7.686
| 7686
| 1
| 1
| 1
| 2016/6/12 14:12
|-
|[[Os11g0225100|'''''Pia''''']]
|[[Os11g0225100]]
| 7.669
| 12296
| 0.624
| 3
| 3
| 2015/6/13 17:04
|-
|'''''[[Pi1]]'''''
|
| 7.644
| 7644
| 1
| 1
| 1
| 2014/6/5 17:02
|-
|[[Os01g0307500|'''''SKC1''''']]
|[[Os01g0307500]]
| 7.639
| 7639
| 1
| 1
| 1
| 2014/6/7 21:57
|-
|'''''[[Chalk5]]'''''
|
| 7.635
| 7635
| 1
| 1
| 1
| 2014/5/29 11:10
|-
|[[Os08g0140300|'''''TDC''''']]
|[[Os08g0140300]]
| 7.633
| 13769
| 0.554
| 2
| 2
| 2015/6/12 17:26
|-
|[[Os07g0622900|'''''DTM1''''']]
|[[Os07g0622900]]
| 7.632
| 14288
| 0.534
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os01g0292200|'''''OsCIPK1''''']]
|[[Os01g0292200]]
| 7.626
| 12859
| 0.593
| 2
| 2
| 2015/5/13 15:11
|-
|[[Os03g0230500|'''''DSM3''''']]
|[[Os03g0230500]]
| 7.618
| 14126
| 0.539
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os12g0472500|'''''OsTDL1A''''']]
|[[Os12g0472500]]
| 7.581
| 13819
| 0.549
| 4
| 4
| 2015/6/13 17:17
|-
|[[Os03g0262900|'''''glup6''''']]
|[[Os03g0262900]]
| 7.571
| 15719
| 0.482
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0107700|'''''OsLFNR2''''']]
|[[Os06g0107700]]
| 7.533
| 7533
| 1
| 1
| 1
| 2016/6/6 9:33
|-
|[[Os02g57310|'''''Pib''''']]
|[[Os02g57310]]
| 7.531
| 7531
| 1
| 1
| 1
| 2014/6/6 14:27
|-
|[[Os09g0104200|'''''OsRAD51D''''']]
|[[Os09g0104200]]
| 7.502
| 15399
| 0.487
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os06g0142600|'''''Hd17''''']]
|[[Os06g0142600]]
| 7.492
| 11545
| 0.649
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os03g0788500|'''''OsCPK10''''']]
|[[Os03g0788500]]
| 7.454
| 10159
| 0.734
| 2
| 2
| 2015/5/15 13:44
|-
|[[Os06g0139000|'''''F-box''''']]
|[[Os06g0139000]]
| 7.443
| 15282
| 0.487
| 3
| 4
| 2015/6/12 16:05
|-
|[[Os03g0168600|'''''CYP704B2''''']]
|[[Os03g0168600]]
| 7.43
| 12348
| 0.602
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os11g0117400|'''''OsWRKY89''''']]
|[[Os11g0117400]]
| 7.353
| 11607
| 0.633
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os03g0223400|'''''OsGLN1_2''''']]
|[[Os03g0223400]]
| 7.313
| 14417
| 0.507
| 3
| 3
| 2015/6/12 13:35
|-
|[[Os02g0731200|'''''MADS57''''']]
|[[Os02g0731200]]
| 7.311
| 14927
| 0.49
| 2
| 2
| 2015/5/14 13:56
|-
|[[Os09g02650|'''''BC12''''']]
|[[Os09g02650]]
| 7.302
| 7302
| 1
| 1
| 1
| 2014/6/1 19:01
|-
|[[Os01g0859300|'''''OsABI5''''']]
|[[Os01g0859300]]
| 7.265
| 12246
| 0.593
| 2
| 2
| 2015/5/13 15:41
|-
|[[Os08g0105000|'''''Ghd7''''']]
|[[Os08g0105000]]
| 7.237
| 15311
| 0.473
| 4
| 4
| 2015/6/12 17:23
|-
|[[Os03g0110800|'''''OsDRM2''''']]
|[[Os03g0110800]]
| 7.203
| 14838
| 0.485
| 2
| 2
| 2015/6/12 12:57
|-
|[[Os01g0367100|'''''PHD1''''']]
|[[Os01g0367100]]
| 7.2
| 12561
| 0.573
| 3
| 3
| 2015/6/9 9:53
|-
|[[Os02g0191600|'''''OsbZIP16''''']]
|[[Os02g0191600]]
| 7.2
| 13785
| 0.522
| 2
| 2
| 2015/5/14 13:25
|-
|[[Os08g0137250|'''''FIE1''''']]
|[[Os08g0137250]]
| 7.185
| 14660
| 0.49
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os02g0220400|'''''Cga1''''']]
|[[Os02g0220400]]
| 7.158
| 17791
| 0.402
| 6
| 8
| 2015/5/14 13:36
|-
|[[Os10g0404500|'''''SUTs''''']]
|[[Os10g0404500]]
| 7.151
| 7164
| 0.998
| 2
| 2
| 2014/6/7 23:34
|-
|[[Os10g0177200|'''''OsDSR-1''''']]
|[[Os10g0177200]]
| 7.15
| 9017
| 0.793
| 3
| 3
| 2015/6/13 16:45
|-
|[[Os10g0496900|'''''OsPORB''''']]
|[[Os10g0496900]]
| 7.143
| 14022
| 0.509
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os02g0313400|'''''API5''''']]
|[[Os02g0313400]]
| 7.12
| 14554
| 0.489
| 2
| 2
| 2015/5/14 13:39
|-
|[[Os08g0117000|'''''PSS1''''']]
|[[Os08g0117000]]
| 7.092
| 8202
| 0.865
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os08g0531700|'''''MADS-box''''']]
|[[Os08g0531700]]
| 7.054
| 13276
| 0.531
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os06g0499500|'''''GH3''''']]
|[[Os06g0499500]]
| 7.051
| 12958
| 0.544
| 3
| 4
| 2015/6/12 16:15
|-
|[[Os03g0188400|'''''OsSRT1''''']]
|[[Os03g0188400]]
| 7.05
| 12067
| 0.584
| 2
| 2
| 2015/6/12 13:06
|-
|[[Os02g0649900|'''''OsYSL2''''']]
|[[Os02g0649900]]
| 7.031
| 12503
| 0.562
| 2
| 2
| 2015/5/14 13:48
|-
|[[Os09g0442700|'''''OsDDM1''''']]
|[[Os09g0442700]]
| 7.028
| 10589
| 0.664
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os12g0438600|'''''AtCLC-a''''']]
|[[Os12g0438600]]
| 7.022
| 14835
| 0.473
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os07g0124700|'''''CRL5''''']]
|[[Os07g0124700]]
| 6.998
| 14469
| 0.484
| 2
| 2
| 2015/6/12 16:31
|-
|[[Os11g0639100|'''''Pi54''''']]
|[[Os11g0639100]]
| 6.934
| 11269
| 0.615
| 4
| 4
| 2015/6/13 17:09
|-
|[[Os01g0615050|'''''OCPI1''''']]
|[[Os01g0615050]]
| 6.92
| 9869
| 0.701
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os12g0610200|'''''OsPIL11''''']]
|[[Os12g0610200]]
| 6.911
| 12604
| 0.548
| 4
| 4
| 2015/6/13 17:18
|-
|[[Os03g0123300|'''''TAD1''''']]
|[[Os03g0123300]]
| 6.87
| 15272
| 0.45
| 4
| 8
| 2015/6/12 13:00
|-
|[[Os07g0682800|'''''rth1''''']]
|[[Os07g0682800]]
| 6.853
| 13550
| 0.506
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os11g0446000|'''''RSS3''''']]
|[[Os11g0446000]]
| 6.838
| 13942
| 0.49
| 5
| 5
| 2015/6/13 17:07
|-
|[[Os07g0182900|'''''OsMET1a''''']]
|[[Os07g0182900]]
| 6.821
| 13295
| 0.513
| 5
| 11
| 2015/6/12 16:33
|-
|[[Os01g0205700|'''''OsGSK1''''']]
|[[Os01g0205700]]
| 6.813
| 12490
| 0.545
| 2
| 2
| 2015/5/13 15:04
|-
|[[Os05g0333200|'''''GPA1''''']]
|[[Os05g0333200]]
| 6.778
| 8703
| 0.779
| 2
| 2
| 2014/6/9 9:17
|-
|[[Os10g0167600|'''''OsCPDP''''']]
|[[Os10g0167600]]
| 6.756
| 14570
| 0.464
| 4
| 4
| 2015/6/13 16:45
|-
|[[Os07g0227800|'''''OsABC1-9''''']]
|[[Os07g0227800]]
| 6.744
| 10826
| 0.623
| 2
| 2
| 2015/6/12 16:37
|-
|[[Os10g0567400|'''''OsCAO1''''']]
|[[Os10g0567400]]
| 6.732
| 13437
| 0.501
| 3
| 3
| 2015/6/13 16:58
|-
|'''''[[DEP2]]'''''
|
| 6.724
| 6763
| 0.994
| 3
| 7
| 2014/6/10 22:30
|-
|[[Os07g0592600|'''''OsMGH3''''']]
|[[Os07g0592600]]
| 6.72
| 15320
| 0.439
| 5
| 11
| 2015/6/12 16:46
|-
|[[Os11g0126900|'''''OsNAC10''''']]
|[[Os11g0126900]]
| 6.705
| 6705
| 1
| 1
| 1
| 2014/5/24 12:41
|-
|[[Os09g0561600|'''''OsDEES1''''']]
|[[Os09g0561600]]
| 6.699
| 11352
| 0.59
| 2
| 2
| 2015/6/13 16:42
|-
|'''''[[Sub1A]]'''''
|
| 6.679
| 6679
| 1
| 1
| 1
| 2014/6/4 16:03
|-
|[[Os08g0126300|'''''OsGAPDH''''']]
|[[Os08g0126300]]
| 6.658
| 13730
| 0.485
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os10g0533600|'''''OsMPK6''''']]
|[[Os10g0533600]]
| 6.522
| 8207
| 0.795
| 3
| 3
| 2015/6/13 16:46
|-
|[[Os10g0397400|'''''dwarf2''''']]
|[[Os10g0397400]]
| 6.52
| 11105
| 0.587
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os06g0712700|'''''OsMADS16''''']]
|[[Os06g0712700]]
| 6.51
| 7624
| 0.854
| 2
| 2
| 2014/6/9 16:43
|-
|[[Os08g0237000|'''''OsXTH8''''']]
|[[Os08g0237000]]
| 6.46
| 6460
| 1
| 1
| 1
| 2014/6/9 18:44
|-
|[[Os02g0811000|'''''TH1''''']]
|[[Os02g0811000]]
| 6.453
| 11487
| 0.562
| 2
| 2
| 2015/5/14 14:02
|-
|[[Os07g0505200|'''''OsSPL13''''']]
|[[Os07g0505200]]
| 6.444
| 6444
| 1
| 1
| 1
| 2016/6/13 9:49
|-
|[[Os11g0247300|'''''Srs5''''']]
|[[Os11g0247300]]
| 6.442
| 13081
| 0.492
| 4
| 4
| 2015/6/13 17:05
|-
|[[AY986492|'''''Xa27''''']]
|[[AY986492]]
| 6.408
| 6408
| 1
| 2
| 2
| 2014/6/10 21:12
|-
|[[Os06g0700700|'''''OsHMA2''''']]
|[[Os06g0700700]]
| 6.404
| 6404
| 1
| 1
| 1
| 2014/6/3 20:16
|-
|[[Os02g0771400|'''''OsPFA-DSP2''''']]
|[[Os02g0771400]]
| 6.399
| 6702
| 0.955
| 2
| 3
| 2014/5/12 16:03
|-
|[[Os06g0127800|'''''DLT''''']]
|[[Os06g0127800]]
| 6.393
| 10797
| 0.592
| 2
| 2
| 2015/6/12 16:03
|-
|[[Os02g0120500|'''''OsTDR''''']]
|[[Os02g0120500]]
| 6.372
| 6372
| 1
| 1
| 1
| 2015/5/14 13:19
|-
|[[Os03g0854500|'''''OsHsfs''''']]
|[[Os03g0854500]]
| 6.367
| 10086
| 0.631
| 2
| 2
| 2015/5/15 13:40
|-
|[[Os06g0275000|'''''Hd1''''']]
|[[Os06g0275000]]
| 6.307
| 11994
| 0.526
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os02g0759800|'''''OsSKIPa''''']]
|[[Os02g0759800]]
| 6.249
| 12883
| 0.485
| 2
| 2
| 2015/5/14 14:00
|-
|[[Os08g0101000|'''''IDEF1''''']]
|[[Os08g0101000]]
| 6.239
| 10862
| 0.574
| 2
| 2
| 2015/6/12 17:22
|-
|[[Os09g0456200|'''''OsbZIP72''''']]
|[[Os09g0456200]]
| 6.23
| 10901
| 0.572
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os12g0101600|'''''leaf2''''']]
|[[Os12g0101600]]
| 6.221
| 35095
| 0.177
| 2
| 3
| 2014/5/31 21:22
|-
|[[Os06g0695800|'''''STAR1''''']]
|[[Os06g0695800]]
| 6.213
| 8582
| 0.724
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0606700|'''''RSS1''''']]
|[[Os02g0606700]]
| 6.198
| 12432
| 0.499
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os11g0210300|'''''Adh1''''']]
|[[Os11g0210300]]
| 6.196
| 12384
| 0.5
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0736400|'''''OsDHODH''''']]
|[[Os02g0736400]]
| 6.183
| 11839
| 0.522
| 2
| 2
| 2015/5/14 13:57
|-
|[[Os08g0549100|'''''OsAPx4''''']]
|[[Os08g0549100]]
| 6.175
| 10093
| 0.612
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os09g0452200|'''''LYP4''''']]
|[[Os09g0452200]]
| 6.171
| 11987
| 0.515
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0170300|'''''OsMADS29''''']]
|[[Os02g0170300]]
| 6.166
| 12582
| 0.49
| 3
| 4
| 2015/5/14 13:23
|-
|[[Os03g0224700|'''''Hsfs''''']]
|[[Os03g0224700]]
| 6.166
| 11925
| 0.517
| 4
| 4
| 2015/6/12 13:35
|-
|[[Os07g0558500|'''''THF1''''']]
|[[Os07g0558500]]
| 6.078
| 12744
| 0.477
| 5
| 9
| 2015/6/12 16:45
|-
|[[Os09g0511000|'''''OsCERK1''''']]
|[[Os09g0511000]]
| 6.076
| 12097
| 0.502
| 2
| 2
| 2015/6/12 22:35
|-
|'''''[[OsWRKY13]]'''''
|
| 6.069
| 6101
| 0.995
| 2
| 3
| 2014/6/4 20:18
|-
|[[Os06g0308100|'''''OsIBR5''''']]
|[[Os06g0308100]]
| 6.062
| 12455
| 0.487
| 2
| 2
| 2015/6/12 16:13
|-
|[[Os11g0113700|'''''OsCIPK15''''']]
|[[Os11g0113700]]
| 5.961
| 12261
| 0.486
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os02g0656600|'''''GPA3''''']]
|[[Os02g0656600]]
| 5.915
| 10022
| 0.59
| 2
| 2
| 2015/5/14 13:50
|-
|[[Os01g0733200|'''''OsHsfC1b''''']]
|[[Os01g0733200]]
| 5.889
| 5889
| 1
| 1
| 1
| 2014/5/31 11:56
|-
|[[Os01g0785400|'''''GH3''''']]
|[[Os01g0785400]]
| 5.864
| 10600
| 0.553
| 2
| 2
| 2015/5/13 15:34
|-
|[[Os04g0541700|'''''Oshox22''''']]
|[[Os04g0541700]]
| 5.857
| 6037
| 0.97
| 2
| 3
| 2014/6/8 16:10
|-
|[[Os08g0140500|'''''TDC-3''''']]
|[[Os08g0140500]]
| 5.829
| 11343
| 0.514
| 2
| 2
| 2015/6/12 17:26
|-
|'''''[[IPK1]]'''''
|
| 5.803
| 5803
| 1
| 1
| 1
| 2014/6/8 16:55
|-
|[[Os09g0522100|'''''CBF''''']]
|[[Os09g0522100]]
| 5.713
| 9270
| 0.616
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os01g0177900|'''''OsABCG31''''']]
|[[Os01g0177900]]
| 5.693
| 11327
| 0.503
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os02g0149800|'''''OsPP18''''']]
|[[Os02g0149800]]
| 5.681
| 11452
| 0.496
| 2
| 2
| 2015/5/14 13:22
|-
|[[Os01g0831000|'''''LAX''''']]
|[[Os01g0831000]]
| 5.68
| 9517
| 0.597
| 2
| 2
| 2015/5/13 15:37
|-
|[[Os05g0580500|'''''OsRAD21-4''''']]
|[[Os05g0580500]]
| 5.66
| 5660
| 1
| 1
| 1
| 2014/5/23 11:03
|-
|'''''[[OsCERK1]]'''''
|
| 5.61
| 5610
| 1
| 1
| 1
| 2014/6/1 18:31
|-
|[[Os11g0116200|'''''LTPs''''']]
|[[Os11g0116200]]
| 5.602
| 7206
| 0.777
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os09g0567800|'''''Lipase''''']]
|[[Os09g0567800]]
| 5.558
| 5558
| 1
| 1
| 1
| 2014/6/6 16:24
|-
|[[Os06g0610350|'''''OsMOC1''''']]
|[[Os06g0610350]]
| 5.547
| 5547
| 1
| 1
| 1
| 2016/6/12 13:57
|-
|[[Os02g0657000|'''''ARAG1''''']]
|[[Os02g0657000]]
| 5.536
| 9210
| 0.601
| 2
| 2
| 2015/5/14 13:51
|-
|'''''[[Wbph8]]'''''
|
| 5.531
| 5531
| 1
| 1
| 1
| 2014/6/10 18:50
|-
|[[Os07g0563300|'''''GD1''''']]
|[[Os07g0563300]]
| 5.487
| 11105
| 0.494
| 2
| 2
| 2015/6/12 16:45
|-
|[[Os06g0701700|'''''OsHKT2;1''''']]
|[[Os06g0701700]]
| 5.432
| 8295
| 0.655
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os10g0419200|'''''RID1''''']]
|[[Os10g0419200]]
| 5.432
| 9118
| 0.596
| 3
| 3
| 2015/6/13 16:44
|-
|'''''[[OsCEBiP]]'''''
|
| 5.419
| 5419
| 1
| 1
| 1
| 2014/6/8 12:32
|-
|'''''[[Xa10]]'''''
|
| 5.416
| 5416
| 1
| 1
| 1
| 2014/6/1 16:52
|-
|[[Os03g0272300|'''''OsSDIR1''''']]
|[[Os03g0272300]]
| 5.41
| 9862
| 0.549
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os10g0528300|'''''GSTs''''']]
|[[Os10g0528300]]
| 5.364
| 9566
| 0.561
| 3
| 3
| 2015/6/13 16:46
|-
|'''''[[Badh2]]'''''
|
| 5.363
| 5363
| 1
| 1
| 1
| 2014/6/8 19:38
|-
|[[Os03g0233900|'''''Hbs''''']]
|[[Os03g0233900]]
| 5.348
| 9011
| 0.593
| 2
| 2
| 2015/6/12 13:38
|-
|'''''[[Xa21]]'''''
|
| 5.345
| 5345
| 1
| 1
| 1
| 2014/6/1 13:37
|-
|'''''[[Bls1]]'''''
|
| 5.308
| 5308
| 1
| 1
| 1
| 2014/5/24 15:17
|-
|[[Os06g0157700|'''''Hd3''''']]
|[[Os06g0157700]]
| 5.304
| 10277
| 0.516
| 2
| 2
| 2015/6/12 16:06
|-
|[[Os02g0260200|'''''LP''''']]
|[[Os02g0260200]]
| 5.302
| 7745
| 0.685
| 2
| 2
| 2015/5/14 13:37
|-
|[[Os03g0232600|'''''TUD1''''']]
|[[Os03g0232600]]
| 5.249
| 10595
| 0.495
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os03g0125100|'''''OsHYD3''''']]
|[[Os03g0125100]]
| 5.183
| 10331
| 0.502
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os06g0212900|'''''ORF3''''']]
|[[Os06g0212900]]
| 5.175
| 6651
| 0.778
| 3
| 3
| 2015/6/12 16:09
|-
|[[Os02g0491300|'''''MTR1''''']]
|[[Os02g0491300]]
| 5.166
| 10047
| 0.514
| 2
| 2
| 2015/5/14 13:40
|-
|[[Os09g0470500|'''''Oshox4''''']]
|[[Os09g0470500]]
| 5.144
| 9661
| 0.532
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os09g0439800|'''''DRO1''''']]
|[[Os09g0439800]]
| 5.122
| 8022
| 0.638
| 3
| 4
| 2015/6/12 17:43
|-
|[[Os12g0555500|'''''PBZ1''''']]
|[[Os12g0555500]]
| 5.108
| 8929
| 0.572
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os11g0508600|'''''Os-11N3''''']]
|[[Os11g0508600]]
| 5.066
| 7754
| 0.653
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os08g0174500|'''''OsDTH8''''']]
|[[Os08g0174500]]
| 5.017
| 9397
| 0.534
| 3
| 3
| 2015/6/12 17:28
|-
|[[Os03g0267200|'''''sHSP17.7''''']]
|[[Os03g0267200]]
| 5.008
| 7991
| 0.627
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os06g0622700|'''''OsbZIP50 ''''']]
|[[Os06g0622700]]
| 5
| 9868
| 0.507
| 2
| 2
| 2015/6/12 16:19
|-
|'''''[[SBP]]'''''
|
| 4.997
| 4997
| 1
| 1
| 1
| 2013/7/21 18:43
|-
|[[Os05g0465800|'''''PI3K''''']]
|[[Os05g0465800]]
| 4.939
| 4939
| 1
| 1
| 1
| 2014/6/6 16:19
|-
|[[Os10g0491000|'''''BSP''''']]
|[[Os10g0491000]]
| 4.912
| 8991
| 0.546
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os01g0206700|'''''OsCIPK05''''']]
|[[Os01g0206700]]
| 4.909
| 9664
| 0.508
| 2
| 2
| 2015/5/13 15:05
|-
|[[Os06g0643300|'''''RISBZ1''''']]
|[[Os06g0643300]]
| 4.869
| 7953
| 0.612
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os03g0180800|'''''OsTIFY11a''''']]
|[[Os03g0180800]]
| 4.859
| 8158
| 0.596
| 2
| 2
| 2015/6/12 13:04
|-
|'''''[[BPH_gene]]'''''
|
| 4.857
| 4857
| 1
| 2
| 2
| 2014/6/11 11:14
|-
|[[Os01g0805600|'''''CycB1''''']]
|[[Os01g0805600]]
| 4.842
| 4842
| 1
| 1
| 1
| 2014/6/5 18:11
|-
|[[Os06g0701600|'''''HKT''''']]
|[[Os06g0701600]]
| 4.831
| 7482
| 0.646
| 2
| 2
| 2015/6/12 16:25
|-
|[[Os08g0531600|'''''OsSPL16''''']]
|[[Os08g0531600]]
| 4.818
| 4825
| 0.999
| 2
| 2
| 2014/5/27 23:11
|-
|[[Os06g0254700|'''''OsCLO-6''''']]
|[[Os06g0254700]]
| 4.802
| 7514
| 0.639
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os01g0615100|'''''OCPI2''''']]
|[[Os01g0615100]]
| 4.794
| 7379
| 0.65
| 2
| 2
| 2015/5/13 15:19
|-
|'''''[[HSF]]'''''
|
| 4.772
| 4781
| 0.998
| 2
| 2
| 2013/7/21 20:57
|-
|[[Os06g0125800|'''''OsBBI1''''']]
|[[Os06g0125800]]
| 4.629
| 9410
| 0.492
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os07g0628500|'''''OsbHLH1''''']]
|[[Os07g0628500]]
| 4.606
| 8573
| 0.537
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os07g0694700|'''''APX''''']]
|[[Os07g0694700]]
| 4.569
| 8480
| 0.539
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os01g0293100|'''''TIP2''''']]
|[[Os01g0293100]]
| 4.568
| 8480
| 0.539
| 2
| 2
| 2015/5/13 15:12
|-
|'''''[[Rl14]]'''''
|
| 4.564
| 4764
| 0.958
| 2
| 2
| 2014/6/10 11:19
|-
|'''''[[OsRPA2]]'''''
|
| 4.552
| 4552
| 1
| 1
| 1
| 2014/6/6 9:13
|-
|[[Os06g0604000|'''''OsWR2''''']]
|[[Os06g0604000]]
| 4.53
| 8229
| 0.55
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os01g0192000|'''''OsDOS''''']]
|[[Os01g0192000]]
| 4.527
| 4527
| 1
| 1
| 1
| 2015/7/30 23:13
|-
|[[Os01g0922800|'''''OsMADS51''''']]
|[[Os01g0922800]]
| 4.506
| 4506
| 1
| 1
| 1
| 2014/5/24 18:45
|-
|[[Os02g0787300|'''''OsRac1''''']]
|[[Os02g0787300]]
| 4.483
| 6886
| 0.651
| 2
| 2
| 2015/5/14 14:01
|-
|[[Os09g0439200|'''''OsJAZ8''''']]
|[[Os09g0439200]]
| 4.477
| 8745
| 0.512
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0822900|'''''Dwarf1''''']]
|[[Os01g0822900]]
| 4.447
| 7550
| 0.589
| 3
| 4
| 2015/5/13 15:36
|-
|[[Os08g0167500|'''''CRR6''''']]
|[[Os08g0167500]]
| 4.432
| 8906
| 0.498
| 2
| 2
| 2015/6/12 17:27
|-
|'''''[[Sucrose_synthase]]'''''
|
| 4.428
| 4436
| 0.998
| 2
| 2
| 2013/7/18 11:20
|-
|'''''[[CL971152]]'''''
|
| 4.417
| 4472
| 0.988
| 2
| 2
| 2014/6/10 21:51
|-
|[[Os12g0603700|'''''OsCIPK04''''']]
|[[Os12g0603700]]
| 4.375
| 9322
| 0.469
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os02g0618400|'''''OsMPS''''']]
|[[Os02g0618400]]
| 4.347
| 8707
| 0.499
| 2
| 2
| 2015/5/14 13:45
|-
|[[Os03g0182800|'''''OsDERF1''''']]
|[[Os03g0182800]]
| 4.322
| 6519
| 0.663
| 2
| 2
| 2015/6/12 13:05
|-
|'''''[[ARF]]'''''
|
| 4.308
| 4308
| 1
| 1
| 1
| 2013/7/21 20:46
|-
|[[Os03g0183000|'''''OsRAF''''']]
|[[Os03g0183000]]
| 4.286
| 4286
| 1
| 1
| 1
| 2014/6/9 20:10
|-
|[[Os02g0654700|'''''AP59''''']]
|[[Os02g0654700]]
| 4.285
| 8306
| 0.516
| 2
| 2
| 2015/5/14 13:49
|-
|[[Os09g0466400|'''''OsZHD1''''']]
|[[Os09g0466400]]
| 4.265
| 8095
| 0.527
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os03g0103300|'''''qLTG3''''']]
|[[Os03g0103300]]
| 4.188
| 7457
| 0.562
| 2
| 2
| 2015/6/12 12:56
|-
|[[Os01g0834400|'''''OsHAP3A''''']]
|[[Os01g0834400]]
| 4.109
| 4109
| 1
| 1
| 1
| 2014/5/31 19:19
|-
|[[Os07g0512200|'''''OsAtg8''''']]
|[[Os07g0512200]]
| 4.095
| 7690
| 0.533
| 4
| 4
| 2015/6/12 16:43
|-
|'''''[[Bph9]]'''''
|
| 4.084
| 4084
| 1
| 1
| 1
| 2014/6/9 12:23
|-
|[[Os06g0181700|'''''OsWR1''''']]
|[[Os06g0181700]]
| 4.083
| 7433
| 0.549
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os06g0157500|'''''RFT1''''']]
|[[Os06g0157500]]
| 4.013
| 7888
| 0.509
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os09g0537700|'''''OsRNS4''''']]
|[[Os09g0537700]]
| 3.992
| 6731
| 0.593
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os02g0610500|'''''OsCOL4''''']]
|[[Os02g0610500]]
| 3.946
| 3946
| 1
| 1
| 1
| 2014/5/20 11:57
|-
|[[Os07g0529600|'''''OsDR8''''']]
|[[Os07g0529600]]
| 3.915
| 6908
| 0.567
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0106700|'''''AKT1''''']]
|[[Os09g0106700]]
| 3.845
| 6498
| 0.592
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os07g0568700|'''''OsFOR1''''']]
|[[Os07g0568700]]
| 3.845
| 6600
| 0.583
| 2
| 2
| 2015/6/12 16:46
|-
|[[Os12g0123700|'''''NAC''''']]
|[[Os12g0123700]]
| 3.826
| 6076
| 0.63
| 4
| 4
| 2015/6/13 17:16
|-
|'''''[[Pik-p]]'''''
|
| 3.816
| 3816
| 1
| 1
| 1
| 2014/6/6 10:16
|-
|[[Os06g0493100|'''''Bphi008a''''']]
|[[Os06g0493100]]
| 3.804
| 7241
| 0.525
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os02g0552700|'''''OsZFP6''''']]
|[[Os02g0552700]]
| 3.779
| 6604
| 0.572
| 2
| 2
| 2015/5/14 13:43
|-
|[[Os12g0100500|'''''COG2267''''']]
|[[Os12g0100500]]
| 3.729
| 5669
| 0.658
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os07g0129200|'''''OsPR1''''']]
|[[Os07g0129200]]
| 3.716
| 6629
| 0.561
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os10g0558900|'''''RL14''''']]
|[[Os10g0558900]]
| 3.699
| 7398
| 0.5
| 5
| 9
| 2015/6/13 16:57
|-
|[[Os01g0177400|'''''ACO1''''']]
|[[Os01g0177400]]
| 3.693
| 6293
| 0.587
| 3
| 3
| 2015/5/13 14:57
|-
|[[Os09g0380200|'''''YLC1''''']]
|[[Os09g0380200]]
| 3.69
| 6890
| 0.536
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os08g0163400|'''''OsSIG1''''']]
|[[Os08g0163400]]
| 3.662
| 3662
| 1
| 1
| 1
| 2014/6/9 20:52
|-
|[[Os06g0665800|'''''OsHMA9''''']]
|[[Os06g0665800]]
| 3.593
| 3593
| 1
| 1
| 1
| 2014/6/2 15:50
|-
|[[Os09g0396900|'''''OsVIT2''''']]
|[[Os09g0396900]]
| 3.437
| 6527
| 0.527
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g0786400|'''''OsCKX2''''']]
|[[Os03g0786400]]
| 3.372
| 3372
| 1
| 1
| 1
| 2014/5/20 0:08
|-
|'''''[[Bhp-3]]'''''
|
| 3.33
| 3330
| 1
| 1
| 1
| 2014/5/31 23:33
|-
|[[Os07g0641200|'''''OsCCaMK''''']]
|[[Os07g0641200]]
| 3.212
| 6389
| 0.503
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0549600|'''''UDT1''''']]
|[[Os07g0549600]]
| 3.204
| 5875
| 0.545
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os11g0582500|'''''OsC6''''']]
|[[Os11g0582500]]
| 3.13
| 5666
| 0.552
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os03g0135700|'''''RAI1''''']]
|[[Os03g0135700]]
| 3.126
| 3126
| 1
| 1
| 1
| 2014/6/7 0:43
|-
|[[Os09g0459200|'''''SG1''''']]
|[[Os09g0459200]]
| 3.094
| 5090
| 0.608
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os11g0523700|'''''OsICE1''''']]
|[[Os11g0523700]]
| 3.071
| 3079
| 0.997
| 2
| 2
| 2014/6/3 13:41
|-
|[[Os09g0522200|'''''OsDREB1A''''']]
|[[Os09g0522200]]
| 3.031
| 5920
| 0.512
| 3
| 3
| 2015/6/12 22:36
|-
|[[Os06g0127100|'''''OsDREB1C''''']]
|[[Os06g0127100]]
| 3.015
| 5846
| 0.516
| 3
| 3
| 2015/6/12 16:02
|-
|[[Os10g0573400|'''''OsPYL10''''']]
|[[Os10g0573400]]
| 3.009
| 6148
| 0.489
| 4
| 4
| 2015/6/13 16:58
|-
|[[Os01g0274800|'''''CSA''''']]
|[[Os01g0274800]]
| 2.805
| 2805
| 1
| 1
| 1
| 2014/5/28 21:34
|-
|[[BGIOSGA033504|'''''csld4''''']]
|[[BGIOSGA033504]]
| 2.803
| 2818
| 0.995
| 2
| 2
| 2014/6/3 16:43
|-
|[[Os11g0454000|'''''rab16c''''']]
|[[Os11g0454000]]
| 2.786
| 5342
| 0.522
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os10g0148000|'''''OsDIL''''']]
|[[Os10g0148000]]
| 2.697
| 5106
| 0.528
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os08g0566600|'''''PGR5''''']]
|[[Os08g0566600]]
| 2.632
| 4314
| 0.61
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os03g0150200|'''''OsAP23''''']]
|[[Os03g0150200]]
| 2.621
| 5115
| 0.512
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os05g0341600|'''''RAB21''''']]
|[[Os05g0341600]]
| 2.592
| 2640
| 0.982
| 2
| 3
| 2014/6/1 17:02
|-
|[[Os07g0191600|'''''STR2''''']]
|[[Os07g0191600]]
| 2.541
| 2541
| 1
| 1
| 1
| 2014/6/11 19:08
|-
|[[Os11g0208900|'''''xa5''''']]
|[[Os11g0208900]]
| 2.152
| 2152
| 1
| 1
| 1
| 2014/6/8 17:23
|-
|[[Os07g0492000|'''''OsNDPK1''''']]
|[[Os07g0492000]]
| 1.777
| 1777
| 1
| 1
| 1
| 2014/6/9 23:45
|-
|[[Os03g0741100|'''''OsbHLH148''''']]
|[[Os03g0741100]]
| 1.578
| 1578
| 1
| 1
| 1
| 2014/5/19 3:18
|}

Os01g0112400

2017-03-08T06:17:29Z

Xysj1981: Replaced content with "==Annotated Information== Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress. ==Structured Inf..."

==Annotated Information==
Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress.

==Structured Information==

[[Category:Genes]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Chromosome 1]]

Os03g0786400

2017-03-08T06:16:15Z

Xysj1981:

zinc finger protein is an important class of eukaryotic transcription factors
==Annotated Information==

===Function===
The Cys-2/His-2-type (C2H2) zinc finger protein—also called a classical or TFIIIA-type zinc finger—that was first found in Xenopus oocytes is an important class of eukaryotic transcription factors[1].
The phytohormone cytokinin (CK) positively regulates the activity and function of the shoot apical meristem (SAM), which is a major parameter determining seed production. The rice (Oryza sativa L.) Gn1a/OsCKX2 (Grain number 1a/Cytokinin oxidase 2) gene, which encodes a cytokinin oxidase, has been identified as a major quantitative trait locus contributing to grain number improvement in rice breeding practice. The zinc finger transcription factor DROUGHT AND SALT TOLERANCE (DST) directly regulates OsCKX2 expression in the reproductive meristem. DST-directed expression of OsCKX2 regulates CK accumulation in the SAM and, therefore, controls the number of the reproductive organs[2].
And the zinc finger transcription factor can negatively regulate stomatal closure by direct modulation of genes related to H2O2 homeostasis. Loss of DST function increases stomatal closure and reduces stomatal density, consequently resulting in enhanced drought and salt tolerance in rice[3].

===Expression===
DST is located in the nucleus with transcriptional activation and it will express momentarily down under the condition of salt stress and osmotic stress, then recovered to pre-treatment levels. All transgenic plants overexpressing a wild-type DST allele (DSTREG1) showed reduced plant stature with less panicle branches and decreased grain number (Fig. S1 A–D). In contrast, the DST RNA interference (RNAi) transgenic plants showed increased panicle branches and enhanced grain number（Fig.S1E–H）.
[[File:444.png]]

===Evolution===
Generally, C2H2-type zinc finger proteins contain more than one zinc finger motif for DNA binding in the N terminus and separable transcriptional activation (or repression) domains in the C terminus [4]. The zinc finger motif is thought to recognize and bind its target DNA sequence, but has never been shown to be required for transcriptional activity [4,5,6].

==Labs working on this gene==
China Natl Hybrid Rice Res & Dev Ctr, State Key Lab Hybrid Rice, Changsha 410125, Hunan, Peoples R China.

Chinese Acad Sci, Shanghai Inst Biol Sci, Shanghai Inst Plant Physiol & Ecol, Natl Key Lab Plant Mol Genet, Shanghai 200032, Peoples R China.

==References==
[1] Miller J, McLachlan AD, Klug A(1985) Repetitive zinc-binding domains in the protein transcription factor IIIA from Xenopus oocytes. EMBO J 4:1609–1614.

[2] Shuyu Li;Bingran Zhao;Dingyang Yuan; Rice zinc finger protein DST enhances grain production through controlling Gn1a/OsCKX2 expression; Proceedings of the National Academy of Sciences, 2013, 110(8): 3167-3172

[3] Xin-Yuan Huang;Dai-Yin Chao; A previously unknown zinc finger protein, DST, regulates drought and salt tolerance in rice via stomatal aperture control; GENES & DEVELOPMENT, 2009, 23(15): 1805-1817

[4] Wolfe SA, Nekludova L, Pabo CO(2000) DNA recognition by Cys(2)His(2) zinc finger proteins. Annu Rev Biophys Biomol Struct 29:183–212.

[5] Sakamoto H, Maruyama K, Sakuma Y, Meshi T, Iwabuchi M, Shinozaki K, Yamaguchi-Shinozaki K(2004) Arabidopsis Cys2/His2-type zinc-finger proteins function as transcription repressors under drought, cold, and high-salinity stress conditions. Plant Physiol 136:2734–2746.

[6] Lin R, Ding L, Casola C, Ripoll DR, Feschotte C, Wang H(2007) Transposase-derived transcription factors regulate light signaling in Arabidopsis. Science 318:1302–1305.

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 3]]
[[Category:Chromosome 3]]

Os03g0135700

2017-03-08T06:14:58Z

Xysj1981: /* References */

Os03g0135700

2017-03-08T06:14:49Z

Xysj1981: /* Annotated Information */

Os03g0135700

2017-03-08T06:14:25Z

Xysj1981:

Os03g0135700

2017-03-08T06:13:36Z

Xysj1981: /* Evolution */

Please input one-sentence summary here.

==Annotated Information==
===Function===
The Rac/Rop GTPase OsRac1 plays an essential role in rice immunity.the gene RAP1 encodes a putative basic helix–loop–helix transcription factor and thhis factor acts as the first factor downstream of the OsRac1,it can induce the expression of the PAL1 and OsWRKY19 by the mechanism of interacting with the OsMKK4–OsMAPK3/6 cascade,which result in the enhancement of the immunity to the rice blast fungus.

===Expression

We used ﬂuorescent proteins to examine the subcellular localization of RAI1 in rice protoplasts isolated from cultured cells. The protoplasts were transfected with either a ﬂuorescent RAI1–green ﬂuorescent protein (GFP) construct or the control ﬂuorescent protein GFP, and then examined under a confocal microscope. RAI1–GFP accumulated mainly in the nucleus but slightly in the cytoplasm, whereas GFP was distributed throughout the cytoplasm and nucleus.this implies that this gene may be a translation factor .when the rice was treated with the sphingolipid and chitin elicitors,we can observe the elevation of this gene's expression level ,and the response is more instant than the PAL1 and OsWRKY19 ,with the addition of other expeiments,we can conclude that this gene act as the first factor downstream of theOsRac1 and induce the expression of the PAL1 and OsWRKY19,two essential genes in the plant immunity.

===Evolution===
The RAI1 protein has a bHLH domain that is conserved in homologous rice proteins . The basic domain at the N-terminus of bHLH is known to be important for binding to DNA elements such as the cis-elements in the promoters of target genes . The HLH domain includes two amphipathic a-helices with a linking loop. These a-helices may function in the formation of homodimers or heterodimers with other bHLH proteins .

==Labs working on this gene==
* Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan
* Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan
* Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan
* Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan

==References==
Please input cited references here.
<ref name="ref1"> Andreasson, E., Jenkins, T., Brodersen, P., Thorgrimsen, S.Petersen, N.H., Zhu, S. et al. (2005) The MAP kinase substrate MKS1 is a regulator of plant defense responses. EMBO J. 24:2579–2589.</ref>
<ref name="ref2">Atchley, W.R., Terhalle, W. and Dress, A. (1999) Positional dependence,cliques, and predictive motifs in the bHLH protein domain. J. Mol.
Evol. 48: 501–516.</ref>
<ref name="ref3">Berken, A. (2006) ROPs in the spotlight of plant signal transduction.Cell. Mol. Life Sci. 63: 2446–2459</ref>
<ref name="ref4">Chisholm, S.T., Coaker, G., Day, B. and Staskawicz, B.J. (2006) Host–microbe interactions: shaping the evolution of the plant immune
response. Cell 124: 803–814.</ref>

==Structured Information==
{{JaponicaGene|
GeneName = Os03g0135700|
Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
Version = NM_001055424.2 GI:297600285 GeneID:4331538|
Length = 1998 bp|
Definition = Oryza sativa Japonica Group Os03g0135700, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 3|Chromosome 3]]|
AP = Chromosome 3:1961902..1963899|
CDS = 1961902..1962100,1962234..1962310,1962516..1962686,1962871..1963047,1963190..1963819 |
GCID = <gbrowseImage1>
name=NC_008396:1961902..1963899
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008396:1961902..1963899
source=RiceChromosome03
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggagcttgacgaggagtccttcttggatgagctcatgtcgctgcggcgtgatggatcggcgccgtggcaggcgccgccgtacccgggtggcggcggcggcggcggcggtggcggcatgatgatgagtgacctcctcttctacggcggcgacggcggcagcgcggaggcgaggggcgggatggacgcgtcgccgttccaggagctggcgtccatggcggcgccgccgcctcagcatccgcacgaggagttcaacttcgactgcttgagcgaggtctgcaacccgtaccgcagctgcggcgcccagctcgtcccctcggaggcggctagccagacgcagacgcagctcactcctctccgcgacgcaatggtggcggaggaggagacgagcggcgacaaggcgctgctccatggcggcggcggctcgtcgtcgccgacgttcatgtttggaggtggcgccggagagagctcggagatgatggccggcatcagaggcgtcggcggcggcgtccacccgcggagcaagctccacggcacgccgtcgaagaacctcatggccgagaggcggcgtcgcaagcggctcaacgaccggctgtccatgctccggtccatcgtgcccaagattagcaagatggacaggacctcgatccttggtgacaccatcgactacgtgaaggagctgacggagaggatcaaaaccctcgaggaggagatcggcgtcacgccggaggagctcgacctgttgaacacgatgaaggattcctccagcggcaacaacaacgagatgctcgtgaggaattccaccaagttcgatgtcgagaaccggggcagcgggaacacgaggatcgagatatgctgcccggcgaaccccggcgtgctgctgtcgacggtgagcgcgctggaggtgctggggctagagatcgagcagtgcgtcgtgagctgcttcagtgactttggcatgcaggcctcctgcttacaagaggacgggaagaggcaagttgtcagcaccgacgagatcaagcagacattgttcaggagcgcaggctatggcggaaggaattatagtagatcgagtaccatttatgagttcatattcatcagcagtggtagtacctcgtttctgaacacaccagagagcaaattaaagatttgctcaagtattgtaagctttgcatttgtgaatcggtatgggaaccggccgtgtgatttgtcgaacattggatttgaattaaacgccaaggtaccaattgtttgt</cdnaseq>|
AA = <aaseq>MELDEESFLDELMSLRRDGSAPWQAPPYPGGGGGGGGGGMMMSD LLFYGGDGGSAEARGGMDASPFQELASMAAPPPQHPHEEFNFDCLSEVCNPYRSCGAQ LVPSEAASQTQTQLTPLRDAMVAEEETSGDKALLHGGGGSSSPTFMFGGGAGESSEMM AGIRGVGGGVHPRSKLHGTPSKNLMAERRRRKRLNDRLSMLRSIVPKISKMDRTSILG DTIDYVKELTERIKTLEEEIGVTPEELDLLNTMKDSSSGNNNEMLVRNSTKFDVENRG SGNTRIEICCPANPGVLLSTVSALEVLGLEIEQCVVSCFSDFGMQASCLQEDGKRQVV STDEIKQTLFRSAGYGGRNYSRSSTIYEFIFISSGSTSFLNTPESKLKICSSIVSFAF VNRYGNRPCDLSNIGFELNAKVPIVC</aaseq>|
DNA = <dnaseqindica>1800..1998#1590..1666#1214..1384#853..1029#81..710#ggagaggtgactgctagcgaggaaagggagcatatatactactatagcttagcttgctgcaggtgctagctagctgaggcatggagcttgacgaggagtccttcttggatgagctcatgtcgctgcggcgtgatggatcggcgccgtggcaggcgccgccgtacccgggtggcggcggcggcggcggcggtggcggcatgatgatgagtgacctcctcttctacggcggcgacggcggcagcgcggaggcgaggggcgggatggacgcgtcgccgttccaggagctggcgtccatggcggcgccgccgcctcagcatccgcacgaggagttcaacttcgactgcttgagcgaggtctgcaacccgtaccgcagctgcggcgcccagctcgtcccctcggaggcggctagccagacgcagacgcagctcactcctctccgcgacgcaatggtggcggaggaggagacgagcggcgacaaggcgctgctccatggcggcggcggctcgtcgtcgccgacgttcatgtttggaggtggcgccggagagagctcggagatgatggccggcatcagaggcgtcggcggcggcgtccacccgcggagcaagctccacggcacgccgtcgaagaacctcatggccgagaggcggcgtcgcaagcggctcaacgaccggctgtccatgctccggtccatcgtgcccaagattagcaaggtgacacacacattgatttgtattgttgtcttgtgacctaattaattgacctagctagctgtagctagcttcttgtctccgtgtcccgtgtgctcatatatctgtaattaaacaatcaatcaatcgctcgctcgcgctgcagatggacaggacctcgatccttggtgacaccatcgactacgtgaaggagctgacggagaggatcaaaaccctcgaggaggagatcggcgtcacgccggaggagctcgacctgttgaacacgatgaaggattcctccagcggcaacaacaacgagatgctcgtgaggaattccaccaaggtacgtacctagcttagctacgcaggcaagcatcgcatcgatggagttttagtttggcatgtatgtatgtgcttgtatatttcttgtgcgtccgcgcagctaaattaatctggttgttgcgatcgaactttgtgatgcatggggcgaaactaactaattaaactgcggtttgattttcctccagttcgatgtcgagaaccggggcagcgggaacacgaggatcgagatatgctgcccggcgaaccccggcgtgctgctgtcgacggtgagcgcgctggaggtgctggggctagagatcgagcagtgcgtcgtgagctgcttcagtgactttggcatgcaggcctcctgcttacaagtaagttctatatatctatcttgaattcttgatagctatagcaacttagctagtgcggatttctgaacatctatatcggtcgatatatagctataccttgatttcttgctcgaacaaattaacctatagctatatataggcatatatatgttttgattaatctcttgtttcaatattgaatgggttcgtcgacaatgcatgataggaggacgggaagaggcaagttgtcagcaccgacgagatcaagcagacattgttcaggagcgcaggctatggcggaaggtgtctgtagctagctagctatacaatccattgaacgctgagcactgtgagcaggtacaggttgcatatatatgatcttcatcatccatgatataggagtaatagctatacatgcatatgcacttcgctccaggaattatagtagatcgagtaccatttatgagttcatattcatcagcagtggtagtacctcgtttctgaacacaccagagagcaaattaaagatttgctcaagtattgtaagctttgcatttgtgaatcggtatgggaaccggccgtgtgatttgtcgaacattggatttgaattaaacgccaaggtaccaattgtttgt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001055424.2 RefSeq:Os03g0135700]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 3]]
[[Category:Chromosome 3]]

Os10g0148000

2017-03-08T06:11:33Z

Xysj1981: /* Annotated Information */

''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP.
==Annotated Information==
[[File:Fig.1.jpg|327px|thumb|right|Fig1]]
===Function===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed
less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages<ref name="ref1" />.

===Expression===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .
To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.

You can also add sub-section(s) at will.

==Labs working on this gene==
State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.

==References==
<references>
* <ref name="ref1">Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 .
</ref>
</references>
== Structured Information ==
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

Os10g0148000

2017-03-08T06:11:25Z

Xysj1981: /* Annotated Information */

''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP.
==Annotated Information==
[[File:Fig.1.jpg|427px|thumb|right|Fig1]]
===Function===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed
less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages<ref name="ref1" />.

===Expression===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .
To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.

You can also add sub-section(s) at will.

==Labs working on this gene==
State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.

==References==
<references>
* <ref name="ref1">Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 .
</ref>
</references>
== Structured Information ==
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

Os10g0148000

2017-03-08T06:11:08Z

Xysj1981:

''OsDIL'' is a stress-responsive gene and it is short for Oryza sativa Drought-Induced LTP.
==Annotated Information==
[[File:Fig.1.jpg|327px|thumb|center|Fig1]]
===Function===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. was found to be up-regulated in flowers under drought.OsDIL was primarily expressed in the anther and mainly responsive to abiotic stresses, including drought, cold, NaCl, and stress-related plant hormone abscisic acid (ABA). Compared with wild type, the OsDIL-overexpressing transgenic rice plants were more tolerant to drought stress during vegetative development and showed
less severe tapetal defects and fewer defective anther sacs when treated with drought at the reproductive stages<ref name="ref1" />.

===Expression===
''OsDIL'' (Os10g0148000) encoding a lipid transfer protein. ''OsDIL'' has an open reading frame of 348 bp, encoding a basic protein of 115 amino acids with a calculated molecular weight of 12.22 kDa and a pI of 5.67. Analysis of the OsDIL sequence using the SignalP program (http://genome.cbs. dtu.dk/services/SignalP) revealed a putative cleavage site for a signal peptide between residues 26 (A) and 27 (G).OsDIL contains an N-terminal region with 17 hydrophobic residues (9–26 aa) similar to typical signal peptides for the secretory pathway and eight cysteine residues highly conserved in plant ns-LTP family .
To further examine the expression pattern of OsDIL, a qRT-PCR experiment was performed and the result showed that OsDIL was expressed in all tested tissues, with relatively high levels of expression in post-meiotic flowers, especially in the anther (Fig. 1a, b).The results suggest that OsDIL is important for the anther development. Because genes induced by one stress condition might also be regulated by other environmental signals, so the expression of OsDIL at the vegetative stage in response to different stresses was examined. The results showed that OsDIL was greatly induced by treatments with PEG6000 (20 %), NaCl (150 mM) or cold (4℃) (Fig. 1c), as well as by ABA (5 lM) (Fig. 1c), indicating that OsDIL is a stress responsive gene.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
State Key Laboratory of Genetic Engineering, Institute of Plant Biology, Center for Evolutionary Biology, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China.

==References==
<references>
* <ref name="ref1">Guo, C., et al. (2013). "The rice OsDIL gene plays a role in drought tolerance at vegetative and reproductive stages." Plant Mol Biol 82(3): 239-253 .
</ref>
</references>
== Structured Information ==
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 10]]
[[Category:Chromosome 10]]

Os05g0341600

2017-03-08T06:10:14Z

Xysj1981: /* References */

the rice gene '''Os05g0341600''' was recongized as '''''RAB21''''' in 1988, which is induced when plants are subject to water-stress.
==Annotated Information==
===Function===
the rice gene '''Os05g0341600''' was recongized as '''''RAB21''''' in 1988, which is induced to balance water-stress of plants. encoding a basic, glycine-rich protein (mol.wt 16 529) which has a duplicated domain structure. Immunoblots probed with antibodies raised against Bgalactosidase/RAB 21 fusion protein detect RAB 21 protein only in cytosolic cell fractions. <ref name="ref1" />
===Expression===
RAB 21 mRNA and protein accumulate in rice embryos, leaves, roots and callus-derived suspension cells upon treatment with NaCl (200 mM) and/or the plant hormone abscisic acid (10 /tMABA). The effects of NaCI and ABA are not cumulative, suggesting that these two inducers share a common response pathway. Induction of RAB 21 mRNA accumulation by ABA is rapid (< 15 min in suspension cells) and does not require protein synthesis, indicating that preformed nuclear and/or cytosolic factors mediate the response to this hormone.the reseachers have characterized the RAB 21 gene by deternmining the complete nucleotide sequence of a nearly full-length cDNA and corresponding genomiccopy, and by mapping the start site of its major transcript. The proximal promoter region contains various GC-rich repeats.[[File:12343.png]]

===Knowledge Extension===
The hormone abscisic acid (ABA) mediates a number of important physiological processes in plants (King, 1976;
Jones et al., 1987). Developmental studies have shown that ABA induces the accumulation of specific mRNAs and
proteins late during embryogenesis in seeds of diverse species (Galau et al., 1986; Finklestein et al., 1985; Litts et al.,1987). At this time, the level of endogenous ABA increases,the seeds desiccate and the embryos of some species become dormant (King, 1976; Suzuki et al., 1981). In cereal seeds,some of the 'late' developmental mRNAs are long-lived in mature, dry grains, but are rapidly degraded during seed germination. However, exogenously applied ABA causes the precocious accumulation of these mRNAs in immature embryos and their reappearance in germinating seeds (Finklestein et al., 1985; Mundy et al., 1986).
[[File:Abscisic acid.png]]

==Labs working on this gene==
Laboratory of Plant Molecular Biology, Rockefeller University, 1230 York Avenue, New York, NY 10021, USA

==References==
<references>
<ref name="ref1">Mundy, J. and N.-H. Chua (1988). "Abscisic acid and water-stress induce the expression of a novel rice gene." The EMBO Journal 7(8): 2279.</ref>
Bray EA, Beachy RN. Regulation by ABA of beta-Conglycinin Expression in Cultured Developing Soybean Cotyledons. Plant Physiol. 1985 Nov;79(3):746–750.</ref>
Finkelstein RR, Tenbarge KM, Shumway JE, Crouch ML. Role of ABA in Maturation of Rapeseed Embryos. Plant Physiol. 1985 Jul;78(3):630–636.</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 5]]
[[Category:Chromosome 5]]

Os07g0191600

2017-03-08T06:09:43Z

Xysj1981: /* Labs working on this gene */

The rice gene Os07g0191600 was reported as '''''STR2''''' in 2012<ref name="ref1" /> by researchers from Switzerland, Korea, USA and France.

==Annotated Information==
===Gene Symbol===
*'''''Os07g0191600 <=> STR2，OsSTR2

===Function===
* The half-size ABC transporters STR1 and STR2 are indispensable for mycorrhizal arbuscule formation in rice.
===Mutation===
* Mutation of either of the Oryza sativa (rice) ABCG transporters blocked arbuscule growth of different AM fungi at a small and stunted stage, recapitulating the phenotype of Medicago truncatula stunted arbuscule 1 and 2 (str1 and str2) mutants that are deficient in homologous ABCG genes.

===Sublocalization===
* The STR1/STR2 complex resides in the peri-arbuscular membrane, which represents the plant border of the apoplastic symbiotic interface

===Evolution===

You can also add sub-section(s) at will.
==Labs working on this gene==
*Department of Plant Molecular Biology, University of Lausanne, Biophore Building, 1015 Lausanne, Switzerland,
*Boyce Thompson Institute for Plant Research, Cornell University, Ithaca, NY 14853, USA,
*Crop Biotech Institute and Department of Plant Molecular Systems Biotechnology, Kyung Hee University, Yongin 446-701, Korea,
*CIRAD, UMR AGAP 1096, TA 108/03 Avenue Agropolis, 34398 Montpellier Cedex 5, France, and
*Department of Plant Biology, University of California Davis, Davis, CA 95616, USA

==References==
<references>
* <ref name="ref1">
Gutjahr C, Radovanovic D, Geoffroy J, Zhang Q, Siegler H, Chiapello M, Casieri
L, An K, An G, Guiderdoni E, Kumar CS, Sundaresan V, Harrison MJ, Paszkowski U.
The half-size ABC transporters STR1 and STR2 are indispensable for mycorrhizal
arbuscule formation in rice. Plant J. 2012 Mar;69(5):906-20. doi:
10.1111/j.1365-313X.2011.04842.x. PubMed PMID: 22077667.
</ref>
</references>

==Structured Information==
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 7]]

Os07g0492000

2017-03-08T06:09:07Z

Xysj1981: /* References */

Nucleoside diphosphate kinase (NDK) is a ubiquitous enzyme found in all organisms and cell types, and catalyzes the transfer of the phosphoryl group from a nucleoside triphosphate to a nucleoside diphosphate.

==Annotated Information==
===Function===
1. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice <ref name="ref1" />
2. OsNDPK1 expression in rice plants is enhanced upon infection with bacterial pathogens <ref name="ref2" />

===Expression===
Transcripts of OsNDPK1 accumulated strongly after infection with Xoo. When rice plants were infected with Burkholderia glumae, a bacterial grain/seedling rot pathogen, the pattern of expression of the rice NDPK genes was similar to that following infection with Xoo. OsNDPK1 gene expression was also strongly induced in response to exposure to salicylic acid, jasmonic acid, and abscisic acid, although the level of transcripts and their pattern of expression depended on the inducer.
[[File:Differential induction of the rice NDPK genes following treatment.jpg|right|thumb|150px|"Differential induction of the rice NDPK genes (from reference <ref name="ref2" />)."]]

===Evolution===
When OsNDPK1 was aligned with other rice NDPK isoforms, it proved to be moderately similar to the conserved regions of NP922751 (76% identity), OsNDPK2 (67% identity), and OsNDPK3 (55% identity).

You can also add sub-section(s) at will.

==Labs working on this gene==
Agricultural Plant Stress Research Center, Applied Plant Science Division, College of Agriculture and Life Sciences, Chonnam
National University, Gwangju 500-757, Korea;

==References==
<references>
<ref name="ref1">Huang J Y, Chang T, Chang C Y, et al. Crystal structure of nucleoside diphosphate kinase required for coleoptile elongation in rice ( Oryza sativa L.)[J]. Journal of structural biology, 2005, 150(3): 309-318.</ref>
<ref name="ref2"> Cho S M, Shin S H, Kim K S, et al. Enhanced expression of a gene encoding a nucleoside diphosphate kinase 1 (OsNDPK1) in rice plants upon infection with bacterial pathogens[J]. Mol Cells, 2004, 18(3): 390-395.</ref>
</references>
==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

Os01g0273800

2017-03-08T06:07:37Z

Xysj1981:

The rice '''''Os01g0273800''''' was reported as ''''' OsYUC9''''' in 2012 <ref name="ref1" /> by researchers from Australia.

==Annotated Information==
===Gene Symbol===
*'''''Os01g0273800''''' '''''<=>''''' '''''OsYUCCA9, OsYUC9, YUC9'''''
===Function===
* IAA production in developing rice grains is controlled via expression of '''''OsTAR1, OsYUC9, OsYUC11''''' and that IAA may be important during starch deposition in addition to its previously suggested role early in grain development.

===Expression===
* '''''OsYUC9''''' was expressed in endosperm.

===Evolution===
* Phylogenetic analysis indicated that OsYUC11 and AtYUC10 belong to a separate clade of YUCCAs, which do not have orthologues outside the Angiosperms. This clade may have evolved with a specific role in endosperm.

==Labs working on this gene==
* Molecular and Cellular Biology, University of New England, Armidale, New South Wales, Australia
* Department of Biochemistry and Molecular Biology, University of Massachusetts, Amherst, MA 01003, USA

==References==
<references>
* <ref name="ref1">
bu-Zaitoon YM, Bennett K, Normanly J, Nonhebel HM. A large increase in IAA
during development of rice grains correlates with the expression of tryptophan
aminotransferase OsTAR1 and a grain-specific YUCCA. Physiol Plant. 2012
Dec;146(4):487-99. doi: 10.1111/j.1399-3054.2012.01649.x. PubMed PMID: 22582989.
</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os12g0189500

2017-03-08T06:07:35Z

Xysj1981:

The rice '''''Os12g0189500''''' was reported as ''''' OsYUC11''''' in 2012 <ref name="ref1" /> by researchers from Australia.

==Annotated Information==
===Gene Symbol===
*'''''Os04g0459000''''' '''''<=>''''' '''''OsYUCCA11, OsYUC11'''''

===Function===
* IAA production in developing rice grains is controlled via expression of '''''OsTAR1, OsYUC9,OsYUC11''''' and that IAA may be important during starch deposition in addition to its previously suggested role early in grain development.

===Expression===
* '''''OsYUC11''''' was expressed in endosperm, the expression of '''''OsYUC11''''' appeared to be confined to endosperm tissue

===Evolution===
* Phylogenetic analysis indicated that OsYUC11 and AtYUC10 belong to a separate clade of YUCCAs, which do not have orthologues outside the Angiosperms. This clade may have evolved with a specific role in endosperm.

==Labs working on this gene==
* Molecular and Cellular Biology, University of New England, Armidale, New South Wales, Australia
* Department of Biochemistry and Molecular Biology, University of Massachusetts, Amherst, MA 01003, USA

==References==
<references>
* <ref name="ref1">
bu-Zaitoon YM, Bennett K, Normanly J, Nonhebel HM. A large increase in IAA
during development of rice grains correlates with the expression of tryptophan
aminotransferase OsTAR1 and a grain-specific YUCCA. Physiol Plant. 2012
Dec;146(4):487-99. doi: 10.1111/j.1399-3054.2012.01649.x. PubMed PMID: 22582989.
</ref>
</references>

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]

==Structured Information==

Os12g0189500

2017-03-08T06:03:54Z

Xysj1981: /* Labs working on this gene */

The rice '''''Os12g0189500''''' was reported as ''''' OsYUC11''''' in 2012 <ref name="ref1" /> by researchers from Australia.

==Annotated Information==
===Gene Symbol===
*'''''Os04g0459000''''' '''''<=>''''' '''''OsYUCCA11, OsYUC11'''''

===Function===
* IAA production in developing rice grains is controlled via expression of OsTAR1, OsYUC9, '''''OsYUC11''''' and that IAA may be important during starch deposition in addition to its previously suggested role early in grain development.

===Expression===
* '''''OsYUC11''''' was expressed in endosperm, the expression of '''''OsYUC11''''' appeared to be confined to endosperm tissue

===Evolution===
* Phylogenetic analysis indicated that OsYUC11 and AtYUC10 belong to a separate clade of YUCCAs, which do not have orthologues outside the Angiosperms. This clade may have evolved with a specific role in endosperm.

==Labs working on this gene==
* Molecular and Cellular Biology, University of New England, Armidale, New South Wales, Australia
* Department of Biochemistry and Molecular Biology, University of Massachusetts, Amherst, MA 01003, USA

==References==
<references>
* <ref name="ref1">
bu-Zaitoon YM, Bennett K, Normanly J, Nonhebel HM. A large increase in IAA
during development of rice grains correlates with the expression of tryptophan
aminotransferase OsTAR1 and a grain-specific YUCCA. Physiol Plant. 2012
Dec;146(4):487-99. doi: 10.1111/j.1399-3054.2012.01649.x. PubMed PMID: 22582989.
</ref>
</references>

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]

==Structured Information==

Os12g0189500

2017-03-08T06:03:17Z

Xysj1981: /* Labs working on this gene */

The rice '''''Os12g0189500''''' was reported as ''''' OsYUC11''''' in 2012 <ref name="ref1" /> by researchers from Australia.

==Annotated Information==
===Gene Symbol===
*'''''Os04g0459000''''' '''''<=>''''' '''''OsYUCCA11, OsYUC11'''''

===Function===
* IAA production in developing rice grains is controlled via expression of OsTAR1, OsYUC9, '''''OsYUC11''''' and that IAA may be important during starch deposition in addition to its previously suggested role early in grain development.

===Expression===
* '''''OsYUC11''''' was expressed in endosperm, the expression of '''''OsYUC11''''' appeared to be confined to endosperm tissue

===Evolution===
* Phylogenetic analysis indicated that OsYUC11 and AtYUC10 belong to a separate clade of YUCCAs, which do not have orthologues outside the Angiosperms. This clade may have evolved with a specific role in endosperm.

==Labs working on this gene==
*Department of applied biological science, Al-Ghad International AppliedMedical Science University, Jeddah, Saudi Arabia

<references>
* <ref name="ref1">
bu-Zaitoon YM, Bennett K, Normanly J, Nonhebel HM. A large increase in IAA
during development of rice grains correlates with the expression of tryptophan
aminotransferase OsTAR1 and a grain-specific YUCCA. Physiol Plant. 2012
Dec;146(4):487-99. doi: 10.1111/j.1399-3054.2012.01649.x. PubMed PMID: 22582989.
</ref>
</references>

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]

==Structured Information==

RiceWiki:Curated Genes

2017-03-08T06:02:01Z

Xysj1981:

{|class="wikitable sortable" style="width:90%;text-align:center"
|-
!'''Gene Symbol'''
!'''RAP-DB-ID'''
!'''Total Contribution Score'''
!'''Summed Edit Quantity'''
!'''Averaged Edit Quality'''
!'''Contributor Count'''
!'''Edit Count*'''
!'''Last Edit Time'''
|-
|[[Os09g0114500|'''''BC12''''']]
|[[Os09g0114500]]
| 14.854
| 23746
| 0.626
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os10g0405500|'''''PAIR3''''']]
|[[Os10g0405500]]
| 10.742
| 10877
| 0.988
| 3
| 3
| 2014/6/8 23:39
|-
|[[Os09g0286400|'''''OsNHX5''''']]
|[[Os09g0286400]]
| 12.133
| 24113
| 0.503
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0306400|'''''OsbZIP71''''']]
|[[Os09g0306400]]
| 7.71
| 12551
| 0.614
| 2
| 2
| 2015/6/12 17:39
|-
|[[Os09g0417600|'''''OsWRKY76''''']]
|[[Os09g0417600]]
| 5.713
| 10209
| 0.56
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os09g0434200|'''''OsDSG1''''']]
|[[Os09g0434200]]
| 5.792
| 11879
| 0.488
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os10g0553300|'''''OsTPP2''''']]
|[[Os10g0553300]]
| 8.403
| 35721
| 0.235
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os10g0563600|'''''OsMSRA4.1''''']]
|[[Os10g0563600]]
| 7.778
| 13380
| 0.581
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0127600|'''''ONAC045''''']]
|[[Os11g0127600]]
| 7.065
| 12576
| 0.562
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os11g0648000|'''''OsNHX3''''']]
|[[Os11g0648000]]
| 7.638
| 15767
| 0.484
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os12g0569700|'''''OsHsp23.7''''']]
|[[Os12g0569700]]
| 6.412
| 13859
| 0.463
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os12g0583700|'''''ZFP252''''']]
|[[Os12g0583700]]
| 8.489
| 12862
| 0.66
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os08g0139000|'''''OsDEG10''''']]
|[[Os08g0139000]]
| 4.811
| 9008
| 0.534
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os08g0323700|'''''OsCCC1''''']]
|[[Os08g0323700]]
| 6.709
| 11315
| 0.593
| 2
| 2
| 2015/6/12 17:29
|-
|[[Os08g0441100|'''''OsCIPK06''''']]
|[[Os08g0441100]]
| 3.819
| 7418
| 0.515
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os08g0504700|'''''OsSAP11''''']]
|[[Os08g0504700]]
| 7.149
| 10763
| 0.664
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0540400|'''''OsCPK21''''']]
|[[Os08g0540400]]
| 10.561
| 19732
| 0.535
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os08g0546800|'''''OsHsfB2b''''']]
|[[Os08g0546800]]
| 12.399
| 23039
| 0.538
| 2
| 2
| 2015/6/12 17:34
|-
|[[Os07g0186000|'''''OsTRXh1''''']]
|[[Os07g0186000]]
| 7.817
| 12275
| 0.637
| 2
| 2
| 2015/6/12 16:34
|-
|[[Os07g0556800|'''''OSRIP18''''']]
|[[Os07g0556800]]
| 8.473
| 12924
| 0.656
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os07g0666900|'''''OsNHX1''''']]
|[[Os07g0666900]]
| 11.455
| 21522
| 0.532
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0678600|'''''OsCIPK2''''']]
|[[Os07g0678600]]
| 5.575
| 11240
| 0.496
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0693800|'''''OsFAD8''''']]
|[[Os07g0693800]]
| 5.613
| 11290
| 0.497
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os06g0130100|'''''OsSIK1''''']]
|[[Os06g0130100]]
| 11.48
| 22964
| 0.5
| 2
| 2
| 2015/6/12 16:04
|-
|[[Os06g0472000|'''''OsMSRB1.1''''']]
|[[Os06g0472000]]
| 6.592
| 12098
| 0.545
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os06g0561000|'''''OsMIOX''''']]
|[[Os06g0561000]]
| 6.249
| 12468
| 0.501
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os06g0603600|'''''OsSPX1''''']]
|[[Os06g0603600]]
| 7.774
| 15383
| 0.505
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os06g0612800|'''''OsiSAP8''''']]
|[[Os06g0612800]]
| 8.934
| 14002
| 0.638
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0644200|'''''OVP1''''']]
|[[Os06g0644200]]
| 10.007
| 15443
| 0.648
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0651100|'''''YK1''''']]
|[[Os06g0651100]]
| 8.803
| 18547
| 0.475
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0662200|'''''OsbZIP52''''']]
|[[Os06g0662200]]
| 6.942
| 12388
| 0.56
| 2
| 2
| 2015/6/12 16:22
|-
|[[Os06g0727200|'''''OsCATB''''']]
|[[Os06g0727200]]
| 6.864
| 13184
| 0.521
| 2
| 2
| 2015/6/12 16:27
|-
|[[Os03g0117900|'''''HYR''''']]
|[[Os03g0117900]]
| 5.381
| 8815
| 0.61
| 2
| 2
| 2015/6/12 12:59
|-
|[[Os09g0457900|'''''OsEATB''''']]
|[[Os09g0457900]]
| 42.219
| 42219
| 1
| 1
| 1
| 2014/6/6 14:12
|-
|[[Os06g0208800|'''''LYP6''''']]
|[[Os06g0208800]]
| 35.205
| 40853
| 0.862
| 2
| 2
| 2015/6/12 16:09
|-
|[[Os11g0587000|'''''DWARF27''''']]
|[[Os11g0587000]]
| 31.862
| 34044
| 0.936
| 2
| 4
| 2014/6/9 2:23
|-
|'''''[[GW5]]'''''
|
| 31.812
| 31817
| 1
| 2
| 2
| 2014/6/8 22:47
|-
|[[Os03g0122600|'''''OsMADS50''''']]
|[[Os03g0122600]]
| 31.778
| 36672
| 0.867
| 2
| 2
| 2015/6/12 13:00
|-
|'''''[[Du1]]'''''
|
| 26.789
| 26797
| 1
| 2
| 2
| 2014/6/5 11:51
|-
|[[Os01g0771200|'''''XB24''''']]
|[[Os01g0771200]]
| 25.112
| 106499
| 0.236
| 3
| 14
| 2015/5/13 15:32
|-
|'''''[[IPA1]]'''''
|
| 22.636
| 22636
| 1
| 1
| 1
| 2014/6/1 14:57
|-
|'''''[[AB013448]]'''''
|
| 21.65
| 21650
| 1
| 1
| 1
| 2014/6/8 17:24
|-
|[[Os10g0542100|'''''MT''''']]
|[[Os10g0542100]]
| 21.515
| 25382
| 0.848
| 3
| 3
| 2015/6/13 16:56
|-
|'''''[[MADS]]'''''
|
| 21.305
| 21310
| 1
| 3
| 3
| 2014/6/7 19:11
|-
|'''''[[MYB]]'''''
|
| 21.082
| 21418
| 0.984
| 2
| 2
| 2013/7/16 10:48
|-
|[[Os09g0272900|'''''PB''''']]
|[[Os09g0272900]]
| 21.033
| 24405
| 0.862
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os01g0848400|'''''qSH1''''']]
|[[Os01g0848400]]
| 20.688
| 31733
| 0.652
| 2
| 2
| 2015/5/13 15:40
|-
|[[Os09g0441900|'''''OsDEP1''''']]
|[[Os09g0441900]]
| 18.815
| 18855
| 0.998
| 5
| 5
| 2014/6/11 0:23
|-
|[[Os09g0240200|'''''CONSTANS''''']]
|[[Os09g0240200]]
| 18.077
| 26433
| 0.684
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os04g0271200|'''''SRT701''''']]
|[[Os04g0271200]]
| 18.041
| 18413
| 0.98
| 5
| 9
| 2014/6/10 16:01
|-
|[[Os01g0678500|'''''OsTPC1''''']]
|[[Os01g0678500]]
| 17.989
| 29118
| 0.618
| 6
| 7
| 2015/5/13 15:24
|-
|[[Os03g0332400|'''''OsGLYII-2''''']]
|[[Os03g0332400]]
| 17.603
| 17603
| 1
| 1
| 1
| 2014/12/27 21:46
|-
|[[Os06g0196700|'''''OsARF16'''''']]
|[[Os06g0196700]]
| 17.411
| 28849
| 0.604
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os07g0261200|'''''Ghd7''''']]
|[[Os07g0261200]]
| 17.077
| 17414
| 0.981
| 2
| 2
| 2014/6/1 17:56
|-
|'''''[[Xa7]]'''''
|
| 16.58
| 16580
| 1
| 1
| 1
| 2014/5/30 14:34
|-
|[[Os03g0227700|'''''OsDWARF4''''']]
|[[Os03g0227700]]
| 16.238
| 28577
| 0.568
| 4
| 6
| 2015/6/12 13:36
|-
|'''''[[Pb1]]'''''
|
| 15.987
| 15987
| 1
| 1
| 1
| 2014/6/3 15:06
|-
|[[Os12g0597000|'''''CBL''''']]
|[[Os12g0597000]]
| 15.897
| 25737
| 0.618
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os01g0841500|'''''OsMYB3R2''''']]
|[[Os01g0841500]]
| 15.635
| 27885
| 0.561
| 3
| 4
| 2015/5/13 15:39
|-
|[[Os01g0182600|'''''GI''''']]
|[[Os01g0182600]]
| 14.75
| 22705
| 0.65
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os08g0162100|'''''ASP1''''']]
|[[Os08g0162100]]
| 14.743
| 14743
| 1
| 1
| 1
| 2015/6/12 17:26
|-
|[[Os02g0738900|'''''OsDRP2B''''']]
|[[Os02g0738900]]
| 14.365
| 21439
| 0.67
| 2
| 2
| 2015/5/14 13:58
|-
|[[Os06g0594600|'''''OsAt10''''']]
|[[Os06g0594600]]
| 14.147
| 19008
| 0.744
| 3
| 4
| 2015/6/12 16:17
|-
|[[Os01g57340|'''''Npi37''''']]
|[[Os01g57340]]
| 14.08
| 14080
| 1
| 1
| 1
| 2014/5/27 20:22
|-
|[[Os01g0718300|'''''OsBRI1''''']]
|[[Os01g0718300]]
| 14.008
| 25923
| 0.54
| 3
| 3
| 2015/5/13 15:26
|-
|'''''[[Du2]]'''''
|
| 13.964
| 13964
| 1
| 2
| 2
| 2014/6/5 11:53
|-
|'''''[[OsMYB103L]]'''''
|
| 13.96
| 13960
| 1
| 1
| 1
| 2014/6/11 16:14
|-
|[[Os01g0782100|''''' Pi-sh''''']]
|[[Os01g0782100]]
| 13.897
| 27151
| 0.512
| 3
| 3
| 2015/5/13 15:34

|-
|[[Os06g0706400|'''''OsPTR9''''']]
|[[Os06g0706400]]
| 13.739
| 20020
| 0.686
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os08g0398400|'''''OsHIR1''''']]
|[[Os08g0398400]]
| 13.721
| 13748
| 0.998
| 3
| 6
| 2014/6/3 16:40
|-
|[[Os02g0141300|'''''CAP1''''']]
|[[Os02g0141300]]
| 13.71
| 28137
| 0.487
| 5
| 10
| 2015/5/14 13:21
|-
|[[Os07g0214100|'''''RAG1''''']]
|[[Os07g0214100]]
| 13.62
| 31302
| 0.435
| 2
| 2
| 2015/6/12 16:36
|-
|'''''[[DWT1]]'''''
|
| 13.275
| 13275
| 1
| 1
| 1
| 2014/5/31 12:55
|-
|[[Os01g0797600|'''''OsERF3''''']]
|[[Os01g0797600]]
| 13.247
| 13247
| 1
| 1
| 1
| 2014/5/25 15:17
|-
|[[Os01g0883800|'''''semidwarf-1''''']]
|[[Os01g0883800]]
| 13.17
| 24896
| 0.529
| 16
| 41
| 2016/6/17 17:22
|-
|[[Os08g0524100|'''''OsSRT1''''']]
|[[Os08g0524100]]
| 13.001
| 18711
| 0.695
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os08g0559300|'''''SPINDLY''''']]
|[[Os08g0559300]]
| 12.718
| 21018
| 0.605
| 3
| 6
| 2015/6/12 17:35
|-
|[[Os11g0225300|'''''PAMP''''']]
|[[Os11g0225300]]
| 12.691
| 23520
| 0.54
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os07g0155600|'''''OsEIN2''''']]
|[[Os07g0155600]]
| 12.605
| 18316
| 0.688
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os01g0607200|'''''OsBAT1''''']]
|[[Os01g0607200]]
| 12.553
| 19986
| 0.628
| 2
| 2
| 2015/5/13 15:17
|-
|[[Os07g0616800|'''''SUS''''']]
|[[Os07g0616800]]
| 12.42
| 26693
| 0.465
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os12g0102400|'''''OsRINGC2-2''''']]
|[[Os12g0102400]]
| 12.278
| 17739
| 0.692
| 3
| 3
| 2015/6/13 17:13
|-
|'''''[[WRKY]]'''''
|
| 12.226
| 12233
| 0.999
| 2
| 2
| 2014/5/31 12:44
|-
|[[Os10g0536100|'''''OsMADS50''''']]
|[[Os10g0536100]]
| 11.96
| 19080
| 0.627
| 3
| 3
| 2015/6/13 16:52
|-
|[[Os02g0725900|'''''HAP3''''']]
|[[Os02g0725900]]
| 11.931
| 16469
| 0.724
| 2
| 2
| 2015/5/14 13:55
|-
|[[Os01g0626400|'''''OsWRKY11''''']]
|[[Os01g0626400]]
| 11.902
| 18881
| 0.63
| 2
| 2
| 2015/5/13 15:20
|-
|[[Os01g0726400|'''''CFO1''''']]
|[[Os01g0726400]]
| 11.891
| 17625
| 0.675
| 2
| 2
| 2015/5/13 15:27
|-
|[[Os09g0422500|'''''OsCESA9''''']]
|[[Os09g0422500]]
| 11.747
| 23511
| 0.5
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os09g0250700|'''''OsABC1-12''''']]
|[[Os09g0250700]]
| 11.742
| 15681
| 0.749
| 2
| 2
| 2015/6/12 17:38
|-
|[[Os06g0701300|'''''OsABC1-8''''']]
|[[Os06g0701300]]
| 11.604
| 15691
| 0.74
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0126400|'''''OsCPK4''''']]
|[[Os02g0126400]]
| 11.6
| 22962
| 0.505
| 2
| 2
| 2015/5/14 13:20
|-
|[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]
|[[Os06g0570100]]
| 11.586
| 15710
| 0.737
| 3
| 3
| 2015/6/12 16:16
|-
|[[Os03g0793500|'''''Hd16''''']]
|[[Os03g0793500]]
| 11.531
| 15843
| 0.728
| 2
| 2
| 2015/5/15 13:43
|-
|[[Os01g0536000|'''''OsCIPK08''''']]
|[[Os01g0536000]]
| 11.52
| 15150
| 0.76
| 2
| 2
| 2015/5/13 15:15
|-
|[[Os03g0848700|'''''Bph14''''']]
|[[Os03g0848700]]
| 11.486
| 21573
| 0.532
| 4
| 4
| 2015/5/15 13:41
|-
|[[Os01g0907900|'''''PLA2''''']]
|[[Os01g0907900]]
| 11.483
| 11485
| 1
| 2
| 2
| 2014/6/2 17:56
|-
|[[Os07g0459200|'''''OsABC1-10''''']]
|[[Os07g0459200]]
| 11.449
| 15381
| 0.744
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os07g0102300|'''''SRL1''''']]
|[[Os07g0102300]]
| 11.423
| 22326
| 0.512
| 3
| 3
| 2015/6/12 16:30
|-
|[[Os07g0186200|'''''OsSIK2''''']]
|[[Os07g0186200]]
| 11.413
| 20165
| 0.566
| 3
| 3
| 2015/6/12 16:34
|-
|[[Os03g0226800|'''''CMT3''''']]
|[[Os03g0226800]]
| 11.245
| 21415
| 0.525
| 3
| 3
| 2015/6/12 13:36
|-
|[[Os08g0114200|'''''OsGLU3''''']]
|[[Os08g0114200]]
| 11.137
| 17754
| 0.627
| 2
| 2
| 2015/6/12 17:23
|-
|[[Os07g0596300|'''''FH5''''']]
|[[Os07g0596300]]
| 11.085
| 15490
| 0.716
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os02g0178800|'''''OsGL1-2''''']]
|[[Os02g0178800]]
| 11.079
| 14720
| 0.753
| 2
| 2
| 2015/5/14 13:23
|-
|[[Os03g0811100|''''' Chl1''''']]
|[[Os03g0811100]]
| 11.068
| 14957
| 0.74
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os09g0395300|'''''SLL1''''']]
|[[Os09g0395300]]
| 11.063
| 16461
| 0.672
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g03150|'''''TAD1''''']]
|[[Os03g03150]]
| 10.972
| 10972
| 1
| 1
| 1
| 2014/6/9 12:35
|-
|[[Os12g0189500|'''''OsYUC11''''']]
|[[Os12g0189500]]
| 10.931
| 20645
| 0.529
| 7
| 7
| 2015/6/13 17:16
|-
|[[Os06g0211200|'''''OsAREB1''''']]
|[[Os06g0211200]]
| 10.925
| 19995
| 0.546
| 5
| 6
| 2015/6/12 16:09
|-
|[[Os02g0100200|'''''HSP''''']]
|[[Os02g0100200]]
| 10.917
| 21797
| 0.501
| 2
| 2
| 2015/5/14 13:17
|-
|'''''[[BHLH]]'''''
|
| 10.829
| 10829
| 1
| 1
| 1
| 2013/7/21 20:47
|-
|[[Os11g0703900|'''''Hsp70''''']]
|[[Os11g0703900]]
| 10.813
| 10898
| 0.992
| 4
| 5
| 2014/6/9 23:54
|-
|[[Os01g44260|'''''OsDfr''''']]
|[[Os01g44260]]
| 10.787
| 10787
| 1
| 1
| 1
| 2014/6/9 21:48
|-
|[[Os03g0815100|'''''SNAC1''''']]
|[[Os03g0815100]]
| 10.722
| 15783
| 0.679
| 2
| 2
| 2015/5/15 13:42
|-
|[[Os10g0561400|'''''OsMYBS3''''']]
|[[Os10g0561400]]
| 10.656
| 22236
| 0.479
| 3
| 3
| 2015/6/13 16:57
|-
|[[Os11g0523800|'''''OsARF1''''']]
|[[Os11g0523800]]
| 10.633
| 21943
| 0.485
| 6
| 6
| 2015/6/13 17:08
|-
|[[Os07g0257200|'''''OsNRAMP5''''']]
|[[Os07g0257200]]
| 10.556
| 10556
| 1
| 1
| 1
| 2015/6/12 16:38
|-
|[[Os02g0661100|'''''OsTPP1''''']]
|[[Os02g0661100]]
| 10.544
| 18837
| 0.56
| 2
| 2
| 2015/5/14 13:51
|-
|[[Os07g0164000|'''''WAF1''''']]
|[[Os07g0164000]]
| 10.534
| 11864
| 0.888
| 2
| 2
| 2015/6/12 16:33
|-
|[[Os12g0476200|'''''Xa25''''']]
|[[Os12g0476200]]
| 10.44
| 17073
| 0.611
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os10g0497300|'''''Rf1a''''']]
|[[Os10g0497300]]
| 10.431
| 18232
| 0.572
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os07g0108900|'''''OsMADS15''''']]
|[[Os07g0108900]]
| 10.425
| 20545
| 0.507
| 4
| 5
| 2015/6/12 16:31
|-
|[[Os03g0215400|'''''MADS1''''']]
|[[Os03g0215400]]
| 10.412
| 14715
| 0.708
| 2
| 2
| 2015/6/12 13:34
|-
|[[Os08g0174700|'''''OsSERK1''''']]
|[[Os08g0174700]]
| 10.335
| 21519
| 0.48
| 2
| 2
| 2015/6/12 17:28
|-
|[[Os01g0121700|'''''OsWBC1''''']]
|[[Os01g0121700]]
| 10.278
| 14300
| 0.719
| 2
| 2
| 2015/5/13 14:49
|-
|[[Os01g0201700|'''''OsMADS3''''']]
|[[Os01g0201700]]
| 10.276
| 20440
| 0.503
| 2
| 2
| 2015/5/13 15:03
|-
|[[Os10g0577600|'''''JMJ706''''']]
|[[Os10g0577600]]
| 10.16
| 18081
| 0.562
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0839100|'''''ZFP179''''']]
|[[Os01g0839100]]
| 10.128
| 13298
| 0.762
| 2
| 2
| 2015/5/13 15:38
|-
|[[Os03g0237250|'''''LPA1''''']]
|[[Os03g0237250]]
| 10.125
| 14184
| 0.714
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0133000|'''''Waxy''''']]
|[[Os06g0133000]]
| 10.084
| 22204
| 0.454
| 3
| 3
| 2015/6/12 16:04
|-
|[[Os03g0805100|'''''SQS''']]
|[[Os03g0805100]]
| 10.051
| 13542
| 0.742
| 2
| 2
| 2015/5/15 13:42
|-
|'''''[[AB013449]]'''''
|
| 10.03
| 10030
| 1
| 1
| 1
| 2014/6/10 22:14
|-
|[[Os07g0605200|'''''OsMADS18''''']]
|[[Os07g0605200]]
| 10.027
| 19041
| 0.527
| 2
| 2
| 2015/6/12 16:47
|-
|[[Os06g0194900|'''''Sus''''']]
|[[Os06g0194900]]
| 10.026
| 20580
| 0.487
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os01g0764800|'''''GH3''''']]
|[[Os01g0764800]]
| 10.024
| 18674
| 0.537
| 2
| 2
| 2015/5/13 15:32
|-
|[[Os03g0111300|'''''NsLTPs''''']]
|[[Os03g0111300]]
| 10.013
| 12909
| 0.776
| 4
| 4
| 2015/6/12 12:57
|-
|[[Os10g0127900|'''''OsFbx352''''']]
|[[Os10g0127900]]
| 10.013
| 20618
| 0.486
| 4
| 8
| 2015/6/13 16:43
|-
|[[Os06g0662000|'''''OsVHA-A''''']]
|[[Os06g0662000]]
| 9.949
| 19796
| 0.503
| 2
| 2
| 2015/6/12 16:21
|-
|[[Os06g0254600|'''''CALEOSIN''''']]
|[[Os06g0254600]]
| 9.94
| 12129
| 0.82
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os06g0330100|'''''Pi-25''''']]
|[[Os06g0330100]]
| 9.935
| 18990
| 0.523
| 4
| 5
| 2015/6/12 16:13
|-
|[[Os06g0603000|'''''SE5''''']]
|[[Os06g0603000]]
| 9.889
| 9889
| 1
| 1
| 1
| 2014/6/9 17:03
|-
|[[Os08g0535200|'''''xa13''''']]
|[[Os08g0535200]]
| 9.858
| 18774
| 0.525
| 3
| 3
| 2015/6/12 17:34
|-
|[[Os12g0281300|'''''Pi-ta''''']]
|[[Os12g0281300]]
| 9.857
| 21855
| 0.451
| 4
| 4
| 2015/6/13 17:16
|-
|[[Os01g0919400|'''''SPS''''']]
|[[Os01g0919400]]
| 9.837
| 9837
| 1
| 1
| 1
| 2016/6/6 17:48
|-
|[[Os10g0573900|'''''OsNMD3''''']]
|[[Os10g0573900]]
| 9.818
| 16399
| 0.599
| 3
| 3
| 2015/6/13 16:59
|-
|[[Os01g0197100|'''''dwarf2''''']]
|[[Os01g0197100]]
| 9.81
| 19279
| 0.509
| 5
| 6
| 2015/5/13 14:59
|-
|[[Os11g0216300|'''''OsABC1-13''''']]
|[[Os11g0216300]]
| 9.795
| 13761
| 0.712
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os01g0102900|'''''Os-LIR1''''']]
|[[Os01g0102900]]
| 9.726
| 9726
| 1
| 1
| 1
| 2016/6/12 14:04
|-
|[[Os11g0249000|'''''NLS1''''']]
|[[Os11g0249000]]
| 9.718
| 17393
| 0.559
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os10g0467800|'''''OsCesA7''''']]
|[[Os10g0467800]]
| 9.68
| 22133
| 0.437
| 5
| 6
| 2015/6/13 16:48
|-
|[[Os02g0682200|'''''MADS6''''']]
|[[Os02g0682200]]
| 9.577
| 17192
| 0.557
| 3
| 13
| 2015/5/14 13:53
|-
|[[Os06g0569500|'''''GAs''''']]
|[[Os06g0569500]]
| 9.526
| 18834
| 0.506
| 2
| 2
| 2015/6/12 16:15
|-
|[[Os09g0456800|'''''OsHsfs''''']]
|[[Os09g0456800]]
| 9.468
| 13735
| 0.689
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0274900|'''''OsGMST1''''']]
|[[Os02g0274900]]
| 9.449
| 18241
| 0.518
| 2
| 2
| 2015/5/14 13:38
|-
|[[Os06g0724900|'''''ILA1''''']]
|[[Os06g0724900]]
| 9.361
| 19950
| 0.469
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os01g0611100|'''''OsRAN1''''']]
|[[Os01g0611100]]
| 9.349
| 15330
| 0.61
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os08g0509600|'''''OsSPL14''''']]
|[[Os08g0509600]]
| 9.346
| 17625
| 0.53
| 3
| 4
| 2015/6/12 17:32
|-
|[[Os07g0558000|'''''OsABC1-11''''']]
|[[Os07g0558000]]
| 9.337
| 13289
| 0.703
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0449000|'''''PTC1''''']]
|[[Os09g0449000]]
| 9.33
| 16966
| 0.55
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os04g0415000|'''''BY240''''']]
|[[Os04g0415000]]
| 9.31
| 9310
| 1
| 1
| 1
| 2014/6/6 19:55
|-
|[[Os07g0471000|'''''OsIRE1''''']]
|[[Os07g0471000]]
| 9.278
| 18586
| 0.499
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os03g0170900|'''''OsSUT1''''']]
|[[Os03g0170900]]
| 9.272
| 19337
| 0.479
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os06g0610300|'''''MOC1''''']]
|[[Os06g0610300]]
| 9.171
| 11979
| 0.766
| 2
| 2
| 2015/6/12 16:19
|-
|[[Os06g0583400|'''''OsHDAC702''''']]
|[[Os06g0583400]]
| 9.15
| 11481
| 0.797
| 2
| 2
| 2015/6/12 16:16
|-
|[[Os02g0622100|'''''LTG1''''']]
|[[Os02g0622100]]
| 9.147
| 12303
| 0.743
| 2
| 2
| 2015/5/14 13:47
|-
|[[Os03g0203200|'''''HTD2''''']]
|[[Os03g0203200]]
| 9.128
| 17233
| 0.53
| 4
| 4
| 2015/6/12 13:06
|-
|[[Os06g0660200|'''''OsPIN2''''']]
|[[Os06g0660200]]
| 9.119
| 20530
| 0.444
| 5
| 6
| 2015/6/12 16:21
|-
|[[Os10g0403000|'''''PLA1 ''''']]
|[[Os10g0403000]]
| 9.104
| 15463
| 0.589
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os03g0112700|'''''Ehd4''''']]
|[[Os03g0112700]]
| 9.094
| 17122
| 0.531
| 3
| 3
| 2015/6/12 12:58
|-
|[[Os02g0799100|'''''Ossgo1''''']]
|[[Os02g0799100]]
| 9.068
| 16095
| 0.563
| 3
| 6
| 2015/5/14 14:02
|-
|[[Os09g0307800|'''''SDG724''''']]
|[[Os09g0307800]]
| 9.029
| 11279
| 0.801
| 4
| 15
| 2014/6/6 8:56
|-
|[[Os08g0424500|'''''Badh2''''']]
|[[Os08g0424500]]
| 9.021
| 17768
| 0.508
| 3
| 3
| 2015/6/12 17:30
|-
|[[Os11g0184900|'''''OsNAC5''''']]
|[[Os11g0184900]]
| 9.016
| 15182
| 0.594
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0203700|'''''SRZ1''''']]
|[[Os02g0203700]]
| 9.003
| 12324
| 0.731
| 2
| 2
| 2015/5/14 13:26
|-
|[[Os06g0125000|'''''RPM1''''']]
|[[Os06g0125000]]
| 8.97
| 12695
| 0.707
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os03g0128700|'''''OsCDPK13''''']]
|[[Os03g0128700]]
| 8.928
| 17882
| 0.499
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os03g0215200|'''''DL''''']]
|[[Os03g0215200]]
| 8.927
| 14196
| 0.629
| 3
| 3
| 2015/6/12 13:07
|-
|[[Os01g0952800|'''''OsIRO2''''']]
|[[Os01g0952800]]
| 8.922
| 8922
| 1
| 1
| 1
| 2014/6/10 21:52
|-
|[[Os06g0494100|'''''Pi-d2''''']]
|[[Os06g0494100]]
| 8.906
| 12742
| 0.699
| 3
| 3
| 2015/6/12 16:14
|-
|[[Os03g0149100|'''''OsCrl1''''']]
|[[Os03g0149100]]
| 8.897
| 13456
| 0.661
| 3
| 4
| 2015/6/12 11:15
|-
|'''''[[BZIP]]'''''
|
| 8.894
| 8924
| 0.997
| 2
| 2
| 2013/7/21 21:01
|-
|[[Os06g0625900|'''''OsHAK10''''']]
|[[Os06g0625900]]
| 8.872
| 13033
| 0.681
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os06g0229800|'''''ALK''''']]
|[[Os06g0229800]]
| 8.835
| 16807
| 0.526
| 2
| 2
| 2015/6/12 16:11
|-
|[[Os07g0232900|'''''OsHMA3''''']]
|[[Os07g0232900]]
| 8.79
| 18004
| 0.488
| 3
| 8
| 2015/6/12 16:37
|-
|[[Os07g0129700|'''''OSH15''''']]
|[[Os07g0129700]]
| 8.789
| 18504
| 0.475
| 3
| 3
| 2015/6/12 16:32
|-
|[[Os12g0641400|'''''OsSUT2''''']]
|[[Os12g0641400]]
| 8.735
| 8735
| 1
| 1
| 1
| 2016/6/12 13:56
|-
|[[Os08g0137100|'''''OsFIE2''''']]
|[[Os08g0137100]]
| 8.717
| 8717
| 1
| 1
| 1
| 2015/6/12 17:25
|-
|'''''[[Htd1]]'''''
|
| 8.705
| 8705
| 1
| 1
| 1
| 2014/6/10 14:14
|-
|[[Os03g0707600|'''''GAI''''']]
|[[Os03g0707600]]
| 8.666
| 16659
| 0.52
| 2
| 5
| 2014/5/28 0:43
|-
|'''''[[Xa23]]'''''
|
| 8.641
| 8641
| 1
| 1
| 1
| 2014/5/31 21:49
|-
|[[Os11g0235200|'''''SP1''''']]
|[[Os11g0235200]]
| 8.563
| 17156
| 0.499
| 3
| 3
| 2015/6/13 17:05
|-
|[[Os07g0100600|'''''OsPTR1''''']]
|[[Os07g0100600]]
| 8.559
| 15027
| 0.57
| 2
| 2
| 2015/6/12 16:30
|-
|[[Os06g0597000|'''''OsIAA23''''']]
|[[Os06g0597000]]
| 8.509
| 16209
| 0.525
| 4
| 11
| 2014/5/19 22:42
|-
|[[Os02g0232100|'''''HEI10''''']]
|[[Os02g0232100]]
| 8.485
| 15567
| 0.545
| 2
| 2
| 2015/5/14 13:36
|-
|[[Os04g0452500|'''''ZEP1''''']]
|[[Os04g0452500]]
| 8.484
| 8484
| 1
| 1
| 1
| 2014/5/31 16:56
|-
|[[Os09g0363900|'''''ONI3''''']]
|[[Os09g0363900]]
| 8.473
| 12412
| 0.683
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os09g0426800|'''''WSL2''''']]
|[[Os09g0426800]]
| 8.447
| 9634
| 0.877
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0253300|'''''alpha-1a''''']]
|[[Os01g0253300]]
| 8.439
| 17745
| 0.476
| 5
| 5
| 2015/5/13 15:07
|-
|[[Os06g0683400|'''''OsCCD1''''']]
|[[Os06g0683400]]
| 8.438
| 8438
| 1
| 1
| 1
| 2016/6/12 14:00
|-
|[[Os09g0522000|'''''OsDREB''''']]
|[[Os09g0522000]]
| 8.335
| 8335
| 1
| 1
| 1
| 2014/5/24 21:12
|-
|[[Os02g0580300|'''''GID2''''']]
|[[Os02g0580300]]
| 8.329
| 15752
| 0.529
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os08g0499300|'''''OsWRKY30''''']]
|[[Os08g0499300]]
| 8.324
| 17032
| 0.489
| 2
| 2
| 2015/6/12 17:32
|-
|[[Os08g0445700|'''''TPS''''']]
|[[Os08g0445700]]
| 8.317
| 10922
| 0.761
| 2
| 2
| 2015/6/12 17:31
|-
|[[Os10g0505700|'''''LTPs''''']]
|[[Os10g0505700]]
| 8.312
| 16220
| 0.512
| 5
| 6
| 2015/6/13 16:46
|-
|[[Os11g0559200|'''''OsXa21''''']]
|[[Os11g0559200]]
| 8.294
| 15586
| 0.532
| 6
| 9
| 2015/6/13 17:08
|-
|[[Os03g0179400|'''''GUDK''''']]
|[[Os03g0179400]]
| 8.292
| 14840
| 0.559
| 2
| 2
| 2015/6/12 13:04
|-
|[[Os02g0553200|'''''OsAPx8''''']]
|[[Os02g0553200]]
| 8.204
| 8204
| 1
| 1
| 1
| 2014/6/8 16:03
|-
|[[Os01g0571300|'''''OsHsfA7''''']]
|[[Os01g0571300]]
| 8.184
| 14946
| 0.548
| 2
| 2
| 2015/5/13 15:16
|-
|[[Os09g0401100|'''''STR1''''']]
|[[Os09g0401100]]
| 8.183
| 17216
| 0.475
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os02g0181300|'''''WRKY''''']]
|[[Os02g0181300]]
| 8.174
| 13252
| 0.617
| 2
| 2
| 2015/5/14 13:24
|-
|[[Os05g0346200|'''''OsDREB2B2''''']]
|[[Os05g0346200]]
| 8.14
| 8233
| 0.989
| 2
| 3
| 2014/6/5 17:14
|-
|[[Os09g0502100|'''''LGD1''''']]
|[[Os09g0502100]]
| 8.139
| 15501
| 0.525
| 2
| 2
| 2015/6/12 22:35
|-
|[[Os03g0820300|'''''ZFP182''''']]
|[[Os03g0820300]]
| 8.137
| 11604
| 0.701
| 2
| 2
| 2015/5/15 13:41
|-
|[[Os03g0230300|'''''OsSRO1c''''']]
|[[Os03g0230300]]
| 8.029
| 15193
| 0.528
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os07g0438800|'''''OsPHR2''''']]
|[[Os07g0438800]]
| 8.026
| 15610
| 0.514
| 2
| 2
| 2015/6/12 16:39
|-
|[[Os02g0534400|'''''OsCIN1''''']]
|[[Os02g0534400]]
| 7.997
| 16635
| 0.481
| 2
| 2
| 2015/5/14 13:41
|-
|[[Os06g0165600|'''''OsDREB1D''''']]
|[[Os06g0165600]]
| 7.982
| 11937
| 0.669
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os11g0490600|'''''LAZY1''''']]
|[[Os11g0490600]]
| 7.98
| 16603
| 0.481
| 4
| 5
| 2015/6/13 17:07
|-
|[[Os07g0585700|'''''Sdr4''''']]
|[[Os07g0585700]]
| 7.966
| 7966
| 1
| 1
| 1
| 2014/6/9 23:14
|-
|[[Os01g0194300|'''''OsNPR1''''']]
|[[Os01g0194300]]
| 7.966
| 11111
| 0.717
| 2
| 2
| 2015/5/13 14:59
|-
|[[Os01g0869900|'''''SNF1''''']]
|[[Os01g0869900]]
| 7.964
| 16289
| 0.489
| 2
| 2
| 2015/5/13 15:42
|-
|[[Os06g0160700|'''''SSSl''''']]
|[[Os06g0160700]]
| 7.962
| 15027
| 0.53
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os09g0451500|'''''PDI''''']]
|[[Os09g0451500]]
| 7.903
| 10040
| 0.787
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os01g0759400|'''''OsCIPK12''''']]
|[[Os01g0759400]]
| 7.902
| 15742
| 0.502
| 2
| 2
| 2015/5/13 15:30
|-
|[[Os06g0205100|'''''OsC1-Myb''''']]
|[[Os06g0205100]]
| 7.891
| 12914
| 0.611
| 2
| 2
| 2015/6/12 16:08
|-
|[[Os09g0244900|'''''Ypt1p''''']]
|[[Os09g0244900]]
| 7.89
| 11371
| 0.694
| 2
| 2
| 2015/6/12 17:38
|-
|'''''[[HTD2]]'''''
|
| 7.887
| 7887
| 1
| 1
| 1
| 2014/6/4 22:20
|-
|[[Os09g0482400|'''''HSP82''''']]
|[[Os09g0482400]]
| 7.873
| 11843
| 0.665
| 2
| 2
| 2015/6/12 17:47
|-
|[[Os10g0478000|'''''TAW1''''']]
|[[Os10g0478000]]
| 7.871
| 12275
| 0.641
| 4
| 5
| 2015/6/13 16:47
|-
|[[Os07g0258400|'''''OsNRAMP1''''']]
|[[Os07g0258400]]
| 7.866
| 13708
| 0.574
| 2
| 2
| 2015/6/12 16:38
|-
|[[Os10g0445400|'''''OsHCI1''''']]
|[[Os10g0445400]]
| 7.848
| 15652
| 0.501
| 6
| 15
| 2015/6/13 16:48
|-
|[[Os01g0273800|'''''OsYUC9''''']]
|[[Os01g0273800]]
| 7.843
| 9988
| 0.785
| 2
| 2
| 2015/5/13 15:10
|-
|[[Os01g0643300|'''''OsPIN10a''''']]
|[[Os01g0643300]]
| 7.839
| 16276
| 0.482
| 3
| 3
| 2015/5/13 15:22
|-
|[[Os06g0286700|'''''Pi9''''']]
|[[Os06g0286700]]
| 7.816
| 16653
| 0.469
| 6
| 9
| 2015/6/12 16:13
|-
|[[Os11g0104300|'''''DWARF53''''']]
|[[Os11g0104300]]
| 7.791
| 11682
| 0.667
| 4
| 4
| 2015/6/13 17:00
|-
|[[Os07g0150700|'''''Os-AKT1''''']]
|[[Os07g0150700]]
| 7.79
| 15994
| 0.487
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os09g0494200|'''''BC15''''']]
|[[Os09g0494200]]
| 7.776
| 7776
| 1
| 1
| 1
| 2014/6/3 23:51
|-
|[[Os03g0181500|'''''ONI1''''']]
|[[Os03g0181500]]
| 7.751
| 12230
| 0.634
| 3
| 4
| 2015/6/12 13:05
|-
|[[Os02g0814200|'''''OsGL1-6''''']]
|[[Os02g0814200]]
| 7.743
| 13379
| 0.579
| 2
| 2
| 2015/5/14 14:03
|-
|[[Os02g0103800|'''''OsLFNR1''''']]
|[[Os02g0103800]]
| 7.686
| 7686
| 1
| 1
| 1
| 2016/6/12 14:12
|-
|[[Os11g0225100|'''''Pia''''']]
|[[Os11g0225100]]
| 7.669
| 12296
| 0.624
| 3
| 3
| 2015/6/13 17:04
|-
|'''''[[Pi1]]'''''
|
| 7.644
| 7644
| 1
| 1
| 1
| 2014/6/5 17:02
|-
|[[Os01g0307500|'''''SKC1''''']]
|[[Os01g0307500]]
| 7.639
| 7639
| 1
| 1
| 1
| 2014/6/7 21:57
|-
|'''''[[Chalk5]]'''''
|
| 7.635
| 7635
| 1
| 1
| 1
| 2014/5/29 11:10
|-
|[[Os08g0140300|'''''TDC''''']]
|[[Os08g0140300]]
| 7.633
| 13769
| 0.554
| 2
| 2
| 2015/6/12 17:26
|-
|[[Os07g0622900|'''''DTM1''''']]
|[[Os07g0622900]]
| 7.632
| 14288
| 0.534
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os01g0292200|'''''OsCIPK1''''']]
|[[Os01g0292200]]
| 7.626
| 12859
| 0.593
| 2
| 2
| 2015/5/13 15:11
|-
|[[Os03g0230500|'''''DSM3''''']]
|[[Os03g0230500]]
| 7.618
| 14126
| 0.539
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os12g0472500|'''''OsTDL1A''''']]
|[[Os12g0472500]]
| 7.581
| 13819
| 0.549
| 4
| 4
| 2015/6/13 17:17
|-
|[[Os03g0262900|'''''glup6''''']]
|[[Os03g0262900]]
| 7.571
| 15719
| 0.482
| 2
| 2
| 2015/6/12 13:38
|-
|[[Os06g0107700|'''''OsLFNR2''''']]
|[[Os06g0107700]]
| 7.533
| 7533
| 1
| 1
| 1
| 2016/6/6 9:33
|-
|[[Os02g57310|'''''Pib''''']]
|[[Os02g57310]]
| 7.531
| 7531
| 1
| 1
| 1
| 2014/6/6 14:27
|-
|[[Os09g0104200|'''''OsRAD51D''''']]
|[[Os09g0104200]]
| 7.502
| 15399
| 0.487
| 3
| 3
| 2015/6/12 17:37
|-
|[[Os06g0142600|'''''Hd17''''']]
|[[Os06g0142600]]
| 7.492
| 11545
| 0.649
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os03g0788500|'''''OsCPK10''''']]
|[[Os03g0788500]]
| 7.454
| 10159
| 0.734
| 2
| 2
| 2015/5/15 13:44
|-
|[[Os06g0139000|'''''F-box''''']]
|[[Os06g0139000]]
| 7.443
| 15282
| 0.487
| 3
| 4
| 2015/6/12 16:05
|-
|[[Os03g0168600|'''''CYP704B2''''']]
|[[Os03g0168600]]
| 7.43
| 12348
| 0.602
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os11g0117400|'''''OsWRKY89''''']]
|[[Os11g0117400]]
| 7.353
| 11607
| 0.633
| 3
| 3
| 2015/6/13 17:01
|-
|[[Os03g0223400|'''''OsGLN1_2''''']]
|[[Os03g0223400]]
| 7.313
| 14417
| 0.507
| 3
| 3
| 2015/6/12 13:35
|-
|[[Os02g0731200|'''''MADS57''''']]
|[[Os02g0731200]]
| 7.311
| 14927
| 0.49
| 2
| 2
| 2015/5/14 13:56
|-
|[[Os09g02650|'''''BC12''''']]
|[[Os09g02650]]
| 7.302
| 7302
| 1
| 1
| 1
| 2014/6/1 19:01
|-
|[[Os01g0859300|'''''OsABI5''''']]
|[[Os01g0859300]]
| 7.265
| 12246
| 0.593
| 2
| 2
| 2015/5/13 15:41
|-
|[[Os08g0105000|'''''Ghd7''''']]
|[[Os08g0105000]]
| 7.237
| 15311
| 0.473
| 4
| 4
| 2015/6/12 17:23
|-
|[[Os03g0110800|'''''OsDRM2''''']]
|[[Os03g0110800]]
| 7.203
| 14838
| 0.485
| 2
| 2
| 2015/6/12 12:57
|-
|[[Os01g0367100|'''''PHD1''''']]
|[[Os01g0367100]]
| 7.2
| 12561
| 0.573
| 3
| 3
| 2015/6/9 9:53
|-
|[[Os02g0191600|'''''OsbZIP16''''']]
|[[Os02g0191600]]
| 7.2
| 13785
| 0.522
| 2
| 2
| 2015/5/14 13:25
|-
|[[Os08g0137250|'''''FIE1''''']]
|[[Os08g0137250]]
| 7.185
| 14660
| 0.49
| 2
| 2
| 2015/6/12 17:25
|-
|[[Os02g0220400|'''''Cga1''''']]
|[[Os02g0220400]]
| 7.158
| 17791
| 0.402
| 6
| 8
| 2015/5/14 13:36
|-
|[[Os10g0404500|'''''SUTs''''']]
|[[Os10g0404500]]
| 7.151
| 7164
| 0.998
| 2
| 2
| 2014/6/7 23:34
|-
|[[Os10g0177200|'''''OsDSR-1''''']]
|[[Os10g0177200]]
| 7.15
| 9017
| 0.793
| 3
| 3
| 2015/6/13 16:45
|-
|[[Os10g0496900|'''''OsPORB''''']]
|[[Os10g0496900]]
| 7.143
| 14022
| 0.509
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os02g0313400|'''''API5''''']]
|[[Os02g0313400]]
| 7.12
| 14554
| 0.489
| 2
| 2
| 2015/5/14 13:39
|-
|[[Os08g0117000|'''''PSS1''''']]
|[[Os08g0117000]]
| 7.092
| 8202
| 0.865
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os08g0531700|'''''MADS-box''''']]
|[[Os08g0531700]]
| 7.054
| 13276
| 0.531
| 2
| 2
| 2015/6/12 17:33
|-
|[[Os06g0499500|'''''GH3''''']]
|[[Os06g0499500]]
| 7.051
| 12958
| 0.544
| 3
| 4
| 2015/6/12 16:15
|-
|[[Os03g0188400|'''''OsSRT1''''']]
|[[Os03g0188400]]
| 7.05
| 12067
| 0.584
| 2
| 2
| 2015/6/12 13:06
|-
|[[Os02g0649900|'''''OsYSL2''''']]
|[[Os02g0649900]]
| 7.031
| 12503
| 0.562
| 2
| 2
| 2015/5/14 13:48
|-
|[[Os09g0442700|'''''OsDDM1''''']]
|[[Os09g0442700]]
| 7.028
| 10589
| 0.664
| 2
| 2
| 2015/6/12 17:44
|-
|[[Os12g0438600|'''''AtCLC-a''''']]
|[[Os12g0438600]]
| 7.022
| 14835
| 0.473
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os07g0124700|'''''CRL5''''']]
|[[Os07g0124700]]
| 6.998
| 14469
| 0.484
| 2
| 2
| 2015/6/12 16:31
|-
|[[Os11g0639100|'''''Pi54''''']]
|[[Os11g0639100]]
| 6.934
| 11269
| 0.615
| 4
| 4
| 2015/6/13 17:09
|-
|[[Os01g0615050|'''''OCPI1''''']]
|[[Os01g0615050]]
| 6.92
| 9869
| 0.701
| 2
| 2
| 2015/5/13 15:18
|-
|[[Os12g0610200|'''''OsPIL11''''']]
|[[Os12g0610200]]
| 6.911
| 12604
| 0.548
| 4
| 4
| 2015/6/13 17:18
|-
|[[Os03g0123300|'''''TAD1''''']]
|[[Os03g0123300]]
| 6.87
| 15272
| 0.45
| 4
| 8
| 2015/6/12 13:00
|-
|[[Os07g0682800|'''''rth1''''']]
|[[Os07g0682800]]
| 6.853
| 13550
| 0.506
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os11g0446000|'''''RSS3''''']]
|[[Os11g0446000]]
| 6.838
| 13942
| 0.49
| 5
| 5
| 2015/6/13 17:07
|-
|[[Os07g0182900|'''''OsMET1a''''']]
|[[Os07g0182900]]
| 6.821
| 13295
| 0.513
| 5
| 11
| 2015/6/12 16:33
|-
|[[Os01g0205700|'''''OsGSK1''''']]
|[[Os01g0205700]]
| 6.813
| 12490
| 0.545
| 2
| 2
| 2015/5/13 15:04
|-
|[[Os05g0333200|'''''GPA1''''']]
|[[Os05g0333200]]
| 6.778
| 8703
| 0.779
| 2
| 2
| 2014/6/9 9:17
|-
|[[Os10g0167600|'''''OsCPDP''''']]
|[[Os10g0167600]]
| 6.756
| 14570
| 0.464
| 4
| 4
| 2015/6/13 16:45
|-
|[[Os07g0227800|'''''OsABC1-9''''']]
|[[Os07g0227800]]
| 6.744
| 10826
| 0.623
| 2
| 2
| 2015/6/12 16:37
|-
|[[Os10g0567400|'''''OsCAO1''''']]
|[[Os10g0567400]]
| 6.732
| 13437
| 0.501
| 3
| 3
| 2015/6/13 16:58
|-
|'''''[[DEP2]]'''''
|
| 6.724
| 6763
| 0.994
| 3
| 7
| 2014/6/10 22:30
|-
|[[Os07g0592600|'''''OsMGH3''''']]
|[[Os07g0592600]]
| 6.72
| 15320
| 0.439
| 5
| 11
| 2015/6/12 16:46
|-
|[[Os11g0126900|'''''OsNAC10''''']]
|[[Os11g0126900]]
| 6.705
| 6705
| 1
| 1
| 1
| 2014/5/24 12:41
|-
|[[Os09g0561600|'''''OsDEES1''''']]
|[[Os09g0561600]]
| 6.699
| 11352
| 0.59
| 2
| 2
| 2015/6/13 16:42
|-
|'''''[[Sub1A]]'''''
|
| 6.679
| 6679
| 1
| 1
| 1
| 2014/6/4 16:03
|-
|[[Os08g0126300|'''''OsGAPDH''''']]
|[[Os08g0126300]]
| 6.658
| 13730
| 0.485
| 2
| 2
| 2015/6/12 17:24
|-
|[[Os10g0533600|'''''OsMPK6''''']]
|[[Os10g0533600]]
| 6.522
| 8207
| 0.795
| 3
| 3
| 2015/6/13 16:46
|-
|[[Os10g0397400|'''''dwarf2''''']]
|[[Os10g0397400]]
| 6.52
| 11105
| 0.587
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os06g0712700|'''''OsMADS16''''']]
|[[Os06g0712700]]
| 6.51
| 7624
| 0.854
| 2
| 2
| 2014/6/9 16:43
|-
|[[Os08g0237000|'''''OsXTH8''''']]
|[[Os08g0237000]]
| 6.46
| 6460
| 1
| 1
| 1
| 2014/6/9 18:44
|-
|[[Os02g0811000|'''''TH1''''']]
|[[Os02g0811000]]
| 6.453
| 11487
| 0.562
| 2
| 2
| 2015/5/14 14:02
|-
|[[Os07g0505200|'''''OsSPL13''''']]
|[[Os07g0505200]]
| 6.444
| 6444
| 1
| 1
| 1
| 2016/6/13 9:49
|-
|[[Os11g0247300|'''''Srs5''''']]
|[[Os11g0247300]]
| 6.442
| 13081
| 0.492
| 4
| 4
| 2015/6/13 17:05
|-
|[[AY986492|'''''Xa27''''']]
|[[AY986492]]
| 6.408
| 6408
| 1
| 2
| 2
| 2014/6/10 21:12
|-
|[[Os06g0700700|'''''OsHMA2''''']]
|[[Os06g0700700]]
| 6.404
| 6404
| 1
| 1
| 1
| 2014/6/3 20:16
|-
|[[Os02g0771400|'''''OsPFA-DSP2''''']]
|[[Os02g0771400]]
| 6.399
| 6702
| 0.955
| 2
| 3
| 2014/5/12 16:03
|-
|[[Os06g0127800|'''''DLT''''']]
|[[Os06g0127800]]
| 6.393
| 10797
| 0.592
| 2
| 2
| 2015/6/12 16:03
|-
|[[Os02g0120500|'''''OsTDR''''']]
|[[Os02g0120500]]
| 6.372
| 6372
| 1
| 1
| 1
| 2015/5/14 13:19
|-
|[[Os03g0854500|'''''OsHsfs''''']]
|[[Os03g0854500]]
| 6.367
| 10086
| 0.631
| 2
| 2
| 2015/5/15 13:40
|-
|[[Os06g0275000|'''''Hd1''''']]
|[[Os06g0275000]]
| 6.307
| 11994
| 0.526
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os02g0759800|'''''OsSKIPa''''']]
|[[Os02g0759800]]
| 6.249
| 12883
| 0.485
| 2
| 2
| 2015/5/14 14:00
|-
|[[Os08g0101000|'''''IDEF1''''']]
|[[Os08g0101000]]
| 6.239
| 10862
| 0.574
| 2
| 2
| 2015/6/12 17:22
|-
|[[Os09g0456200|'''''OsbZIP72''''']]
|[[Os09g0456200]]
| 6.23
| 10901
| 0.572
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os12g0101600|'''''leaf2''''']]
|[[Os12g0101600]]
| 6.221
| 35095
| 0.177
| 2
| 3
| 2014/5/31 21:22
|-
|[[Os06g0695800|'''''STAR1''''']]
|[[Os06g0695800]]
| 6.213
| 8582
| 0.724
| 2
| 2
| 2015/6/12 16:24
|-
|[[Os02g0606700|'''''RSS1''''']]
|[[Os02g0606700]]
| 6.198
| 12432
| 0.499
| 2
| 2
| 2015/5/14 13:44
|-
|[[Os11g0210300|'''''Adh1''''']]
|[[Os11g0210300]]
| 6.196
| 12384
| 0.5
| 3
| 3
| 2015/6/13 17:04
|-
|[[Os02g0736400|'''''OsDHODH''''']]
|[[Os02g0736400]]
| 6.183
| 11839
| 0.522
| 2
| 2
| 2015/5/14 13:57
|-
|[[Os08g0549100|'''''OsAPx4''''']]
|[[Os08g0549100]]
| 6.175
| 10093
| 0.612
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os09g0452200|'''''LYP4''''']]
|[[Os09g0452200]]
| 6.171
| 11987
| 0.515
| 2
| 2
| 2015/6/12 17:45
|-
|[[Os02g0170300|'''''OsMADS29''''']]
|[[Os02g0170300]]
| 6.166
| 12582
| 0.49
| 3
| 4
| 2015/5/14 13:23
|-
|[[Os03g0224700|'''''Hsfs''''']]
|[[Os03g0224700]]
| 6.166
| 11925
| 0.517
| 4
| 4
| 2015/6/12 13:35
|-
|[[Os07g0558500|'''''THF1''''']]
|[[Os07g0558500]]
| 6.078
| 12744
| 0.477
| 5
| 9
| 2015/6/12 16:45
|-
|[[Os09g0511000|'''''OsCERK1''''']]
|[[Os09g0511000]]
| 6.076
| 12097
| 0.502
| 2
| 2
| 2015/6/12 22:35
|-
|'''''[[OsWRKY13]]'''''
|
| 6.069
| 6101
| 0.995
| 2
| 3
| 2014/6/4 20:18
|-
|[[Os06g0308100|'''''OsIBR5''''']]
|[[Os06g0308100]]
| 6.062
| 12455
| 0.487
| 2
| 2
| 2015/6/12 16:13
|-
|[[Os11g0113700|'''''OsCIPK15''''']]
|[[Os11g0113700]]
| 5.961
| 12261
| 0.486
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os02g0656600|'''''GPA3''''']]
|[[Os02g0656600]]
| 5.915
| 10022
| 0.59
| 2
| 2
| 2015/5/14 13:50
|-
|[[Os01g0733200|'''''OsHsfC1b''''']]
|[[Os01g0733200]]
| 5.889
| 5889
| 1
| 1
| 1
| 2014/5/31 11:56
|-
|[[Os01g0785400|'''''GH3''''']]
|[[Os01g0785400]]
| 5.864
| 10600
| 0.553
| 2
| 2
| 2015/5/13 15:34
|-
|[[Os04g0541700|'''''Oshox22''''']]
|[[Os04g0541700]]
| 5.857
| 6037
| 0.97
| 2
| 3
| 2014/6/8 16:10
|-
|[[Os08g0140500|'''''TDC-3''''']]
|[[Os08g0140500]]
| 5.829
| 11343
| 0.514
| 2
| 2
| 2015/6/12 17:26
|-
|'''''[[IPK1]]'''''
|
| 5.803
| 5803
| 1
| 1
| 1
| 2014/6/8 16:55
|-
|[[Os09g0522100|'''''CBF''''']]
|[[Os09g0522100]]
| 5.713
| 9270
| 0.616
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os01g0177900|'''''OsABCG31''''']]
|[[Os01g0177900]]
| 5.693
| 11327
| 0.503
| 2
| 2
| 2015/5/13 14:58
|-
|[[Os02g0149800|'''''OsPP18''''']]
|[[Os02g0149800]]
| 5.681
| 11452
| 0.496
| 2
| 2
| 2015/5/14 13:22
|-
|[[Os01g0831000|'''''LAX''''']]
|[[Os01g0831000]]
| 5.68
| 9517
| 0.597
| 2
| 2
| 2015/5/13 15:37
|-
|[[Os05g0580500|'''''OsRAD21-4''''']]
|[[Os05g0580500]]
| 5.66
| 5660
| 1
| 1
| 1
| 2014/5/23 11:03
|-
|'''''[[OsCERK1]]'''''
|
| 5.61
| 5610
| 1
| 1
| 1
| 2014/6/1 18:31
|-
|[[Os11g0116200|'''''LTPs''''']]
|[[Os11g0116200]]
| 5.602
| 7206
| 0.777
| 3
| 3
| 2015/6/13 17:00
|-
|[[Os09g0567800|'''''Lipase''''']]
|[[Os09g0567800]]
| 5.558
| 5558
| 1
| 1
| 1
| 2014/6/6 16:24
|-
|[[Os06g0610350|'''''OsMOC1''''']]
|[[Os06g0610350]]
| 5.547
| 5547
| 1
| 1
| 1
| 2016/6/12 13:57
|-
|[[Os02g0657000|'''''ARAG1''''']]
|[[Os02g0657000]]
| 5.536
| 9210
| 0.601
| 2
| 2
| 2015/5/14 13:51
|-
|'''''[[Wbph8]]'''''
|
| 5.531
| 5531
| 1
| 1
| 1
| 2014/6/10 18:50
|-
|[[Os07g0563300|'''''GD1''''']]
|[[Os07g0563300]]
| 5.487
| 11105
| 0.494
| 2
| 2
| 2015/6/12 16:45
|-
|[[Os06g0701700|'''''OsHKT2;1''''']]
|[[Os06g0701700]]
| 5.432
| 8295
| 0.655
| 2
| 2
| 2015/6/12 16:26
|-
|[[Os10g0419200|'''''RID1''''']]
|[[Os10g0419200]]
| 5.432
| 9118
| 0.596
| 3
| 3
| 2015/6/13 16:44
|-
|'''''[[OsCEBiP]]'''''
|
| 5.419
| 5419
| 1
| 1
| 1
| 2014/6/8 12:32
|-
|'''''[[Xa10]]'''''
|
| 5.416
| 5416
| 1
| 1
| 1
| 2014/6/1 16:52
|-
|[[Os03g0272300|'''''OsSDIR1''''']]
|[[Os03g0272300]]
| 5.41
| 9862
| 0.549
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os10g0528300|'''''GSTs''''']]
|[[Os10g0528300]]
| 5.364
| 9566
| 0.561
| 3
| 3
| 2015/6/13 16:46
|-
|'''''[[Badh2]]'''''
|
| 5.363
| 5363
| 1
| 1
| 1
| 2014/6/8 19:38
|-
|[[Os03g0233900|'''''Hbs''''']]
|[[Os03g0233900]]
| 5.348
| 9011
| 0.593
| 2
| 2
| 2015/6/12 13:38
|-
|'''''[[Xa21]]'''''
|
| 5.345
| 5345
| 1
| 1
| 1
| 2014/6/1 13:37
|-
|'''''[[Bls1]]'''''
|
| 5.308
| 5308
| 1
| 1
| 1
| 2014/5/24 15:17
|-
|[[Os06g0157700|'''''Hd3''''']]
|[[Os06g0157700]]
| 5.304
| 10277
| 0.516
| 2
| 2
| 2015/6/12 16:06
|-
|[[Os02g0260200|'''''LP''''']]
|[[Os02g0260200]]
| 5.302
| 7745
| 0.685
| 2
| 2
| 2015/5/14 13:37
|-
|[[Os03g0232600|'''''TUD1''''']]
|[[Os03g0232600]]
| 5.249
| 10595
| 0.495
| 2
| 2
| 2015/6/12 13:37
|-
|[[Os03g0125100|'''''OsHYD3''''']]
|[[Os03g0125100]]
| 5.183
| 10331
| 0.502
| 2
| 2
| 2015/6/12 13:01
|-
|[[Os06g0212900|'''''ORF3''''']]
|[[Os06g0212900]]
| 5.175
| 6651
| 0.778
| 3
| 3
| 2015/6/12 16:09
|-
|[[Os02g0491300|'''''MTR1''''']]
|[[Os02g0491300]]
| 5.166
| 10047
| 0.514
| 2
| 2
| 2015/5/14 13:40
|-
|[[Os09g0470500|'''''Oshox4''''']]
|[[Os09g0470500]]
| 5.144
| 9661
| 0.532
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os09g0439800|'''''DRO1''''']]
|[[Os09g0439800]]
| 5.122
| 8022
| 0.638
| 3
| 4
| 2015/6/12 17:43
|-
|[[Os12g0555500|'''''PBZ1''''']]
|[[Os12g0555500]]
| 5.108
| 8929
| 0.572
| 3
| 3
| 2015/6/13 17:17
|-
|[[Os11g0508600|'''''Os-11N3''''']]
|[[Os11g0508600]]
| 5.066
| 7754
| 0.653
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os08g0174500|'''''OsDTH8''''']]
|[[Os08g0174500]]
| 5.017
| 9397
| 0.534
| 3
| 3
| 2015/6/12 17:28
|-
|[[Os03g0267200|'''''sHSP17.7''''']]
|[[Os03g0267200]]
| 5.008
| 7991
| 0.627
| 2
| 2
| 2015/6/12 13:39
|-
|[[Os06g0622700|'''''OsbZIP50 ''''']]
|[[Os06g0622700]]
| 5
| 9868
| 0.507
| 2
| 2
| 2015/6/12 16:19
|-
|'''''[[SBP]]'''''
|
| 4.997
| 4997
| 1
| 1
| 1
| 2013/7/21 18:43
|-
|[[Os05g0465800|'''''PI3K''''']]
|[[Os05g0465800]]
| 4.939
| 4939
| 1
| 1
| 1
| 2014/6/6 16:19
|-
|[[Os10g0491000|'''''BSP''''']]
|[[Os10g0491000]]
| 4.912
| 8991
| 0.546
| 3
| 3
| 2015/6/13 16:47
|-
|[[Os01g0206700|'''''OsCIPK05''''']]
|[[Os01g0206700]]
| 4.909
| 9664
| 0.508
| 2
| 2
| 2015/5/13 15:05
|-
|[[Os06g0643300|'''''RISBZ1''''']]
|[[Os06g0643300]]
| 4.869
| 7953
| 0.612
| 2
| 2
| 2015/6/12 16:20
|-
|[[Os03g0180800|'''''OsTIFY11a''''']]
|[[Os03g0180800]]
| 4.859
| 8158
| 0.596
| 2
| 2
| 2015/6/12 13:04
|-
|'''''[[BPH_gene]]'''''
|
| 4.857
| 4857
| 1
| 2
| 2
| 2014/6/11 11:14
|-
|[[Os01g0805600|'''''CycB1''''']]
|[[Os01g0805600]]
| 4.842
| 4842
| 1
| 1
| 1
| 2014/6/5 18:11
|-
|[[Os06g0701600|'''''HKT''''']]
|[[Os06g0701600]]
| 4.831
| 7482
| 0.646
| 2
| 2
| 2015/6/12 16:25
|-
|[[Os08g0531600|'''''OsSPL16''''']]
|[[Os08g0531600]]
| 4.818
| 4825
| 0.999
| 2
| 2
| 2014/5/27 23:11
|-
|[[Os06g0254700|'''''OsCLO-6''''']]
|[[Os06g0254700]]
| 4.802
| 7514
| 0.639
| 2
| 2
| 2015/6/12 16:12
|-
|[[Os01g0615100|'''''OCPI2''''']]
|[[Os01g0615100]]
| 4.794
| 7379
| 0.65
| 2
| 2
| 2015/5/13 15:19
|-
|'''''[[HSF]]'''''
|
| 4.772
| 4781
| 0.998
| 2
| 2
| 2013/7/21 20:57
|-
|[[Os06g0125800|'''''OsBBI1''''']]
|[[Os06g0125800]]
| 4.629
| 9410
| 0.492
| 2
| 2
| 2015/6/12 16:02
|-
|[[Os07g0628500|'''''OsbHLH1''''']]
|[[Os07g0628500]]
| 4.606
| 8573
| 0.537
| 2
| 2
| 2015/6/12 16:48
|-
|[[Os07g0694700|'''''APX''''']]
|[[Os07g0694700]]
| 4.569
| 8480
| 0.539
| 2
| 2
| 2015/6/12 16:50
|-
|[[Os01g0293100|'''''TIP2''''']]
|[[Os01g0293100]]
| 4.568
| 8480
| 0.539
| 2
| 2
| 2015/5/13 15:12
|-
|'''''[[Rl14]]'''''
|
| 4.564
| 4764
| 0.958
| 2
| 2
| 2014/6/10 11:19
|-
|'''''[[OsRPA2]]'''''
|
| 4.552
| 4552
| 1
| 1
| 1
| 2014/6/6 9:13
|-
|[[Os06g0604000|'''''OsWR2''''']]
|[[Os06g0604000]]
| 4.53
| 8229
| 0.55
| 2
| 2
| 2015/6/12 16:18
|-
|[[Os01g0192000|'''''OsDOS''''']]
|[[Os01g0192000]]
| 4.527
| 4527
| 1
| 1
| 1
| 2015/7/30 23:13
|-
|[[Os01g0922800|'''''OsMADS51''''']]
|[[Os01g0922800]]
| 4.506
| 4506
| 1
| 1
| 1
| 2014/5/24 18:45
|-
|[[Os02g0787300|'''''OsRac1''''']]
|[[Os02g0787300]]
| 4.483
| 6886
| 0.651
| 2
| 2
| 2015/5/14 14:01
|-
|[[Os09g0439200|'''''OsJAZ8''''']]
|[[Os09g0439200]]
| 4.477
| 8745
| 0.512
| 2
| 2
| 2015/6/12 17:42
|-
|[[Os01g0822900|'''''Dwarf1''''']]
|[[Os01g0822900]]
| 4.447
| 7550
| 0.589
| 3
| 4
| 2015/5/13 15:36
|-
|[[Os08g0167500|'''''CRR6''''']]
|[[Os08g0167500]]
| 4.432
| 8906
| 0.498
| 2
| 2
| 2015/6/12 17:27
|-
|'''''[[Sucrose_synthase]]'''''
|
| 4.428
| 4436
| 0.998
| 2
| 2
| 2013/7/18 11:20
|-
|'''''[[CL971152]]'''''
|
| 4.417
| 4472
| 0.988
| 2
| 2
| 2014/6/10 21:51
|-
|[[Os12g0603700|'''''OsCIPK04''''']]
|[[Os12g0603700]]
| 4.375
| 9322
| 0.469
| 3
| 3
| 2015/6/13 17:18
|-
|[[Os02g0618400|'''''OsMPS''''']]
|[[Os02g0618400]]
| 4.347
| 8707
| 0.499
| 2
| 2
| 2015/5/14 13:45
|-
|[[Os03g0182800|'''''OsDERF1''''']]
|[[Os03g0182800]]
| 4.322
| 6519
| 0.663
| 2
| 2
| 2015/6/12 13:05
|-
|'''''[[ARF]]'''''
|
| 4.308
| 4308
| 1
| 1
| 1
| 2013/7/21 20:46
|-
|[[Os03g0183000|'''''OsRAF''''']]
|[[Os03g0183000]]
| 4.286
| 4286
| 1
| 1
| 1
| 2014/6/9 20:10
|-
|[[Os02g0654700|'''''AP59''''']]
|[[Os02g0654700]]
| 4.285
| 8306
| 0.516
| 2
| 2
| 2015/5/14 13:49
|-
|[[Os09g0466400|'''''OsZHD1''''']]
|[[Os09g0466400]]
| 4.265
| 8095
| 0.527
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os03g0103300|'''''qLTG3''''']]
|[[Os03g0103300]]
| 4.188
| 7457
| 0.562
| 2
| 2
| 2015/6/12 12:56
|-
|[[Os01g0834400|'''''OsHAP3A''''']]
|[[Os01g0834400]]
| 4.109
| 4109
| 1
| 1
| 1
| 2014/5/31 19:19
|-
|[[Os07g0512200|'''''OsAtg8''''']]
|[[Os07g0512200]]
| 4.095
| 7690
| 0.533
| 4
| 4
| 2015/6/12 16:43
|-
|'''''[[Bph9]]'''''
|
| 4.084
| 4084
| 1
| 1
| 1
| 2014/6/9 12:23
|-
|[[Os06g0181700|'''''OsWR1''''']]
|[[Os06g0181700]]
| 4.083
| 7433
| 0.549
| 2
| 2
| 2015/6/12 16:07
|-
|[[Os06g0157500|'''''RFT1''''']]
|[[Os06g0157500]]
| 4.013
| 7888
| 0.509
| 3
| 3
| 2015/6/12 16:06
|-
|[[Os09g0537700|'''''OsRNS4''''']]
|[[Os09g0537700]]
| 3.992
| 6731
| 0.593
| 2
| 2
| 2015/6/12 22:36
|-
|[[Os02g0610500|'''''OsCOL4''''']]
|[[Os02g0610500]]
| 3.946
| 3946
| 1
| 1
| 1
| 2014/5/20 11:57
|-
|[[Os07g0529600|'''''OsDR8''''']]
|[[Os07g0529600]]
| 3.915
| 6908
| 0.567
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os09g0106700|'''''AKT1''''']]
|[[Os09g0106700]]
| 3.845
| 6498
| 0.592
| 2
| 2
| 2015/6/12 17:37
|-
|[[Os07g0568700|'''''OsFOR1''''']]
|[[Os07g0568700]]
| 3.845
| 6600
| 0.583
| 2
| 2
| 2015/6/12 16:46
|-
|[[Os12g0123700|'''''NAC''''']]
|[[Os12g0123700]]
| 3.826
| 6076
| 0.63
| 4
| 4
| 2015/6/13 17:16
|-
|'''''[[Pik-p]]'''''
|
| 3.816
| 3816
| 1
| 1
| 1
| 2014/6/6 10:16
|-
|[[Os06g0493100|'''''Bphi008a''''']]
|[[Os06g0493100]]
| 3.804
| 7241
| 0.525
| 2
| 2
| 2015/6/12 16:14
|-
|[[Os02g0552700|'''''OsZFP6''''']]
|[[Os02g0552700]]
| 3.779
| 6604
| 0.572
| 2
| 2
| 2015/5/14 13:43
|-
|[[Os12g0100500|'''''COG2267''''']]
|[[Os12g0100500]]
| 3.729
| 5669
| 0.658
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os07g0129200|'''''OsPR1''''']]
|[[Os07g0129200]]
| 3.716
| 6629
| 0.561
| 2
| 2
| 2015/6/12 16:32
|-
|[[Os10g0558900|'''''RL14''''']]
|[[Os10g0558900]]
| 3.699
| 7398
| 0.5
| 5
| 9
| 2015/6/13 16:57
|-
|[[Os01g0177400|'''''ACO1''''']]
|[[Os01g0177400]]
| 3.693
| 6293
| 0.587
| 3
| 3
| 2015/5/13 14:57
|-
|[[Os09g0380200|'''''YLC1''''']]
|[[Os09g0380200]]
| 3.69
| 6890
| 0.536
| 3
| 3
| 2015/6/12 17:40
|-
|[[Os08g0163400|'''''OsSIG1''''']]
|[[Os08g0163400]]
| 3.662
| 3662
| 1
| 1
| 1
| 2014/6/9 20:52
|-
|[[Os06g0665800|'''''OsHMA9''''']]
|[[Os06g0665800]]
| 3.593
| 3593
| 1
| 1
| 1
| 2014/6/2 15:50
|-
|[[Os01g0112400|'''''OsTIP4''''']]
|[[Os01g0112400]]
| 3.44
| 6824
| 0.504
| 2
| 2
| 2015/5/13 14:07
|-
|[[Os09g0396900|'''''OsVIT2''''']]
|[[Os09g0396900]]
| 3.437
| 6527
| 0.527
| 2
| 2
| 2015/6/12 17:41
|-
|[[Os03g0786400|'''''OsCKX2''''']]
|[[Os03g0786400]]
| 3.372
| 3372
| 1
| 1
| 1
| 2014/5/20 0:08
|-
|'''''[[Bhp-3]]'''''
|
| 3.33
| 3330
| 1
| 1
| 1
| 2014/5/31 23:33
|-
|[[Os07g0641200|'''''OsCCaMK''''']]
|[[Os07g0641200]]
| 3.212
| 6389
| 0.503
| 2
| 2
| 2015/6/12 16:49
|-
|[[Os07g0549600|'''''UDT1''''']]
|[[Os07g0549600]]
| 3.204
| 5875
| 0.545
| 2
| 2
| 2015/6/12 16:44
|-
|[[Os11g0582500|'''''OsC6''''']]
|[[Os11g0582500]]
| 3.13
| 5666
| 0.552
| 3
| 3
| 2015/6/13 17:09
|-
|[[Os03g0135700|'''''RAI1''''']]
|[[Os03g0135700]]
| 3.126
| 3126
| 1
| 1
| 1
| 2014/6/7 0:43
|-
|[[Os09g0459200|'''''SG1''''']]
|[[Os09g0459200]]
| 3.094
| 5090
| 0.608
| 2
| 2
| 2015/6/12 17:46
|-
|[[Os11g0523700|'''''OsICE1''''']]
|[[Os11g0523700]]
| 3.071
| 3079
| 0.997
| 2
| 2
| 2014/6/3 13:41
|-
|[[Os09g0522200|'''''OsDREB1A''''']]
|[[Os09g0522200]]
| 3.031
| 5920
| 0.512
| 3
| 3
| 2015/6/12 22:36
|-
|[[Os06g0127100|'''''OsDREB1C''''']]
|[[Os06g0127100]]
| 3.015
| 5846
| 0.516
| 3
| 3
| 2015/6/12 16:02
|-
|[[Os10g0573400|'''''OsPYL10''''']]
|[[Os10g0573400]]
| 3.009
| 6148
| 0.489
| 4
| 4
| 2015/6/13 16:58
|-
|[[Os01g0274800|'''''CSA''''']]
|[[Os01g0274800]]
| 2.805
| 2805
| 1
| 1
| 1
| 2014/5/28 21:34
|-
|[[BGIOSGA033504|'''''csld4''''']]
|[[BGIOSGA033504]]
| 2.803
| 2818
| 0.995
| 2
| 2
| 2014/6/3 16:43
|-
|[[Os11g0454000|'''''rab16c''''']]
|[[Os11g0454000]]
| 2.786
| 5342
| 0.522
| 3
| 3
| 2015/6/13 17:07
|-
|[[Os10g0148000|'''''OsDIL''''']]
|[[Os10g0148000]]
| 2.697
| 5106
| 0.528
| 3
| 3
| 2015/6/13 16:44
|-
|[[Os08g0566600|'''''PGR5''''']]
|[[Os08g0566600]]
| 2.632
| 4314
| 0.61
| 2
| 2
| 2015/6/12 17:35
|-
|[[Os03g0150200|'''''OsAP23''''']]
|[[Os03g0150200]]
| 2.621
| 5115
| 0.512
| 2
| 2
| 2015/6/12 13:03
|-
|[[Os05g0341600|'''''RAB21''''']]
|[[Os05g0341600]]
| 2.592
| 2640
| 0.982
| 2
| 3
| 2014/6/1 17:02
|-
|[[Os07g0191600|'''''STR2''''']]
|[[Os07g0191600]]
| 2.541
| 2541
| 1
| 1
| 1
| 2014/6/11 19:08
|-
|[[Os11g0208900|'''''xa5''''']]
|[[Os11g0208900]]
| 2.152
| 2152
| 1
| 1
| 1
| 2014/6/8 17:23
|-
|[[Os07g0492000|'''''OsNDPK1''''']]
|[[Os07g0492000]]
| 1.777
| 1777
| 1
| 1
| 1
| 2014/6/9 23:45
|-
|[[Os03g0741100|'''''OsbHLH148''''']]
|[[Os03g0741100]]
| 1.578
| 1578
| 1
| 1
| 1
| 2014/5/19 3:18
|}

Os12g0189500

2017-03-08T06:01:40Z

Xysj1981:

The rice '''''Os12g0189500''''' was reported as ''''' OsYUC11''''' in 2012 <ref name="ref1" /> by researchers from Australia.

==Annotated Information==
===Gene Symbol===
*'''''Os04g0459000''''' '''''<=>''''' '''''OsYUCCA11, OsYUC11'''''

===Function===
* IAA production in developing rice grains is controlled via expression of OsTAR1, OsYUC9, '''''OsYUC11''''' and that IAA may be important during starch deposition in addition to its previously suggested role early in grain development.

===Expression===
* '''''OsYUC11''''' was expressed in endosperm, the expression of '''''OsYUC11''''' appeared to be confined to endosperm tissue

===Evolution===
* Phylogenetic analysis indicated that OsYUC11 and AtYUC10 belong to a separate clade of YUCCAs, which do not have orthologues outside the Angiosperms. This clade may have evolved with a specific role in endosperm.

==Labs working on this gene==
*Department of applied biological science, Al-Ghad International AppliedMedical Science University, Jeddah, Saudi Arabia

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 12]]
[[Category:Chromosome 12]]
==Structured Information==

Test

2017-03-08T05:44:42Z

Xysj1981:

{|class="wikitable" \style="width:90%;text-align:center
|-
!Number
!Gene name
!RAP ID
!DOI
!Reference TitleLDMAR
!Keywords
|-
|1
|''GA2ox3''
|[[Os01g0757200]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|2
|''GA2ox9''
|[[Os02g0630300]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|3
|''GA2ox6''
|[[Os04g0522500]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|4
|''SG1''
|[[Os09g0459200]]
|10.1104/pp.111.187567
|
*Annotated
|-
|5
|''ALS''
|[[Os02g0510200]]
|10.1007/s00299-010-0915-8
|
*Selecting genetic transformants of indica and indica-derived rice cultivars using bispyribac sodium and a mutated ALS gene
|-
|6
|''EL5''
|[[Os02g0559800]]
|10.1111/j.1365-313X.2007.03120.x
|
*SHORT GRAIN1 Decreases Organ Elongation and Brassinosteroid Response in Rice1[W][OA]
|-
|7
|''OASA2''
|[[Os03g0264400]]
|10.1104/pp.111.175778
|
*Application of Gene Targeting to Designed Mutation Breeding of High-Tryptophan Rice1[W][OA]
|-
|8
|''OsGAD2''
|[[Os04g0447800]]
|10.1093/jxb/erm120
|
*C-terminal extension of rice glutamate decarboxylase(OsGAD2) functions as an autoinhibitory domain and overexpression of a truncated mutant results in the accumulation of extremely high levels of GABA in plant cells
|-
|9
|''OsIAA3''
|[[Os12g0601400]]
|10.1111/j.1365-313X.2006.02693.x
|
*Production and characterization of auxin-insensitive rice by overexpression of a mutagenized rice IAA protein
|-
|10
|''IDEF1''
|[[Os08g0101000]]
|10.1111/j.1365-313X.2011.04772.x
|
*Annotated
|-
|11
|''OsPLDα1''
|[[Os01g0172400]]
|10.1111/j.1744-7909.2010.01021.x
|
*Annotated
|-
|12
|''AFT''
|[[Os01g0185300]]
|10.1007/s00425-009-1077-1
|
*Down-regulation of four putative arabinoxylan feruloyl transferase genes from family PF02458 reduces ester-linked ferulate content in rice cell walls
|-
|13
|''OsGAE1''
|[[Os01g0201600]]
|10.1007/s11103-006-9030-1
|
*The rice OsGAE1 is a novel gibberellin-regulated gene and involved in rice growth
|-
|14
|''OsMADS3''
|[[Os01g0201700]]
|10.1023/A:1006051911291
|
*Annotated
|-
|15
|''OsSAMS3''
|[[Os01g0293000]]
|10.1016/j.jplph.2011.05.020
|
*Knockdown of SAMS genes encoding S-adenosyl-l-methionine synthetases causes methylation alterations of DNAs and histones and leads to late flowering in rice
|-
|16
|''OsSAMS2''
|[[Os01g0323600]]
|10.1016/j.jplph.2011.05.020
|
*Knockdown of SAMS genes encoding S-adenosyl-l-methionine synthetases causes methylation alterations of DNAs and histones and leads to late flowering in rice
|-
|17
|''OsACO7''
|[[Os01g0580500]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|18
|''OsrbohA''
|[[Os01g0734466]]
|10.5511/plantbiotechnology.22.127
|
*Function of the rice gp91phox homologs OsrbohA and OsrbohE genes in ROS-dependent plant immune responses
|-
|19
|''Orysa;CycB1;1''
|[[Os01g0805600]]
|10.1007/s00425-009-1051-y
|
*Annotated
|-
|20
|''OsNAC4''
|[[Os01g0816100]]
|10.1038/emboj.2009.39
|
*The transcription factor OsNAC4 is a key positive regulator of plant hypersensitive cell death
|-
|21
|''OsHAP3A''
|[[Os01g0834400]]
|10.1046/j.1365-313X.2003.01897.x
|
*Annotated
|-
|22
|''HDT702''
|[[Os01g0909100]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|23
|''OsDCL1''
|[[Os01g0909200]]
|10.1104/pp.105.063420
|
*Loss of Function of OsDCL1 Affects MicroRNA Accumulation and Causes Developmental Defects in Rice
|-
|24
|''SDG714''
|[[Os01g0927000]]
|10.1105/tpc.106.048124
|
*SDG714, a Histone H3K9 Methyltransferase, Is Involved in Tos17 DNA Methylation and Transposition in Rice
|-
|25
|''rtS''
|[[Os01g0929600]]
|10.1007/s11103-006-9031-0
|
*Annotated
|-
|26
|''Osg1''
|[[Os01g0947700]]
|10.1007/s00425-010-1301-z
|
*A rice �-1,3-glucanase gene Osg1 is required for callose degradation in pollen development
|-
|27
|''NOA1''
|[[Os02g0104700]]
|10.1371/journal.pone.0020015
|
*Annotated
|-
|28
|''OsNOA1?RIF1''
|[[Os02g0104700]]
|10.1111/j.1469-8137.2010.03264.x
|
*Annotated
|-
|29
|''Os4CL3''
|[[Os02g0177600]]
|10.1104/pp.111.178301
|
*Functional Characterization of Evolutionarily Divergent 4-Coumarate:Coenzyme A Ligases in Rice
|-
|30
|''HDA703''
|[[Os02g0214900]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|31
|''HDA710''
|[[Os02g0215200]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|32
|''RPBF''
|[[Os02g0252400]]
|10.1111/j.1365-313X.2009.03925.x
|
*Compensation and interaction between RISBZ1 and RPBF during grain filling in rice
|-
|33
|''DCW11''
|[[Os02g0255100]]
|10.1093/pcp/pcn036
|
*DCW11, Down-Regulated Gene 11 in CW-Type Cytoplasmic Male Sterile Rice,Encoding Mitochondrial Protein Phosphatase 2C is Related to Cytoplasmic Male Sterility
|-
|34
|''OsHARP''
|[[Os02g0256200]]
|10.1007/s00726-008-0043-8
|
*Characterization of a histidine- and alanine-rich protein showing interaction with calreticulin in rice
|-
|35
|''OsGMST1''
|[[Os02g0274900]]
|10.1093/jxb/err178
|
*Annotated
|-
|36
|''OsTudor-SN''
|[[Os02g0523500]]
|10.1111/j.1365-313X.2008.03516.x
|
*The cytoplasmic-localized, cytoskeletal-associated RNA binding protein OsTudor-SN: evidence for an essential role in storage protein RNA transport and localization
|-
|37
|''RAR1''
|[[Os02g0535400]]
|10.1105/tpc.107.055517
|
*Annotated
|-
|38
|''GF14e''
|[[Os02g0580300]]
|10.1111/j.1365-313X.2011.04728.x
|
*Annotated
|-
|39
|''OsNAR2.1''
|[[Os02g0595900]]
|10.1111/j.1365-3040.2011.02335.x
|
*Rice OsNAR2.1 interacts with OsNRT2.1, OsNRT2.2 and OsNRT2.3a nitrate transporters to provide uptake over high and low concentration ranges
|-
|40
|''OsCKI1''
|[[Os02g0622100]]
|10.1046/j.1365-313X.2003.01866.x
|
*Annotated
|-
|41
|''Oscry2''
|[[Os02g0625000]]
|10.1093/pcp/pcj064
|
*Involvement of Rice Cryptochromes in De-etiolation Responses and Flowering
|-
|42
|''OsYSL15''
|[[Os02g0650300]]
|10.1074/jbc.M806042200
|
*Annotated
|-
|43
|''SGL1''
|[[Os02g0762600]]
|10.1104/pp.111.187567
|
*SHORT GRAIN1 Decreases Organ Elongation and Brassinosteroid Response in Rice
|-
|44
|''CEBiP''
|[[Os03g0133400]]
|10.1111/j.1365-313X.2010.04328.x
|
*Perception of the chitin oligosaccharides contributes to disease resistance to blast fungus Magnaporthe oryzae in rice
|-
|45
|''OsPAO''
|[[Os03g0146400]]
|10.1016/j.jplph.2011.05.026
|
*Knockdown of OsPAO and OsRCCR1 cause different plant death phenotypes in rice
|-
|46
|''OsPT2''
|[[Os03g0150800]]
|10.1111/j.1365-313X.2008.03726.x
|
*Two rice phosphate transporters, OsPht1;2 and OsPht1;6, have different functions and kinetic properties in uptake and translocation
|-
|47
|''OsSUT1''
|[[Os03g0170900]]
|10.1093/pcp/pce148
|
*Annotated
|-
|48
|''OsBP-73''
|[[Os03g0183100]]
|10.1023/A:1024854101965
|
*OsBP-73, a rice gene, encodes a novel DNA-binding protein with a SAP-like domain and its genetic interference by double-stranded RNA inhibits rice growth
|-
|49
|''OsMDP1''
|[[Os03g0186600]]
|10.1111/j.1365-313X.2006.02804.x
|
*A brassinolide-suppressed rice MADS-box transcription factor, OsMDP1, has a negative regulatory role in BR signaling
|-
|50
|''RINO1''
|[[Os03g0192700]]
|10.1093/pcp/pcp071
|
*Differential Effects of a Transgene to Confer Low Phytic Acid in Caryopses Located at Different Positions in Rice Panicles
|-
|51
|''OsMADS1''
|[[Os03g0215400]]
|10.1111/j.1365-313X.2009.04101.x
|
*Annotated
|-
|53
|''OsApx1''
|[[Os03g0285700]]
|10.1016/j.phytochem.2010.01.003
|
*Annotated
|-
|54
|''APx1''
|[[Os03g0285700]]
|10.1111/j.1365-3040.2011.02366.x
|
*Annotated
|-
|55
|''OsFAD7''
|[[Os03g0290300]]
|10.1093/pcp/pcm107
|
*Disease Resistance against Magnaporthe grisea is Enhanced in Transgenic Rice with Suppression of u-3 Fatty Acid Desaturases
|-
|57
|''RGB1''
|[[Os03g0669100]]
|10.1111/j.1365-313X.2011.04643.x
|
*Suppression of the rice heterotrimeric G protein b-subunit gene, RGB1, causes dwarfism and browning of internodes and lamina joint regions
|-
|58
|''OsPIPK1''
|[[Os03g0701800]]
|10.1023/B:PLAN.0000028796.14336.24
|
*OsPIPK1, a rice phosphatidylinositol monophosphate kinase, regulates rice heading by modifying the expression of floral induction genes
|-
|59
|''ero1''
|[[Os03g0733800]]
|10.1073/pnas.0904429106
|
*ER membrane-localized oxidoreductase Ero1 is required for disulfide bond formation in the rice endosperm
|-
|60
|''OsSPO11-1''
|[[Os03g0752200]]
|10.1007/s00412-010-0284-7
|
*OsSPO11-1 is essential for both homologous chromosome pairing and crossover formation in rice
|-
|61
|''CysR10''
|[[Os03g0766000]]
|10.1093/pcp/pcr053
|
*A Role for the Cysteine-Rich 10 kDa Prolamin in Protein Body I Formation in Rice
|-
|62
|''OsGLO1''
|[[Os03g0786100]]
|10.1093/jxb/erp056
|
*Inducible antisense suppression of glycolate oxidase reveals its strong regulation over photosynthesis in rice
|-
|63
|''OsMet1''
|[[Os03g0798300]]
|10.1111/j.1365-313X.2008.03624.x
|
*Annotation
|-
|64
|''CYP99A3''
|[[Os04g0178400]]
|10.1111/j.1365-313X.2010.04408.x
|
*Annotation
|-
|65
|''CYP99A2''
|[[Os04g0180400]]
|10.1111/j.1365-313X.2010.04408.x
|
*CYP99A3: functional identification of a diterpene oxidase from the momilactone biosynthetic gene cluster in rice
|-
|66
|''Ostil1''
|[[Os04g0460600]]
|10.1111/j.1469-8137.2007.02177.x
|
*Overexpression of a NAC-domain protein promotes shoot Blackwell Publishing Ltd branching in rice
|-
|67
|''OsPBP1''
|[[Os04g0531100]]
|10.1093/mp/ssn035
|
*A Novel C2-Domain Phospholipid-Binding Protein, OsPBP1, Is Required for Pollen Fertility in Rice
|-
|68
|''YAB3''
|[[Os04g0536300]]
|10.1104/pp.107.095737
|
*Annotation
|-
|69
|''OsACS2''
|[[Os04g0578000]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|70
|''rca''
|[[Os04g0658300]]
|10.1093/aob/mcl025
|
*Annotation
|-
|71
|''OsRMC''
|[[Os04g0659300]]
|10.1111/j.1365-3040.2007.01663.x
|
*Annotation
|-
|72
|''OsMT2b''
|[[Os05g0111300]]
|10.1104/pp.107.110304
|
*Annotation
|-
|73
|''XB3''
|[[Os05g0112000]]
|10.1105/tpc.106.046730
|
*Annotation
|-
|74
|''STAR2''
|[[Os05g0119000]]
|10.1105/tpc.108.064543
|
*Annotation
|-
|75
|''OsSAMS1''
|[[Os05g0135700]]
|10.1016/j.jplph.2011.05.020
|
*Annotation
|-
|76
|''OsACO5''
|[[Os05g0149400]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|77
|''OsBLE3''
|[[Os05g0245300]]
|10.1016/j.phytochem.2006.05.026
|
*OsBLE3, a brassinolide-enhanced gene, is involved in the growth of rice
|-
|78
|''OsMADS4''
|[[Os05g0423400]]
|10.1023/A:1006051911291
|
*Identification of class B and class C floral organ identity genes from rice plants
|-
|79
|''IDEF2''
|[[Os05g0426200]]
|10.1074/jbc.M708732200
|
*A Novel NAC Transcription Factor, IDEF2, That Recognizes the Iron Deficiency-responsive Element 2 Regulates the Genes Involved in Iron Homeostasis in Plants
|-
|81
|''OsHAP3C''
|[[Os05g0573500]]
|10.1046/j.1365-313X.2003.01897.x
|
*Annotated
|-
|82
|''OsRAD21-4''
|[[Os05g0580500]]
|10.1007/s11103-005-4922-z
|
*Annotated
|-
|83
|''OsMAPK6''
|[[Os06g0154500]]
|10.1104/pp.104.057414
|
*A Sphingolipid Elicitor-Inducible Mitogen-Activated Protein Kinase Is Regulated by the Small GTPase OsRac1 and Heterotrimeric G-Protein in Rice
|-
|84
|''RFT1''
|[[Os06g0157500]]
|10.1242/dev.040170
|
*Annotated
|-
|85
|''OsMADS5''
|[[Os06g0162800]]
|10.1111/j.1365-313X.2009.04101.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|86
|''SSIIa''
|[[Os06g0229800]]
|10.1139/g11-010
|
*Annotated
|-
|87
|''OsGSR1''
|[[Os06g0266800]]
|10.1111/j.1365-313X.2008.03707.x
|
*OsGSR1 is involved in crosstalk between gibberellins and brassinosteroids in rice
|-
|89
|''HDA702''
|[[Os06g0583400]]
|10.1016/j.bbrc.2009.07.162
|
*Annotation
|-
|90
|''OsPNH1''
|[[Os06g0597400]]
|10.1046/j.1365-313X.2002.01279.x
|
*OsPNH1 regulates leaf development and maintenance of the shoot apical meristem in rice
|-
|91
|''OsPLDα4''
|[[Os06g0604200]]
|10.1104/pp.111.183749
|
*The Chloroplast-Localized Phospholipases D a4 and a5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice
|-
|92
|''OsPLDα5''
|[[Os06g0604300]]
|10.1104/pp.111.183749
|
*The Chloroplast-Localized Phospholipases D a4 and a5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice
|-
|93
|''OsLIC''
|[[Os06g0704300]]
|10.1371/journal.pone.0003521
|
*OsLIC, a Novel CCCH-Type Zinc Finger Protein with Transcription Activation, Mediates Rice Architecture via Brassinosteroids Signaling
|-
|94
|''OsEIN2''
|[[Os07g0155600]]
|10.1104/pp.109.152702
|
*Annotated
|-
|95
|''HDA704''
|[[Os07g0164100]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|96
|''RISBZ1''
|[[Os07g0182000]]
|10.1111/j.1365-313X.2009.03925.x
|
*Annotated
|-
|97
|''NDP kinase''
|[[Os07g0492000]]
|10.1104/pp.122.2.447
|
*Annotated
|-
|98
|''OsDR8''
|[[Os07g0529600]]
|10.1007/s11103-005-4770-x
|
*Annotated
|-
|99
|''OsFOR1''
|[[Os07g0568700]]
|10.1023/B:PLAN.0000006940.89955.f1
|
*Annotated
|-
|100
|''OsBZR1''
|[[Os07g0580500]]
|10.1073/pnas.0706386104
|
*Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice
|-
|101
|''Osppc4''
|[[Os01g0208700]]
|10.1073/pnas.0913127107
|
*Phosphoenolpyruvate carboxylase intrinsically located in the chloroplast of rice plays a crucial role in ammonium assimilation
|-
|102
|''OsPDK1''
|[[Os07g0637300]]
|10.1093/pcp/pci241
|
*Gibberellin Regulates Mitochondrial Pyruvate Dehydrogenase Activity in Rice
|-
|103
|''OsBLE2''
|[[Os07g0650600]]
|10.1023/A:1025001304994
|
*A novel brassinolide-enhanced gene identified by cDNA microarray is involved in the growth of rice
|-
|104
|''aldolase''
|[[Os07g0650600]]
|10.1007/s11103-004-5920-2
|
*Characterization of fructose-bisphosphate aldolase regulated by gibberellin in roots of rice seedling
|-
|105
|''rtGA2.1''
|[[Os07g0687700]]
|10.1111/j.1365-313X.2005.02457.x
|
*Alteration of TGA factor activity in rice results in enhanced tolerance to Xanthomonas oryzae pv. oryzae
|-
|106
|''OsFAD8''
|[[Os07g0693800]]
|10.1093/pcp/pcm107
|
*Annotated
|-
|107
|''OsApx2''
|[[Os07g0694700]]
|10.1016/j.phytochem.2010.01.003
|
*Annotated
|-
|108
|''APx2''
|[[Os07g0694700]]
|10.1111/j.1365-3040.2011.02366.x
|
*Annotated
|-
|109
|''OsDEG10''
|[[Os08g0139000]]
|10.1016/j.bbrc.2009.01.131
|
*Annotated
|-
|110
|''OsDR10''
|[[Os08g0155900]]
|10.1371/journal.pone.0004603
|
*A Rice Gene of De Novo Origin Negatively Regulates Pathogen-Induced Defense Response
|-
|111
|''OsBAK1''
|[[Os08g0174700]]
|10.1111/j.1467-7652.2009.00444.x
|
*Annotated
|-
|112
|''OsGLP8''
|[[Os08g0189200]]
|10.1104/pp.108.128348
|
*A Germin-Like Protein Gene Family Functions as a Complex Quantitative Trait Locus Conferring Broad-Spectrum Disease Resistance in Rice
|-
|113
|''SSIIIa''
|[[Os08g0191433]]
|10.1139/g11-010
|
*Double repression of soluble starch synthase genes SSIIa and SSIIIa in rice (Oryza sativa L.) uncovers interactive effects on the physicochemical properties of starch
|-
|114
|''OsRAD21-3''
|[[Os08g0266700]]
|10.1111/j.1365-313X.2007.03190.x
|
*OsRAD21-3, an orthologue of yeast RAD21, is required for pollen development in Oryza sativa
|-
|115
|''OsCCC1''
|[[Os08g0323700]]
|10.1007/s11103-011-9744-6
|
*Annotated
|-
|116
|''OsrbohE''
|[[Os08g0453733]]
|10.5511/plantbiotechnology.22.127
|
*Function of the rice gp91phox homologs OsrbohA and OsrbohE genes in ROS-dependent plant immune responses
|-
|117
|''OsHI-LOX''
|[[Os08g0508800]]
|10.1111/j.1365-313X.2009.03988.x
|
*Silencing OsHI-LOX makes rice more susceptible to chewing herbivores, but enhances resistance to a phloem feeder
|-
|118
|''OsAPx-R''
|[[Os08g0522400]]
|10.1111/j.1469-8137.2011.03659.x
|
*Ascorbate peroxidase-related (APx-R) is a new hemecontaining protein functionally associated with ascorbate peroxidase but evolutionarily divergent
|-
|119
|''OsMADS7''
|[[Os08g0531700]]
|10.1111/j.1365-313X.2009.04101.x
|
*Annotated
|-
|120
|''Os8N3''
|[[Os08g0535200]]
|10.1073/pnas.0604088103
|
*Annotated
|-
|121
|''OsCERK1''
|[[Os08g0538300]]
|10.1111/j.1365-313X.2010.04324.x
|
*Two LysM receptor molecules, CEBiP and OsCERK1,cooperatively regulate chitin elicitor signaling in rice
|-
|122
|''OsSPY''
|[[Os08g0559300]]
|10.1111/j.1365-313X.2006.02875.x
|
*Annotated
|-
|123
|''OsPT6''
|[[Os08g0564000]]
|10.1111/j.1365-313X.2008.03726.x
|
*Two rice phosphate transporters, OsPht1;2 and OsPht1;6, have different functions and kinetic properties in uptake and translocation
|-
|124
|''OsMADS8''
|[[Os09g0507200]]
|10.1111/j.1365-313X.2009.04101.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|125
|''OsSGT1''
|[[Os09g0518200]]
|10.1111/j.1365-313X.2008.03697.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|126
|''OsGEN-L''
|[[Os09g0521900]]
|10.1093/pcp/pci090
|
*RNAi-mediated Silencing of OsGEN-L (OsGEN-like), a New Member of the RAD2/XPG Nuclease Family, Causes Male Sterility by Defect of Microspore Development in Rice
|-
|128
|''Ugp1''
|[[Os09g0553200]]
|10.1105/tpc.106.044123
|
*Rice UDP-Glucose Pyrophosphorylase1 Is Essential for Pollen Callose Deposition and Its Cosuppression Results in a New Type of Thermosensitive Genic Male Sterility
|-
|129
|''OsRCCR1''
|[[Os10g0389200]]
|10.1016/j.jplph.2011.05.026
|
*Knockdown of OsPAO and OsRCCR1 cause different plant death phenotypes in rice
|-
|130
|''EBL1''
|[[Os10g0390800]]
|10.1007/s10529-010-0405-7
|
*Phytochrome-regulated EBL1 contributes to ACO1 upregulation in rice
|-
|131
|''OsDCL3b''
|[[Os10g0485600]]
|10.1111/j.1365-313X.2011.04805.x
|
*Roles of DCL4 and DCL3b in rice phased small RNA biogenesis
|-
|132
|''OsPLDbeta1''
|[[Os10g0524400]]
|10.1104/pp.108.131979
|
*Suppression of a Phospholipase D Gene, OsPLDb1,Activates Defense Responses and Increases Disease Resistance in Rice
|-
|134
|''SPK''
|[[Os10g0539600]]
|10.1093/pcp/pch122
|
*A Rice Antisense SPK Transformant that Lacks the Accumulation of Seed Storage Substances Shows no Correlation Between Sucrose Concentration in Phloem Sap and Demand for Carbon Sources in the Sink Organs
|-
|135
|''OsMPK5''
|[[Os11g0684000]]
|10.1104/pp.109.152702
|
*Abscisic Acid-Induced Resistance against the Brown Spot Pathogen Cochliobolus miyabeanus in Rice Involves MAP Kinase-Mediated Repression of Ethylene Signaling
|-
|136
|''OsDMC1''
|[[Os12g0143800]]
|10.1007/s11103-007-9195-2
|
*OsDMC1 is required for homologous pairing in Oryza sativa
|-
|137
|''Ostrxm''
|[[Os12g0188700]]
|10.1104/pp.108.123547
|
*Abnormal Chloroplast Development and Growth Inhibition in Rice Thioredoxin m Knock-Down Plants
|-
|139
|''OsRBCS2''
|[[Os12g0274700]]
|10.1111/j.1365-3040.2011.02434.x
|
*Effect of individual suppression of RBCS multigene family on Rubisco contents in rice leavespce_2434 546..553
|-
|143
|''OsTDL1A''
|[[Os12g0472500]]
|10.1111/j.1365-313X.2008.03426.x
|
*Annotated
|-
|144
|''OsSpo11-4''
|[[Os12g0622500]]
|10.1371/journal.pone.0020327
|
*Annotated
|-
|145
|''OsDOS''
|[[Os01g0192000]]
|10.1104/pp.106.082941
|
*Annotated
|-
|146
|''OsNPR1''
|[[Os01g0194300]]
|10.1007/s11103-010-9695-3
|
*Annotated
|-
|147
|''OsRac1''
|[[Os01g0229400]]
|10.1073/pnas.98.2.759
|
*Essential role of the small GTPase Rac in disease resistance of rice
|-
|148
|''Rdd1''
|[[Os01g0264000]]
|10.1111/j.1365-3040.2009.01954.x
|
*Circadian clock- and phytochrome-regulated Dof-like gene,Rdd1, is associated with grain size in rice
|-
|149
|''OsLOL2''
|[[Os01g0612700]]
|10.1007/s00438-007-0232-2
|
*The rice OsLOL2 gene encodes a zinc Wnger protein involved in rice growth and disease resistance
|-
|150
|''OsYUCCA1''
|[[Os01g0645400]]
|10.1104/pp.106.091561
|
*Auxin Biosynthesis by the YUCCA Genes in Rice
|-
|151
|''PME1''
|[[Os01g0788400]]
|10.1111/j.1365-313X.2011.04486.x
|
*Methanol is an endogenous elicitor molecule for the synthesis of tryptophan and tryptophan-derived secondary metabolites upon senescence of detached rice leaves
|-
|152
|''OsABI5''
|[[Os01g0859300]]
|10.1007/s11103-008-9298-4
|
*Annotated
|-
|153
|''OsNAC6''
|[[Os01g0884300]]
|10.1111/j.1365-313X.2009.03908.x
|
*Annotated
|-
|154
|''OsIRO2''
|[[Os01g0952800]]
|10.1111/j.1365-313X.2007.03149.x
|
*Annotated
|-
|155
|''BiP1''
|[[Os02g0115900]]
|10.1111/j.1365-313X.2010.04453.x
|
*Annotated
|-
|156
|''OsYSL2''
|[[Os02g0649900]]
|10.1111/j.1365-313X.2010.04158.x
|
*Annotated
|-
|157
|''ARAG1''
|[[Os02g0657000]]
|10.1093/aob/mcp303
|
*Annotated
|-
|158
|''OsPIP1;1''
|[[Os02g0666200]]
|10.1038/cr.2007.34
|
*Annotated
|-
|159
|''OsDHODH1''
|[[Os02g0736400]]
|10.1111/j.1744-7909.2009.00853.x
|
*Annotated
|-
|160
|''OsPIN1''
|[[Os02g0743400]]
|10.1093/pcp/pci183
|
*Annotated
|-
|161
|''OsMADS22''
|[[Os02g0761000]]
|10.1111/j.1365-313X.2008.03406.x
|
*Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses
|-
|162
|''AmyI-1''
|[[Os02g0765600]]
|10.1093/pcp/pci091
|
*Annotated
|-
|163
|''OsPIP1;3''
|[[Os02g0823100]]
|10.1038/cr.2007.34
|
*Annotated
|-
|164
|''OsACDR1''
|[[Os03g0160100]]
|10.1007/s10059-009-0161-5
|
*Annotated
|-
|165
|''OsBRR1''
|[[Os03g0228800]]
|10.1007/s00425-009-0951-1
|
*A putative leucine-rich repeat receptor kinase, OsBRR1, is involved in rice blast resistance
|-
|166
|''OsMAPK5''
|[[Os03g0285800]]
|10.1105/tpc.008714
|
*Annotation
|-
|167
|''OsWRKY31''
|[[Os03g0321700]]
|10.1038/cr.2007.104
|
*Constitutive expression of pathogen-inducible OsWRKY31 enhances disease resistance and affects root growth and auxin response in transgenic rice plants
|-
|168
|''OsDIS1''
|[[Os03g0356414]]
|10.1104/pp.111.180893
|
*The SINA E3 Ligase OsDIS1 Negatively Regulates Drought Response in Rice
|-
|169
|''OsLOX1''
|[[Os03g0700700]]
|10.1007/s11103-007-9278-0
|
*A novel lipoxygenase gene from developing rice seeds confers dual position specificity and responds to wounding and insect attack
|-
|170
|''OsSrt1''
|[[Os04g0271000]]
|10.1104/pp.107.099473
|
*Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1, Induces DNA Fragmentation and Cell Death in Rice
|-
|171
|''RERJ1''
|[[Os04g0301500]]
|10.1016/j.bbrc.2004.10.126
|
*Annotated
|-
|172
|''OsGA2ox6''
|[[Os04g0522500]]
|10.1016/S1673-8527(09)60022-9
|
*Annotated
|-
|173
|''RFL''
|[[Os04g0598300]]
|10.1073/pnas.0709059105
|
*Annotated
|-
|174
|''OsrcaA2''
|[[Os04g0658300]]
|10.1006/bbrc.2001.6269
|
*Annotated
|-
|175
|''OsMTP1''
|[[Os05g0128400]]
|10.1007/s00299-011-1140-9
|
*Annotated
|-
|176
|''OsWRKY45''
|[[Os05g0322900]]
|10.1093/jxb/err144
|
*Annotated
|-
|177
|''OsEXP4''
|[[Os05g0477600]]
|10.1105/tpc.011965
|
*Regulation of Expansin Gene Expression Affects Growth and Development in Transgenic Rice Plants
|-
|178
|''SDG728''
|[[Os05g0490700]]
|10.1093/mp/ssq030
|
*Rice SUVH Histone Methyltransferase Genes Display Specific Functions in Chromatin Modification and Retrotransposon Repression
|-
|179
|''OsRan2''
|[[Os05g0574500]]
|10.1093/jxb/erp341
|
*Annotation
|-
|180
|''OsMADS55''
|[[Os06g0217300]]
|10.1111/j.1365-313X.2008.03406.x
|
*Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses
|-
|181
|''OsCIPK23''
|[[Os07g0150700]]
|10.1016/S1673-8527(08)60073-9
|
*Annotated
|-
|182
|''OsTRXh1''
|[[Os07g0186000]]
|10.1104/pp.111.182808
|
*Annotated
|-
|183
|''TDC''
|[[Os08g0140300]]
|10.1104/pp.109.138552
|
*Annotated
|-
|184
|''OsLSD1''
|[[Os08g0159500]]
|10.1094/MPMI-18-0375
|
*Overexpression of OsRAN2 in rice and Arabidopsis renders transgenic plants hypersensitive to salinity and osmotic stress
|-
|185
|''OsDERF1''
|[[Os08g0454000]]
|10.1371/journal.pone.0025216
|
*Annotated
|-
|186
|''OsGLP1''
|[[Os08g0460000]]
|10.1016/j.bbrc.2010.02.142
|
*Functional role of rice germin-like protein1 in regulation of plant height and disease resistance
|-
|187
|''OsPRP3''
|[[Os10g0148100]]
|10.1007/s11103-009-9557-z
|
*OsPRP3, a flower specific proline-rich protein of rice, determines extracellular matrix structure of floral organs and its overexpression confers cold-tolerance
|-
|188
|''OsPT8''
|[[Os10g0444700]]
|10.1104/pp.111.175240
|
*The Phosphate Transporter Gene OsPht1;8 Is Involved in Phosphate Homeostasis in Rice
|-
|189
|''OsWRKY89''
|[[Os11g0117400]]
|10.1007/s11103-007-9244-x
|
*Annotated
|-
|190
|''OsNAC5''
|[[Os11g0184900]]
|10.1007/s00425-011-1403-2
|
*Annotated
|-
|191
|''OsPCBP''
|[[Os11g0689300]]
|10.1007/s12374-011-9184-5
|
*A Calmodulin-Binding Protein from Rice is Essential to Pollen Development
|-
|192
|''OsrcaA1''
|[[Os11g0707000]]
|10.1006/bbrc.2001.6269
|
*Involvement of a Ca21-Dependent Protein Kinase Component Downstream to the Gibberellin-Binding Phosphoprotein, RuBisCO Activase, in Rice
|-
|193
|''sui1''
|[[Os01g0118300]]
|10.1007/s11103-011-9825-6
|
*Identification and characterization of SHORTENED UPPERMOST INTERNODE 1, a gene negatively regulating uppermost internode elongation in rice
|-
|194
|''Osjag''
|[[Os01g0129200]]
|10.1007/s11103-010-9703-7
|
*Molecular cloning and functional characterization of OsJAG gene based on a complete-deletion mutant in rice (Oryza sativa L.)
|-
|195
|''sl1''
|[[Os01g0129200]]
|10.1111/j.1365-313X.2009.03913.x
|
*STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice
|-
|197
|''OsABCG31''
|[[Os01g0177900]]
|10.1073/pnas.1108444108
|
*Annotated
|-
|198
|''OsGI''
|[[Os01g0182600]]
|10.1105/tpc.111.083238
|
*Annotated
|-
|199
|''d2''
|[[Os01g0197100]]
|10.1105/tpc.014712
|
*Annotated
|-
|200
|''mads3''
|[[Os01g0201700]]
|10.1105/tpc.110.074369
|
*Annotated
|-
|201
|''OsGSK1''
|[[Os01g0205700]]
|10.1007/s11103-007-9213-4
|
*Annotated
|-
|202
|''nyc1''
|[[Os01g0227100]]
|10.1105/tpc.106.042911
|
*Annotated
|-
|203
|''OSH6''
|[[Os01g0302500]]
|10.1007/s00425-007-0576-1
|
*A Ds-insertion mutant of OSH6 (Oryza sativa Homeobox 6) exhibits outgrowth of vestigial leaf-like structures, bracts,in rice
|-
|204
|''phd1''
|[[Os01g0367100]]
|10.1371/journal.pgen.1002196
|
*Annotated
|-
|205
|''dbs1''
|[[Os01g0513900]]
|10.1093/pcp/pci206
|
*The Rice Mutant dwarf bamboo shoot 1: A Leaky Mutant of the NACK-type Kinesin-like Gene Can Initiate Organ Primordia but not Organ Development
|-
|206
|''shl2''
|[[Os01g0527600]]
|10.1073/pnas.0704339104
|
|Finishend
*Annotated
|-
|207
|''osubp6''
|[[Os01g0550100]]
|10.1007/s10059-009-0138-4
|
*Structure and Expression of OsUBP6, an Ubiquitin-Specific Protease 6 Homolog in Rice (Oryza sativa L.)
|-
|208
|''log''
|[[Os01g0588900]]
|10.1038/nature05504
|
*Direct control of shoot meristem activity by a cytokinin-activating enzyme
|-
|209
|''osagpl2''
|[[Os01g0633100]]
|10.1007/s11103-007-9153-z
|
*Annotated
|-
|210
|''snl6''
|[[Os01g0639200]]
|10.1371/journal.pgen.1001123
|
*Annotated
|-
|211
|''Ostpc1''
|[[Os01g0678500]]
|10.1093/pcp/pch082
|
*Annotated
|-
|212
|''nadh-gogat1''
|[[Os01g0682001]]
|10.1007/s00726-010-0531-5
|
*Reverse genetics approach to characterize a function of NADH-glutamate synthase1 in rice plants
|-
|213
|''dgl1''
|[[Os01g0683100]]
|10.1104/pp.105.062968
|
*Analysis of the Rice Mutant dwarf and gladius leaf 1. Aberrant Katanin-Mediated Microtubule Organization Causes Up-Regulation of Gibberellin Biosynthetic Genes Independently of Gibberellin Signaling
|-
|214
|''spl28*''
|[[Os01g0703600]]
|10.1111/j.1469-8137.2009.03047.x
|
*Annotated
|-
|215
|''OsLFL''
|[[Os01g0713600]]
|10.1016/j.jplph.2007.07.010
|
*Overexpression of transcription factor OsLFL1 delays flowering time in Oryza sativa
|-
|216
|''d61''
|[[Os01g0718300]]
|10.1105/tpc.12.9.1591
|
*Annotated
|-
|217
|''d10''
|[[Os01g0746400]]
|10.1111/j.1365-313X.2007.03210.x
|
*Annotated
|-
|218
|''Bc7(t)''
|[[Os01g0750300]]
|10.1016/S1673-8527(07)60115-5
|
*Biochemical and molecular characterization of a rice glutelin allele for the GluA-1 gene
|-
|221
|''gamyb''
|[[Os01g0812000]]
|10.1105/tpc.017327
|
*Annotated
|-
|222
|''lax''
|[[Os01g0831000]]
|10.1073/pnas.1932414100
|
*Annotated
|-
|223
|''oscfbp1''
|[[Os01g0866400]]
|10.1111/j.1365-3040.2008.01890.x
|
*Annotated
|-
|224
|''Osabf1''
|[[Os01g0867300]]
|10.1007/s11103-009-9592-9
|
*Annotated
|-
|225
|''Os-pollux''
|[[Os01g0870100]]
|10.1104/pp.108.131540
|
*Antiquity and Function of CASTOR and POLLUX, the Twin Ion Channel-Encoding Genes Key to the Evolution of Root Symbioses in Plants
|-
|226
|''OsPdk1''
|[[Os01g0872800]]
|10.1093/pcp/pcq167
|
*Pdk1 Kinase Regulates Basal Disease Resistance Through the OsOxi1–OsPti1a Phosphorylation Cascade in Rice
|-
|227
|''Osspr1''
|[[Os01g0898300]]
|10.1111/j.1469-8137.2010.03513.x
|
*Annotated
|-
|228
|''eg1''
|[[Os01g0900400]]
|10.1111/j.1365-313X.2008.03710.x
|
*A putative lipase gene EXTRA GLUME1 regulates both empty-glume fate and spikelet development in rice
|-
|229
|''pla2''
|[[Os01g0907900]]
|10.1105/tpc.105.037622
|
*Annotated
|-
|230
|''lhd2''
|[[Os01g0907900]]
|10.1038/sj.cr.7310034
|
*Annotated
|-
|231
|''C3H12''
|[[Os01g0917400]]
|10.1104/pp.111.191379
|
*A CCCH-Type Zinc Finger Nucleic Acid-Binding Protein Quantitatively Confers Resistance against Rice Bacterial Blight Disease
|-
|232
|''msp1''
|[[Os01g0917500]]
|10.1105/tpc.012401
|
*The MSP1 Gene Is Necessary to Restrict the Number of Cells Entering into Male and Female Sporogenesis and to Initiate Anther Wall Formation in Rice
|-
|233
|''OsFRDL4''
|[[Os01g0919100]]
|10.1111/j.1365-313X.2011.04757.x
|
*An Al-inducible MATE gene is involved in external detoxification of Al in rice
|-
|234
|''OsSSI2''
|[[Os01g0919900]]
|10.1094/MPMI-22-7-0820
|
*Annotation
|-
|235
|''OsMADS51''
|[[Os01g0922800]]
|10.1104/pp.107.103291
|
*Annotated
|-
|236
|''se13''
|[[Os01g0949400]]
|10.1007/s00122-010-1426-2
|
*Complete loss of photoperiodic response in the rice mutant line X61 is caused by deWciency of phytochrome chromophore biosynthesis gene
|-
|237
|''LCD''
|[[Os01g0956700]]
|10.1093/jxb/err300
|
*Low cadmium (LCD), a novel gene related to cadmium tolerance and accumulation in rice
|-
|238
|''cde1(t)''
|[[Os02g0121000]]
|10.1007/s00425-007-0525-z
|
*Identification and fine mapping of a thermo-sensitive chlorophyll deficient mutant in rice (Oryza sativa L.)
|-
|239
|''nrat1''
|[[Os02g0131800]]
|10.1073/pnas.1004949107
|
*Annotated
|-
|240
|''lc2''
|[[Os02g0152500]]
|10.1038/cr.2010.109
|
*Annotated
|-
|241
|''Oscand1''
|[[Os02g0167700]]
|10.1093/mp/ssq068
|
*OsCAND1 Is Required for Crown Root Emergence in Rice
|-
|242
|''osgl1-2''
|[[Os02g0178800]]
|10.1007/s11103-009-9483-0
|
*Annotated
|-
|244
|''b-OsLCY''
|[[Os02g0190600]]
|10.1111/j.1365-313X.2008.03411.x
|
*Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|245
|''Docs1''
|[[Os02g0236100]]
|10.1111/j.1365-313X.2011.04824.x
|
*A leucine-rich repeat receptor-like kinase gene is involved in the specification of outer cell layers in rice roots
|-
|246
|''ep3''
|[[Os02g0260200]]
|10.1007/s00122-009-1151-x
|
*Annotated
|-
|247
|''lp''
|[[Os02g0260200]]
|10.1111/j.1467-7652.2011.00610.x
|
*Annotated
|-
|248
|''oscps1''
|[[Os02g0278700]]
|10.1104/pp.103.033696
|
*An Overview of Gibberellin Metabolism Enzyme Genes and Their Related Mutants in Rice
|-
|249
|''naat1''
|[[Os02g0306401]]
|10.1104/pp.107.107912
|
*Mutation in Nicotianamine Aminotransferase Stimulated the Fe(II) Acquisition System and Led to Iron Accumulation in Rice
|-
|250
|''api5''
|[[Os02g0313400]]
|10.1105/tpc.110.082636
|
*Annotated
|-
|251
|''cfl1''
|[[Os02g0516400]]
|10.1105/tpc.111.088625
|
*Annotated
|-
|252
|''osgtgamma-1''
|[[Os02g0542400]]
|10.1007/s00438-009-0507-x
|
*Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses
|-
|253
|''Oscyt-inv1''
|[[Os02g0550600]]
|10.1007/s00425-008-0718-0
|
*OsCYT-INV1 for alkaline/neutral invertase is involved in root cell development and reproductivity in rice (Oryza sativa L.)
|-
|254
|''cpt1''
|[[Os02g0568200]]
|10.1105/tpc.104.028357
|
*The Rice COLEOPTILE PHOTOTROPISM1 Gene Encoding an Ortholog of Arabidopsis NPH3 Is Required for Phototropism of Coleoptiles and Lateral Translocation of Auxin
|-
|255
|''rss1''
|[[Os02g0606700]]
|10.1038/ncomms1279
|
*Annotated
|-
|256
|''OsCOL4''
|[[Os02g0610500]]
|10.1111/j.1365-313X.2010.04226.x
|
*Annotated
|-
|257
|''du3''
|[[Os02g0612300]]
|10.5511/plantbiotechnology.25.483
|
*Du3, a mRNA cap-binding protein gene, regulates amylose content in Japonica rice seeds
|-
|258
|''bc14''
|[[Os02g0614100]]
|10.1073/pnas.1016144108
|
*Golgi nucleotide sugar transporter modulates cell wall biosynthesis and plant growth in rice
|-
|260
|''oul1''
|[[Os02g0674800]]
|10.1104/pp.111.176016
|
*Annotated
|
|-
|261
|''Roc5''
|[[Os02g0674800]]
|10.1104/pp.111.176016
|
*Annotated
|-
|262
|''mfo1''
|[[Os02g0682200]]
|10.1105/tpc.109.068742
|
*Annotated
|-
|263
|''osmads6''
|[[Os02g0682200]]
|10.1111/j.1365-313X.2010.04354.x
|
*Annotated
|-
|265
|''adl1''
|[[Os02g0709400]]
|10.1016/j.ydbio.2009.07.042
|
*Annotated
|-
|266
|''OsGS1;1''
|[[Os02g0735200]]
|10.1111/j.1365-313X.2011.04506.x
|
*Metabolomics data reveal a crucial role of cytosolic glutamine synthetase 1;1 in coordinating metabolic balance in rice
|-
|268
|''bc3''
|[[Os02g0738900]]
|10.1007/s00425-010-1145-6
|
*Annotated
|-
|269
|''dsm1''
|[[Os02g0743500]]
|10.1104/pp.109.149856
|
*Annotated
|-
|270
|''lsi1''
|[[Os02g0745100]]
|10.1038/nature04590
|
*A silicon transporter in rice
|-
|271
|''OsbZIP23''
|[[Os02g0766700]]
|10.1104/pp.108.128199
|
*Annotated
|-
|272
|''pps''
|[[Os02g0771100]]
|10.1105/tpc.111.083436
|
*The COP1 Ortholog PPS Regulates the Juvenile–Adult and Vegetative–Reproductive Phase Changes in Rice
|-
|273
|''Ossgo1''
|[[Os02g0799100]]
|10.1111/j.1365-313X.2011.04615.x
|
*Annotated
|-
|274
|''Ospho1;2''
|[[Os02g0809800]]
|10.1104/pp.109.149872
|
*Characterization of the Rice PHO1 Gene Family Reveals a Key Role for OsPHO1;2 in Phosphate Homeostasis and the Evolution of a Distinct Clade in Dicotyledons
|-
|275
|''osmyoXIB''
|[[Os02g0816900]]
|10.1016/j.ydbio.2007.01.008
|
*ORYZA SATIVA MYOSIN XI B controls pollen development by photoperiod-sensitive protein localizations
|-
|276
|''rtbp1''
|[[Os02g0817800]]
|10.1105/tpc.107.051953
|
*Suppression of RICE TELOMERE BINDING PROTEIN1 Results in Severe and Gradual Developmental Defects Accompanied by Genome Instability in Rice
|-
|277
|''lpa1''
|[[Os02g0819400]]
|10.1007/s00122-008-0818-z
|
*The rice OsLpa1 gene encodes a novel protein involved in phytic acid metabolism
|-
|278
|''dh1''
|[[Os02g0820500]]
|10.1007/s11103-007-9283-3
|
*DH1, a LOB domain-like protein required for glume formation in rice
|-
|279
|''Osa8''
|[[Os03g0100800]]
|10.1093/jxb/ern298
|
*Annotated
|-
|280
|''pair1''
|[[Os03g0106300]]
|10.1105/tpc.020701
|
*The Novel Gene HOMOLOGOUS PAIRING ABERRATION IN RICE MEIOSIS1 of Rice Encodes a Putative Coiled-Coil Protein Required for Homologous Chromosome Pairing in Meiosis
|-
|281
|''lsi2''
|[[Os03g0107300]]
|10.1038/nature05964
|
*An efflux transporter of silicon in rice
|-
|282
|''rim1''
|[[Os03g0119966]]
|10.1111/j.1365-313X.2008.03712.x
|
*Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus
|-
|283
|''osmads50''
|[[Os03g0122600]]
|10.1111/j.1365-313X.2004.02082.x
|
*Annotated
|-
|284
|''dsm2''
|[[Os03g0125100]]
|10.1104/pp.110.163741
|
*Annotated
|-
|285
|''OsCYP96B4''
|[[Os03g0140400]]
|10.1371/journal.pone.0028069
|
*Annotated
|
|-
|286
|''XS-lpa2-1''
|[[Os03g0142800]]
|10.1007/s00122-009-1018-1
|
*Annotated
|-
|287
|''arl1''
|[[Os03g0149100]]
|10.1111/j.1365-313X.2005.02434.x
|
*Annotated
|-
|288
|''crl1''
|[[Os03g0149100]]
|10.1105/tpc.105.030981
|
*Annotated
|-
|289
|''OsEDR1''
|[[Os03g0160100]]
|10.1111/j.1365-3040.2010.02219.x
|
*OsEDR1 negatively regulates rice bacterial resistance via activation of ethylene biosynthesispce
|-
|290
|''oscow1''
|[[Os03g0162000]]
|10.1007/s11103-007-9203-6
|
*NARROW LEAF 7 controls leaf shape mediated by auxin in rice
|-
|291
|''nal7''
|[[Os03g0162000]]
|10.1007/s00438-008-0328-3
|
*NARROW LEAF 7 controls leaf shape mediated by auxin in rice
|-
|292
|''dpw''
|[[Os03g0167600]]
|10.1105/tpc.111.087528
|
*Defective Pollen Wall Is Required for Anther and Microspore Development in Rice and Encodes a Fatty Acyl Carrier Protein Reductase
|-
|293
|''cyp704B2''
|[[Os03g0168600]]
|10.1105/tpc.109.070326
|Annotated
|Development
|-
|294
|''oni1''
|[[Os03g0181500]]
|10.1111/j.1365-313X.2011.04530.x
|
*Annotated
|-
|295
|''OsPDS''
|[[Os03g0184000]]
|10.1111/j.1365-313X.2008.03411.x
|
*Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|296
|''gid2''
|[[Os03g0196500]]
|10.1126/science.1081077
|
*Accumulation of Phosphorylated Repressor for Gibberellin Signaling in an F-box Mutant
|-
|297
|''d88''
|[[Os03g0203200]]
|10.1007/s11103-009-9522-x
|
*Annotated
|-
|298
|''htd2''
|[[Os03g0203200]]
|10.1007/s00425-009-0975-6
|
*Annotated
|-
|299
|''d14''
|[[Os03g0203200]]
|10.1093/pcp/pcp091
|
*Annotated
|-
|300
|''dl''
|[[Os03g0215200]]
|10.1105/tpc.018044
|Annotated
|-
|301
|''lhs1''
|[[Os03g0215400]]
|10.1105/tpc.12.6.871
|
* Annotated
|-
|302
|''OsFRDL1''
|[[Os03g0216700]]
|10.1104/pp.108.128132
|
* OsFRDL1 Is a Citrate Transporter Required for Efficient Translocation of Iron in Rice
|-
|303
|''dsm3''
|[[Os03g0230500]]
|10.1007/s11103-011-9830-9
|
* Annotated
|-
|304
|''Osapc6''
|[[Os03g0236966]]
|10.1007/s10142-009-0155-6
|
* A candidate gene OsAPC6 of anaphase-promoting complex of rice identified through T-DNA insertion
|-
|305
|''rcn1''
|[[Os03g0281900]]
|10.1111/j.1469-8137.2008.02724.x
|
* Annotated
|-
|306
|''mit''
|[[Os03g0296800]]
|10.1038/ncomms1326
|
* The rice mitochondrial iron transporter is essential for plant growth
|-
|307
|''ssd1''
|[[Os03g0302900]]
|10.2183/pjab.86.265
|
* SSD1, which encodes a plant-specific novel protein, controls plant elongation by regulating cell division in rice
|-
|308
|''phyB''
|[[Os03g0309200]]
|10.1105/tpc.105.035899
|
* Annotated
|-
|309
|''oscipk31''
|[[Os03g0319400]]
|10.1007/s10059-010-0084-1
|Annotated
|-
|310
|''v2''
|[[Os03g0320900]]
|10.1111/j.1365-313X.2007.03251.x
|
* The rice nuclear gene, VIRESCENT 2, is essential for chloroplast development and encodes a novel type of guanylate kinase targeted to plastids and mitochondria
|-
|311
|''OschlH''
|[[Os03g0323200]]
|10.1093/pcp/pcg064
|
* Characterization of a Rice Chlorophyll-Deficient Mutant Using the T-DNA Gene-Trap System
|-
|312
|''glu1''
|[[Os03g0329500]]
|10.1007/s11103-005-2972-x
|
* Annotated
|-
|313
|''cwa1/bc1''
|[[Os03g0416200]]
|10.1007/s00425-010-1171-4
|
* Isolation of a novel cell wall architecture mutant of rice with defective Arabidopsis COBL4 ortholog BC1 required for regulated deposition of secondary cell wall components
|-
|314
|''glup4''
|[[Os03g0427300]]
|10.1270/jsbbs.60.556
|
* Characterization of the rice glup4 mutant suggests a role for the small GTPase Rab5 in the biosynthesis of carbon and nitrogen storage reserves in developing endosperm
|-
|315
|''OsAGO7''
|[[Os03g0449200]]
|10.1007/s00425-006-0472-0
|
* Annotated
|-
|316
|''shl4/sho2''
|[[Os03g0449200]]
|10.1073/pnas.0704339104
|
* Annotated
|-
|317
|''chl9''
|[[Os03g0563300]]
|10.1007/s11103-006-9024-z
|
* Rice Chlorina-1 and Chlorina-9 encode ChlD and ChlI subunits of Mg-chelatase, a key enzyme for chlorophyll synthesis and chloroplast development
|-
|318
|''pez1''
|[[Os03g0571900]]
|10.1074/jbc.M111.221168
|
* A Rice phenolic efflux transporter is essential for solubilizing precipitated apoplasmic iron in the plant stele
|-
|321
|''OsIAA11''
|[[Os03g0633500]]
|10.1093/mp/ssr074
|
* A Gain-of-Function Mutation in OsIAA11 Affects Lateral Root Development in Rice
|-
|322
|''Osam1''
|[[Os03g0650400]]
|10.1038/cr.2011.7
|
* OsAM1 is required for leptotene-zygotene transition in rice
|-
|323
|''nol1''
|[[Os03g0654600]]
|10.1111/j.1365-313X.2008.03670.x
|
* Two short-chain dehydrogenase/reductases, NON-YELLOW COLORING 1 and NYC1-LIKE, are required for chlorophyll b and light-harvesting complex II degradation during senescence in rice
|-
|324
|''v1''
|[[Os03g0656900]]
|10.1111/j.1365-313X.2011.04755.x
|
* Annotated
|-
|325
|''crl4''
|[[Os03g0666100]]
|10.3117/plantroot.2.19
|
* CRL4 regulates crown root formation through auxin transport in rice
|-
|327
|''fc1/OsTB1''
|[[Os03g0706500]]
|10.1046/j.1365-313X.2003.01648.x
|
* Annotated
|-
|328
|''slr1''
|[[Os03g0707600]]
|10.1105/tpc.13.5.999
|
* Annotated
|-
|329
|''Slr1-d''
|[[Os03g0707600]]
|10.1007/s00438-008-0406-6
|
* Annotated
|-
|330
|''phyA''
|[[Os03g0719800]]
|10.1105/tpc.105.035899
|
* Distinct and Cooperative Functions of Phytochromes A, B, and C in the Control of Deetiolation and Flowering in Rice
|-
|331
|''OsMIK''
|[[Os03g52760]]
|10.1007/s00122-008-0863-7
|
* Isolation and characterization of a low phytic acid rice mutant reveals a mutation in the rice orthologue of maize MIK
|-
|332
|''phyC''
|[[Os03g0752100]]
|10.1105/tpc.105.035899
|
* Distinct and Cooperative Functions of Phytochromes A, B, and C in the Control of Deetiolation and Flowering in Rice
|-
|333
|''pap2''
|[[Os03g0753100]]
|10.1093/pcp/pcp166
|
* Annotated
|-
|334
|''osmads34''
|[[Os03g0753100]]
|10.1104/pp.110.156711
|
* Annotated
|-
|335
|''pho1''
|[[Os03g0758100]]
|10.1105/tpc.107.054007
|
* Mutation of the Plastidial a-Glucan Phosphorylase Gene in Rice Affects the Synthesis and Structure of Starch in the Endosperm
|-
|336
|''bel''
|[[Os03g0760200]]
|10.1007/s11103-006-0058-z
|
* Annotated
|-
|337
|''DST''
|[[Os03g0786400]]
|10.1101/gad.1812409
|
* Annotated
|-
|338
|''pla3/gp''
|[[Os03g0790600]]
|10.1111/j.1365-313X.2009.03841.x
|
* PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in rice
|-
|339
|''el1''
|[[Os03g0793500]]
|10.1038/emboj.2010.75
|
* Annotated
|-
|340
|''chl1''
|[[Os03g0811100]]
|10.1007/s11103-006-9024-z
|
* Annotated
|-
|341
|''OsIDS1''
|[[Os03g0818800]]
|10.1111/j.1365-313X.2011.04804.x
|
* Two AP2 family genes, SUPERNUMERARY BRACT (SNB) and OsINDETERMINATE SPIKELET 1 (OsIDS1), synergistically control inflorescence architecture and floral meristem establishment in rice
|-
|342
|''Xb15''
|[[Os03g0821300]]
|10.1371/journal.pbio.0060231
|
* Rice XB15, a Protein Phosphatase 2C, Negatively Regulates Cell Death and XA21-Mediated Innate Immunity Chang
|-
|343
|''Os-castor''
|[[Os03g0843600]]
|10.1104/pp.108.131540
|
* Antiquity and Function of CASTOR and POLLUX, the Twin Ion Channel-Encoding Genes Key to the Evolution of Root Symbioses in Plants
|-
|345
|''etr2''
|[[Os04g0169100]]
|10.1105/tpc.108.065391
|
* The Ethylene Receptor ETR2 Delays Floral Transition and Affects Starch Accumulation in Rice
|-
|346
|''OsYSL6''
|[[Os04g0390500]]
|10.1104/pp.111.186031
|* OsYSL6 Is Involved in the Detoxification of Excess Manganese in Rice1[W][OA]
|-
|347
|''lax2''
|[[Os04g0396500]]
|10.1105/tpc.111.088765
|
* LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems
|-
|348
|''ACL1''
|[[Os04g0415000]]
|10.1093/mp/ssq022
|
* Annotated
|-
|349
|''zep1''
|[[Os04g0452500]]
|10.1105/tpc.109.070789
|
* Annotated
|-
|350
|''tdd1''
|[[Os04g0463500]]
|10.1111/j.1365-313X.2009.03952.x
|
* A rice tryptophan deficient dwarf mutant, tdd1, contains a reduced level of indole acetic acid and develops abnormal flowers and organless embryos
|-
|351
|''d11''
|[[Os04g0469800]]
|10.1105/tpc.104.024950
|
* Annotated
|-
|352
|''OsGLU3''
|[[Os04g0497200]]
|10.1093/mp/ssr084
|
* OsGLU3, a putative membrane-bound endo-1,4-beta-glucanase, is required for root cell elongation and division in rice (Oryza sativa L.)
|-
|353
|''OsDCL4''
|[[Os04g0509300]]
|10.1105/tpc.107.052209
|
* Oryza sativa Dicer-like4 Reveals a Key Role for Small Interfering RNA Silencing in Plant Development
|-
|355
|''TOB1''
|[[Os04g0536300]]
|10.1105/tpc.111.094797
|
* The YABBY Gene TONGARI-BOUSHI1 Is Involved in Lateral Organ Development and Maintenance of Meristem Organization in the Rice Spikelet
|-
|356
|''Osvpe1''
|[[Os04g0537900]]
|10.1111/j.1365-313X.2009.03801.x
|
* The vacuolar processing enzyme OsVPE1 is required for efficient glutelin processing in rice
|-
|357
|''d17''
|[[Os04g0550600]]
|10.1038/nature07272
|
* Inhibition of shoot branching by new terpenoid plant hormones
|-
|359
|''OsCPK12''
|[[Os04g0560600]]
|10.1111/j.1365-313X.2011.04766.x
|
* Annotated
|-
|360
|''glr3.1''
|[[Os04g0585200]]
|10.1105/tpc.105.037713
|
* Annotated
|-
|361
|''apo2''
|[[Os04g0598300]]
|10.1111/j.1365-313X.2011.04781.x
|
* ABERRANT PANICLE ORGANIZATION 2/RFL, the rice ortholog of Arabidopsis LEAFY, suppresses the transition from inflorescence meristem to floral meristem through interaction with APO1
|-
|362
|''rlin1''
|[[Os04g0610800]]
|10.1016/j.jcg.2010.12.001
|
* RLIN1, encoding a putative coproporphyrinogen III oxidase, is involved in lesion initiation in rice
|-
|363
|''osks1''
|[[Os04g0611800]]
|10.1104/pp.103.033696
|
* An Overview of Gibberellin Metabolism Enzyme Genes and Their Related Mutants in Rice
|-
|364
|''fc1''
|[[Os04g0612700]]
|10.1007/s11103-008-9448-8
|
* FLEXIBLE CULM 1 encoding a cinnamyl-alcohol dehydrogenase controls culm mechanical strength in rice
|-
|366
|''ili1''
|[[Os04g0641700]]
|10.1105/tpc.109.070441
|
* Antagonistic HLH/bHLH Transcription Factors Mediate Brassinosteroid Regulation of Cell Elongation and Plant Development in Rice and Arabidopsis
|-
|367
|''flo2''
|[[Os04g0645100]]
|10.1105/tpc.109.070821
|
* Annotation
|-
|368
|''OsCP1''
|[[Os04g0670500]]
|10.1023/B:PLAN.0000040904.15329.29
|
* Isolation and characterization of a rice cysteine protease gene, OsCP1, using T-DNA gene-trap system
|-
|369
|''OsARF12''
|[[Os04g0671900]]
|10.1111/j.1469-8137.2011.03910.x
|
* Annotation
|-
|370
|''OsMKP1''
|[[Os05g0115800]]
|10.1093/pcp/pcm007
|
* A Calmodulin-Binding Mitogen-Activated Protein Kinase Phosphatase is Induced by Wounding and Regulates the Activities of Stress-Related Mitogen-Activated Protein Kinases in Rice
|-
|371
|''rsr1''
|[[Os05g0121600]]
|10.1104/pp.110.159517
|
* Coexpression Analysis Identifies Rice Starch Regulator1, a Rice AP2/EREBP Family Transcription Factor, as a Novel Rice Starch Biosynthesis Regulator1
|-
|372
|''siz1''
|[[Os05g0125000]]
|10.1111/j.1469-8137.2010.03538.x
|
* Annotation
|-
|373
|''srs3''
|[[Os05g0154700]]
|10.1093/pcp/pcq092
|
* Annotation
|-
|374
|''bc10''
|[[Os05g0170000]]
|10.1111/j.1365-313X.2008.03703.x
|
* BC10, a DUF266-containing and Golgi-located type II membrane protein, is required for cell-wall biosynthesis in rice (Oryza sativa L.)
|-
|375
|''mads58''
|[[Os05g0203800]]
|10.1105/tpc.111.087262
|
* ??Rice MADS6 Interacts with the Floral Homeotic Genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in Specifying Floral Organ Identities and Meristem Fate
|-
|376
|''d1''
|[[Os05g0333200]]
|10.1073/pnas.96.18.10284
|
* Annotation
|-
|377
|''ygl1''
|[[Os05g0349700]]
|10.1104/pp.107.100321
|
* Annotation
|-
|378
|''OsImpβ1''
|[[Os05g0353400]]
|10.1007/s10059-011-2321-7
|
* Rice Importin β1 Gene Affects Pollen Tube Elongation
|-
|379
|''osbc1l4''
|[[Os05g0386800]]
|10.1007/s11103-009-9537-3
|
* Molecular characterization, expression pattern, and function analysis of the OsBC1L family in rice
|-
|380
|''flo4''
|[[Os05g0405000]]
|10.1111/j.1365-313X.2005.02423.x
|
* White-core endosperm floury endosperm-4 in rice is generated by knockout mutations in the C4-type pyruvate orthophosphate dikinase gene (OsPPDKB)
|-
|382
|''gid1''
|[[Os05g0407500]]
|10.1038/nature04028
|
* Annotation
|-
|383
|''DNG701''
|[[Os05g0446000]]
|10.1073/pnas.1112704108
|
* A 5-methylcytosine DNA glycosylase/lyase demethylates the retrotransposon Tos17 and promotes its transposition in rice
|-
|384
|''bgl''
|[[Os05g0454200]]
|10.1007/s11103-011-9839-0
|
* The rice bright green leaf (bgl) locus encodes OsRopGEF10, which activates the development of small cuticular papillae on leaf surfaces
|-
|385
|''oszip5''
|[[Os05g0472700]]
|10.1007/s11103-010-9637-0
|
* OsZIP5 is a plasma membrane zinc transporter in rice
|-
|386
|''eui1''
|[[Os05g0482400]]
|10.1093/pcp/pci233
|
* Annotation
|-
|389
|''spl7''
|[[Os05g0530400]]
|10.1073/pnas.112209199
|
* Annotation
|-
|390
|''snrk1a''
|[[Os05g0530500]]
|10.1105/tpc.105.037887
|
* The SnRK1A Protein Kinase Plays a Key Role in Sugar Signaling during Germination and Seedling Growth of Rice
|-
|391
|''ltn1''
|[[Os05g0557700]]
|10.1104/pp.110.170209
|
*Annotated
|-
|392
|''nl1''
|[[Os05g0578900]]
|10.1038/cr.2009.36
|
* NECK LEAF 1, a GATA type transcription factor, modulates organogenesis by regulating the expression of multiple regulatory genes during reproductive development in rice
|-
|393
|''Osrec8''
|[[Os05g0580500]]
|10.1104/pp.111.177428
|
* Annotated
|-
|394
|''osjar1''
|[[Os05g0586200]]
|10.1111/j.1365-3040.2008.01790.x
|
* Annotated
|-
|395
|''Osexpa17''
|[[Os06g0108600]]
|10.1111/j.1365-313X.2011.04533.x
|
* Root hair-specific expansins modulate root hair elongation in rice
|-
|398
|''zn''
|[[Os06g0116400]]
|10.1111/j.1365-313X.2010.04183.x
|
* ZEBRA-NECROSIS, a thylakoid-bound protein, is critical for the photoprotection of developing chloroplasts during early leaf development
|-
|399
|''osbbi1''
|[[Os06g0125800]]
|10.1038/cr.2011.4
|
* Annotated
|-
|400
|''d62/dlt''
|[[Os06g0127800]]
|10.1007/s00425-010-1263-1
|
* Annotated
|-
|402
|''sik1''
|[[Os06g0130100]]
|10.1111/j.1365-313X.2010.04146.x
|
* Annotated
|-
|403
|''dp1''
|[[Os06g0136900]]
|10.1016/j.ydbio.2011.08.023
|
* An AT-hook gene is required for palea formation and floral organ number control in rice
|-
|404
|''d3''
|[[Os06g0154200]]
|10.1093/pcp/pci022
|
* Suppression of Tiller Bud Activity in Tillering Dwarf Mutants of Rice
|-
|405
|''OsSSI''
|[[Os06g0160700]]
|10.1104/pp.105.071845
|
* Annotated
|-
|406
|''v3''
|[[Os06g0168600]]
|10.1104/pp.109.136648
|
* Rice Virescent3 and Stripe1 Encoding the Large and Small Subunits of Ribonucleotide Reductase Are Required for Chloroplast Biogenesis during Early Leaf Development
|-
|407
|''aid1''
|[[Os06g0181300]]
|10.1104/pp.104.041459
|
* The ANTHER INDEHISCENCE1 Gene Encoding a Single MYB Domain Protein Is Involved in Anther Development in Rice
|-
|408
|''abl1''
|[[Os06g0211200]]
|10.1104/pp.111.173427
|
* Annotated
|-
|409
|''Osabf2''
|[[Os06g0211200]]
|10.1016/j.jplph.2010.05.008
|
* Annotated
|-
|410
|''lsi6''
|[[Os06g0228200]]
|10.1105/tpc.108.059311
|
* A Transporter Regulating Silicon Distribution in Rice Shoots
|-
|411
|''st1''
|[[Os06g0257450]]
|10.1104/pp.109.136648
|
* Rice Virescent3 and Stripe1 Encoding the Large and Small Subunits of Ribonucleotide Reductase Are Required for Chloroplast Biogenesis during Early Leaf Development
|-
|412
|''nyc3''
|[[Os06g0354700]]
|10.1111/j.1365-313X.2009.03919.x
|
* Defect in non-yellow coloring 3, an a/b hydrolase-fold family protein, causes a stay-green phenotype during leaf senescence in rice
|-
|413
|''d35''
|[[Os06g0569500]]
|10.1023/B:PLAN.0000038261.21060.47
|
* Annotated
|-
|414
|''OsIAA23''
|[[Os06g0597000]]
|10.1111/j.1365-313X.2011.04698.x
|
* Annotated
|-
|415
|''se5''
|[[Os06g0603000]]
|10.1046/j.1365-313X.2000.00753.x
|
* Annotated
|-
|416
|''moc1''
|[[Os06g0610350]]
|10.1038/nature01518
|
* Annotated
|-
|417
|''spp''
|[[Os06g0625400]]
|10.1093/pcp/pcq012
|
* A Rice Stromal Processing Peptidase Regulates Chloroplast and Root Development
|-
|418
|''apo1''
|[[Os06g0665400]]
|10.1111/j.1365-313X.2007.03200.x
|
* Rice ABERRANT PANICLE ORGANIZATION 1, encoding an F-box protein, regulates meristem fate
|-
|419
|''oshma9''
|[[Os06g0665800]]
|10.1104/pp.107.102236
|
* Annotated
|-
|420
|''dep3''
|[[Os06g0677000]]
|10.1007/s00122-011-1543-6
|
* Fine mapping and candidate gene analysis of dense and erect panicle 3, DEP3, which confers high grain yield in rice (Oryza sativa L.)
|-
|421
|''star1''
|[[Os06g0695800]]
|10.1105/tpc.108.064543
|
* Annotated
|-
|422
|''OsHMA2''
|[[Os06g0700700]]
|10.1093/pcp/pcr166
|
* Annotated
|-
|423
|''oshkt2;1''
|[[Os06g0701700]]
|10.1038/sj.emboj.7601732
|
* Annotated
|-
|424
|''spw1''
|[[Os06g0712700]]
|10.1242/dev.00294
|
* Annotated
|-
|425
|''fon1''
|[[Os06g0717200]]
|10.1242/dev.01441
|
* The gene FLORAL ORGAN NUMBER1 regulates floral meristem size in rice and encodes a leucine-rich repeat receptor kinase orthologous to Arabidopsis CLAVATA1
|-
|426
|''ila1''
|[[Os06g0724900]]
|10.1105/tpc.111.093419
|
* Annotated
|-
|427
|''GA2ox5''
|[[Os07g0103500]]
|10.1105/tpc.108.060913
|
* A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice
|-
|428
|''crl5''
|[[Os07g0124700]]
|10.1111/j.1365-313X.2011.04610.x
|
|* Finished
|-
|429
|''g1''
|[[Os07g0139300]]
|10.1073/pnas.0907896106
|
* The homeotic gene long sterile lemma (G1) specifies sterile lemma identity in the rice spikelet
|-
|430
|''waf1''
|[[Os07g0164000]]
|10.1104/pp.110.160234
|
* Annotated
|-
|431
|''osku70''
|[[Os07g0184900]]
|10.1104/pp.109.150391
|
* OsKu70 Is Associated with Developmental Growth and Genome Stability in Rice
|-
|432
|''OsPHF1''
|[[Os07g0187700]]
|10.1104/pp.111.181669
|
* OsPHF1 Regulates the Plasma Membrane Localization of Low- and High-Affinity Inorganic Phosphate Transporters and Determines Inorganic Phosphate Uptake and Translocation in Rice
|-
|433
|''STR2''
|[[Os07g0191600]]
|10.1111/j.1365-313X.2011.04842.x
|
* The half-size ABC transporters STR1 and STR2 are indispensable for mycorrhizal arbuscule formation in rice
|-
|434
|''OsZDS''
|[[Os07g0204900]]
|10.1111/j.1365-313X.2008.03411.x
|
* Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|435
|''sh-h''
|[[Os07g0207700]]
|10.1111/j.1365-313X.2009.04039.x
|
* Inactivation of the CTD phosphatase-like gene OsCPL1 enhances the development of the abscission layer and seed shattering in rice
|-
|436
|''OsZIP8''
|[[Os07g0232800]]
|10.1007/s10059-010-0069-0
|
* Zinc Deficiency-Inducible OsZIP8 Encodes a Plasma Membrane-Localized Zinc Transporter in Rice
|-
|437
|''snb''
|[[Os07g0235800]]
|10.1111/j.1365-313X.2006.02941.x
|
* The rice heterochronic gene SUPERNUMERARY BRACT regulates the transition from spikelet meristem to floral meristem
|-
|438
|''oscbt''
|[[Os07g0490200]]
|10.1007/s10059-009-0081-4
|
* The Calmodulin-Binding Transcription Factor OsCBT Suppresses Defense Responses to Pathogens in Rice
|-
|439
|''oswrky78''
|[[Os07g0583700]]
|10.1007/s00425-011-1423-y
|
* The WRKY transcription factor OsWRKY78 regulates stem elongation and seed development in rice
|-
|440
|''bui1''
|[[Os07g0596300]]
|10.1105/tpc.110.081802
|
* Annotated
|-
|441
|''dep2''
|[[Os07g0616000]]
|10.1038/cr.2010.69
|
* Annotated
|-
|442
|''srs1''
|[[Os07g0616000]]
|10.1266/ggs.85.327
|
* Annotated
|-
|445
|''rth1''
|[[Os07g0682800]]
|10.1270/jsbbs.59.13
|
* Annotated
|-
|446
|''wox11''
|[[Os07g0684900]]
|10.1105/tpc.108.061655
|
* The WUSCHEL-Related Homeobox Gene WOX11 Is Required to Activate Shoot-Borne Crown Root Development in Rice
|-
|447
|''OsNAS3''
|[[Os07g0689600]]
|10.1073/pnas.0910950106
|
* Iron fortification of rice seeds through activation of the nicotianamine synthase gene
|-
|448
|''ehd3''
|[[Os08g0105000]]
|10.1111/j.1365-313X.2011.04517.x
|
* Annotated
|-
|449
|''pss1''
|[[Os08g0117000]]
|10.1105/tpc.109.073692
|
* Annotated
|-
|450
|''cyp703a3''
|[[Os08g0131100]]
|10.1105/tpc.108.062935
|
* Annotated
|-
|451
|''crr6''
|[[Os08g0167500]]
|10.1111/j.1365-313X.2011.04747.x
|
* Annotated
|-
|453
|''ss3a''
|[[Os08g0191433]]
|10.1093/jxb/err125
|
* Annotated
|-
|454
|''osagps2''
|[[Os08g0345800]]
|10.1007/s11103-007-9153-z
|
* Annotated
|-
|455
|''GF14c''
|[[Os08g0430500]]
|10.1093/pcp/pcp012
|
* The 14-3-3 Protein GF14c Acts as a Negative Regulator of Flowering in Rice by Interacting with the Florigen Hd3a
|-
|456
|''coe1''
|[[Os08g0442700]]
|10.1111/j.1365-313X.2010.04250.x
|
* COE1, an LRR–RLK responsible for commissural vein pattern formation in rice
|-
|457
|''bc12''
|[[Os09g0114500]]
|10.1111/j.1365-313X.2010.04238.x
|
* Annotated
|-
|458
|''gdd1''
|[[Os09g0114500]]
|10.1105/tpc.110.081901
|
* Annotated
|-
|459
|''sll1''
|[[Os09g0395300]]
|10.1105/tpc.108.061457
|
* Annotated
|-
|460
|''rl9''
|[[Os09g0395300]]
|10.1007/s11103-008-9365-x
|
* Annotated
|-
|461
|''STR1''
|[[Os09g0401100]]
|10.1111/j.1365-313X.2011.04842.x
|
* Annotated
|-
|462
|''rep1''
|[[Os09g0410500]]
|10.1104/pp.108.128231
|
* RETARDED PALEA1 Controls Palea Development and Floral Zygomorphy in Rice
|-
|463
|''bc6''
|[[Os09g0422500]]
|10.1093/jxb/erq395
|
* Annotated
|-
|464
|''OsCesA9''
|[[Os09g0422500]]
|10.1104/pp.103.022442
|
* Annotated
|-
|465
|''osgl1-1''
|[[Os09g0426800]]
|10.1093/mp/ssr028
|
* Annotated
|-
|466
|''wsl2''
|[[Os09g0426800]]
|10.1007/s00425-011-1481-1
|
* Annotated
|-
|470
|''PTC1''
|[[Os09g0449000]]
|10.1104/pp.111.175760
|
* Annotated
|-
|471
|''aco1''
|[[Os09g0451000]]
|10.1111/j.1365-3040.2009.02106.x
|
* ACO1, a gene for aminocyclopropane-1-carboxylate oxidase: effects on internode elongation at the heading stage in rice
|-
|472
|''isa3''
|[[Os09g0469400]]
|10.1093/pcp/pcr058
|
* Rice Debranching Enzyme Isoamylase3 Facilitates Starch Metabolism and Affects Plastid Morphogenesis
|-
|473
|''gna1''
|[[Os09g0488000]]
|10.1104/pp.104.058248
|
* A Novel Short-Root Gene Encodes a Glucosamine-6-Phosphate Acetyltransferase Required for Maintaining Normal Root Cell Shape in Rice
|-
|474
|''PAIR2''
|[[Os09g0506800]]
|10.1007/s00438-003-0934-z
|
* An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis
|-
|475
|''sgr''
|[[Os09g0532000]]
|10.1105/tpc.106.044891
|
* The Senescence-Induced Staygreen Protein Regulates Chlorophyll Degradation
|-
|476
|''OsAT1/Spl18''
|[[Os10g0195600]]
|10.1007/s11103-006-9130-y
|
* Isolation and molecular characterization of a Spotted leaf 18 mutant by modified activation-tagging in rice
|-
|477
|''brd2''
|[[Os10g0397400]]
|10.1105/tpc.105.030973
|
* Annotated
|-
|478
|''pla1''
|[[Os10g0403000]]
|10.1073/pnas.2636936100
|
* Annotated
|-
|479
|''pair3''
|[[Os10g0405500]]
|10.1111/j.1365-313X.2009.03870.x
|
* Annotated
|-
|480
|''ehd2''
|[[Os10g0419200]]
|10.1104/pp.108.125542
|
* Annotated
|-
|481
|''rid1''
|[[Os10g0419200]]
|10.1073/pnas.0806019105
|
* Annotated
|-
|482
|''OsCesA7''
|[[Os10g0467800]]
|10.1104/pp.103.022442
|
* Annotated
|-
|483
|''wda1''
|[[Os10g0471100]]
|10.1105/tpc.106.042044
|
* Wax-deficient anther1 Is Involved in Cuticle and Wax Production in Rice Anther Walls and Is Required for Pollen Development
|-
|484
|''OsMPK6''
|[[Os10g0533600]]
|10.1007/s00425-007-0541-z
|
* Annotated
|-
|485
|''OsCAO1''
|[[Os10g0567200]]
|10.1007/s11103-005-2066-9
|
* Annotated
|-
|486
|''cao''
|[[Os10g0567400]]
|10.1270/jsbbs.55.361
|
* Annotated
|-
|487
|''jmj6''
|[[Os10g0577600]]
|10.1073/pnas.0805901105
|
* Annotated
|-
|488
|''OsCSLD1''
|[[Os10g0578200]]
|10.1104/pp.106.091546
|
* OsCSLD1, a Cellulose Synthase-Like D1 Gene, Is Required for Root Hair Morphogenesis in Rice
|-
|489
|''phot1a''
|[[Os11g0102200]]
|10.1007/s11103-008-9442-1
|
* Rice phot1a mutation reduces plant growth by affecting photosynthetic responses to light during early seedling growth
|-
|490
|''OsPK1''
|[[Os11g0148500]]
|10.1007/s00425-011-1471-3
|
* Annotated
|-
|491
|''PDIL1''
|[[Os11g0199200]]
|10.1093/jxb/err262
|
* The failure to express a protein disulphide isomerase-like protein results in a floury endosperm and an endoplasmic reticulum stress response in rice
|-
|492
|''rad''
|[[Os11g0210300]]
|10.1270/jsbbs.56.69
|
* Annotated
|-
|493
|''sp1''
|[[Os11g0235200]]
|10.1111/j.1365-313X.2009.03799.x
|
* Annotated
|-
|494
|''Tid1''
|[[Os11g0247300]]
|10.1266/ggs.84.209
|
* Annotated
|-
|495
|''nls1-1D''
|[[Os11g0249000]]
|10.1111/j.1365-313X.2011.04557.x
|
* Annotated
|-
|496
|''lazy1''
|[[Os11g0490600]]
|10.1038/cr.2007.38
|
* Annotated
|-
|497
|''osarf1''
|[[Os11g0523800]]
|10.1007/s11103-009-9474-1
|
* Annotated
|-
|498
|''tld1-D''
|[[Os11g0528700]]
|10.1104/pp.109.146803
|
* Altered Architecture and Enhanced Drought Tolerance in Rice via the Down-Regulation of Indole-3-Acetic Acid by TLD1/OsGH3.13 Activation
|-
|501
|''d27''
|[[Os11g0587000]]
|10.1105/tpc.109.065987
|
* Annotated
|-
|502
|''fon2''
|[[Os11g0595400]]
|10.1093/pcp/pcl025
|
* Conservation and Diversification of Meristem Maintenance Mechanism in Oryza sativa: Function of the FLORAL ORGAN NUMBER2 Gene
|-
|503
|''wdl1''
|[[Os11g0708400]]
|10.1007/s11103-010-9656-x
|
* Mutation in Wilted Dwarf and Lethal 1 (WDL1) causes abnormal cuticle formation and rapid water loss in rice
|-
|504
|''rip1''
|[[Os12g0132400]]
|10.1093/pcp/pcl013
|
* Rice Immature Pollen 1 (RIP1) is a Regulator of Late Pollen Development
|-
|505
|''art1''
|[[Os12g0170400]]
|10.1105/tpc.109.070771
|
* A Zinc Finger Transcription Factor ART1 Regulates Multiple Genes Implicated in Aluminum Tolerance in Rice
|-
|506
|''OsMADS13''
|[[Os12g0207000]]
|10.1111/j.1365-313X.2007.03272.x
|
* The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice
|-
|507
|''ogr1''
|[[Os12g0270200]]
|10.1111/j.1365-313X.2009.03909.x
|
* Rice OGR1 encodes a pentatricopeptide repeat–DYW protein and is essential for RNA editing in mitochondria
|-
|508
|''osatg10b''
|[[Os12g0506800]]
|10.1007/s10059-009-0006-2
|
* Annotated
|-
|509
|''kch1''
|[[Os12g0547500]]
|10.1093/jxb/erq164
|
* A kinesin with calponin-homology domain is involved in premitotic nuclear migration
|-
|513
|''spl11''
|[[Os12g0570000]]
|10.1105/tpc.108.058610
|
* SPIN1, a K Homology Domain Protein Negatively Regulated and Ubiquitinated by the E3 Ubiquitin Ligase SPL11, Is Involved in Flowering Time Control in Rice
|-
|514
|''mel2''
|[[Os12g0572800]]
|10.1371/journal.pgen.1001265
|
* A Novel RNA-Recognition-Motif Protein Is Required for Premeiotic G1/S-Phase Transition in Rice (Oryza sativa L.)
|-
|515
|''gpa1''
|[[Os12g0631100]]
|10.1111/j.1365-313X.2010.04370.x
|
* OsRab5a regulates endomembrane organization and storage protein trafficking in rice endosperm cells
|-
|516
|''ossut2''
|[[Os12g0641400]]
|10.1104/pp.111.176982
|
* Annotated
|-
|517
|''d18''
|[[Os01g0177400]]
|10.1073/pnas.141239398
|
* Annotated
|-
|518
|''Gn1a''
|[[Os01g0197700]]
|10.1126/science.1113373
|
* Cytokinin Oxidase Regulates Rice Grain Production
|-
|520
|''SKC1''
|[[Os01g0307500]]
|10.1038/ng1643
|
* Annotated
|-
|521
|''PSR''
|[[Os01g0357100]]
|10.1073/pnas.0504220102
|
* Isolation of a rice regeneration quantitative trait loci gene and its application to transformation systems
|-
|522
|''SaF''
|[[Os01g0578500]]
|10.1073/pnas.0810108105
|
* Annotated
|-
|523
|''SaM''
|[[Os01g0578700]]
|10.1073/pnas.0810108105
|
* Hybrid male sterility in rice controlled by interaction between divergent alleles of two adjacent genes
|-
|524
|''Rd''
|[[Os01g0633500]]
|10.1111/j.1365-313X.2006.02958.x
|
* The Rc and Rd genes are involved in proanthocyanidin synthesis in rice pericarp
|-
|525
|''Pi37''
|[[Os01g0781700]]
|10.1534/genetics.107.080648
|
* The Blast Resistance Gene Pi37 Encodes a Nucleotide Binding Site–Leucine-Rich Repeat Protein and Is a Member of a Resistance Gene Cluster on Rice Chromosome 1
|-
|526
|''qSH1''
|[[Os01g0848400]]
|10.1126/science.1126410
|
* Annotated
|-
|527
|''qNPQ1-2''
|[[Os01g0869800]]
|10.1073/pnas.1104809108
|
|Finished
|-
|528
|''sd1''
|[[Os01g0883800]]
|10.1038/416701a
|
* Annotated
|-
|529
|''GW2''
|[[Os02g0244100]]
|10.1038/ng2014
|
* Annotated
|-
|530
|''Rf2''
|[[Os02g0274000]]
|10.1111/j.1365-313X.2010.04427.x
|
* The fertility restorer gene, Rf2, for Lead Rice-type cytoplasmic male sterility of rice encodes a mitochondrial glycine-rich protein
|-
|531
|''hbd2''
|[[Os02g0622100]]
|10.1007/s00438-010-0514-y
|
* Annotated
|-
|532
|''Pib''
|[[Os02g0818450]]
|10.1046/j.1365-313X.1999.00498.x
|
* The Pib gene for rice blast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes
|-
|533
|''qLTG3?1''
|[[Os03g0103300]]
|10.1073/pnas.0805303105
|
* Annotated
|-
|534
|''dth3''
|[[Os03g0122600]]
|10.1007/s00299-011-1129-4
|
* Annotated
|-
|535
|''GS3''
|[[Os03g0407400]]
|10.1007/s00122-006-0218-1
|
* Annotated
|-
|536
|''GRP162''
|[[Os03g0641300]]
|10.1105/tpc.111.093211
|
* The Rice Pentatricopeptide Repeat Protein RF5 Restores Fertility in Hong-Lian Cytoplasmic Male-Sterile Lines via a Complex with the Glycine-Rich Protein GRP162
|-
|537
|''LOX-3''
|[[Os03g0700400]]
| 10.1007/s12374-013-0085-7
|
* Molecular genetic characterization of rice seed lipoxygenase 3 and assessment of its effects on seed longevity
|-
|538
|''Hd6''
|[[Os03g0762000]]
|10.1073/pnas.111136798
|
* Annotated
|-
|539
|''Bph14''
|[[Os03g0848700]]
|10.1073/pnas.0912139106
|
* Annotated
|-
|541
|''Pi21''
|[[Os04g0401000]]
|10.1126/science.1175550
|
* Annotated
|-
|542
|''GIF1''
|[[Os04g0413500]]
|10.1038/ng.220
|
* Annotated
|-
|543
|''Rf17''
|[[Os04g0475900]]
|10.1073/pnas.0901860106
|
* Suppressed expression of RETROGRADE-REGULATED MALE STERILITY restores pollen fertility in cytoplasmic male sterile rice plants
|-
|544
|''BET1''
|[[Os04g0477300]]
|10.1104/pp.110.171470
|
* Suppression of a NAC-Like Transcription Factor Gene Improves Boron-Toxicity Tolerance in Rice
|-
|545
|''OSB2''
|[[Os04g0557500]]
|10.1093/pcp/pce128
|
* The Purple leaf (Pl) Locus of Rice: the Plw Allele has a Complex Organization and Includes Two Genes Encoding Basic Helix-Loop-Helix Proteins Involved in Anthocyanin Biosynthesis
|-
|546
|''OSB1''
|[[Os04g0557800]]
|10.1093/pcp/pce128
|
* The Purple leaf (Pl) Locus of Rice: the Plw Allele has a Complex Organization and Includes Two Genes Encoding Basic Helix-Loop-Helix Proteins Involved in Anthocyanin Biosynthesis
|-
|547
|''Xa1''
|[[Os04g0622600]]
|10.1073/pnas.95.4.1663
|
* Annotated
|-
|548
|''sh4''
|[[Os04g0670900]]
|10.1126/science.1123604
|
* Rice Domestication by Reducing Shattering
|-
|549
|''Xa5''
|[[Os05g0107700]]
|10.1094/MPMI.2004.17.12.1348
|
* Annotated
|-
|550
|''GS5''
|[[Os05g0158500]]
|10.1038/ng.977
|
* Annotated
|-
|551
|''GW5''
|[[DQ991205]]
|10.1038/cr.2008.307
|
* Isolation and initial characterization of GW5, a major QTL associated with rice grain width and weight
|-
|552
|''qSW5''
|[[AB433345_DQ991205]]
|10.1038/ng.169
|
* Deletion in a gene associated with grain size increased yields during rice domestication
|-
|553
|''wx''
|[[Os06g0133000]]
|10.1046/j.1365-313X.1995.7040613.x
|
* Annotated
|-
|554
|''Hd3a''
|[[Os06g0157700]]
|10.1093/pcp/pcf156
|
* Annotated
|-
|555
|''DPL2''
|[[Os06g0184100]]
|10.1073/pnas.1003124107
|
* Rice pollen hybrid incompatibility caused by reciprocal gene loss of duplicated genes
|-
|556
|''S5''
|[[Os06g0213100]]
|10.1073/pnas.0804761105
|
* A triallelic system of S5 is a major regulator of the reproductive barrier and compatibility of indica–japonica hybrids in rice
|-
|557
|''ALK''
|[[Os06g0229800]]
|10.1111/j.1744-7909.2011.01065.x
|
* Annotated
|-
|558
|''Hd1''
|[[Os06g0275000]]
|10.1105/tpc.12.12.2473
|
* Annotated
|-
|559
|''Pi2''
|[[Os06g0286700]]
|10.1094/MPMI-19-1216
|
* Annotated
|-
|560
|''Pi9''
|[[Os06g0286700]]
|10.1534/genetics.105.044891
|
* Annotated
|-
|561
|''Pi25''
|[[Os06g0330100]]
|10.1016/j.jgg.2011.03.010
|
* Annotated
|-
|562
|''Pid3''
|[[Os06g0330100]]
|10.1534/genetics.109.102871
|
* Annotated
|-
|563
|''Pi-d2''
|[[Os06g0494100]]
|10.1111/j.1365-313X.2006.02739.x
|
* Annotated
|-
|564
|''Xa27''
|[[Os06g0598900]]
|10.1038/nature03630
|
* R gene expression induced by a type-III effector triggers disease resistance in rice
|-
|566
|''PROG1''
|[[Os07g0153600]]
|10.1038/ng.197
|
* Control of a key transition from prostrate to erect growth in rice domestication
|-
|567
|''Rc''
|[[Os07g0211500]]
|10.1105/tpc.105.038430
|
* Caught Red-Handed: Rc Encodes a Basic Helix-Loop-Helix Protein Conditioning Red Pericarp in Rice
|-
|569
|''OsHMA3''
|[[Os07g0232900]]
|10.1073/pnas.1005396107
|
* Annotated
|-
|571
|''Ghd7''
|[[Os07g0261200]]
|10.1038/ng.143
|
* Annotated
|-
|572
|''Sdr4''
|[[Os07g0585700]]
|10.1073/pnas.0911965107
|
* Annotated
|-
|573
|''Pi36''
|[[Os08g0150100]]
|10.1534/genetics.107.075465
|
* The in Silico Map-Based Cloning of Pi36, a Rice Coiled-Coil–Nucleotide-Binding Site–Leucine-Rich Repeat Gene That Confers Race-Specific Resistance to the Blast Fungus
|-
|574
|''DTH8''
|[[Os08g0174500]]
|10.1104/pp.110.156943
|
* Annotated
|-
|578
|''Badh2''
|[[Os08g0424500]]
|10.1105/tpc.108.058917
|
* Annotated
|-
|579
|''WFP''
|[[Os08g0509600]]
|10.1038/ng.592
|
* Annotated
|-
|580
|''IPA1''
|[[Os08g0509600]]
|10.1038/ng.591
|
* Annotated
|-
|581
|''xa13''
|[[Os08g0535200]]
|10.1101/gad.1416306
|
* Annotated
|-
|582
|''Sub1A''
|[[AAZ06207]]
|10.1038/nature04920
|
* Sub1A is an ethylene-response-factor-like gene that confers submergence tolerance to rice
|-
|584
|''DEP1''
|[[Os09g0441900]]
|10.1038/ng.352
|
* Annotated
|-
|585
|''TAC1''
|[[Os09g0529300]]
|10.1111/j.1365-313X.2007.03284.x
|
* Annotated
|-
|586
|''CPDphotolyase''
|[[Os10g0167600]]
|10.1093/pcp/pch215
|
* Annotated
|-
|588
|''Ehd1''
|[[Os10g0463400]]
|10.1101/gad.1189604
|
* Ehd1, a B-type response regulator in rice, confers short-day promotion of flowering and controls FT-like gene expression independently of Hd1
|-
|589
|''RF1A''
|[[Os10g0497300]]
|10.1105/tpc.105.038240
|
* Annotated
|-
|591
|''Rf-1''
|[[Os10g0497432]]
|10.1046/j.1365-313X.2003.01961.x
|
* Map-based cloning of a fertility restorer gene, Rf-1, in rice (Oryza sativa L.)
|-
|592
|''RF1B''
|[[Os10g0499500]]
|10.1105/tpc.105.038240
|
* Cytoplasmic Male Sterility of Rice with Boro II Cytoplasm Is Caused by a Cytotoxic Peptide and Is Restored by Two Related PPR Motif Genes via Distinct Modes of mRNA Silencing
|-
|593
|''Pia''
|[[Os11g0225100]]
|10.1111/j.1365-313X.2011.04502.x
|
* Annotated
|-
|594
|''Xa21''
|[[Os11g0559200]]
|10.1126/science.270.5243.1804
|
* Annotated
|-
|595
|''Pb1''
|[[Os11g0598500]]
|10.1111/j.1365-313X.2010.04348.x
|
* Durable panicle blast-resistance gene Pb1 encodes an atypical CC-NBS-LRR protein and was generated by acquiring a promoter through local genome duplication
|-
|596
|''Pik1''
|[[Os11g0687800]]
|10.1111/j.1469-8137.2010.03462.x
|
* The isolation and characterization of Pik, a rice blast resistance gene which emerged after rice domestication
|-
|597
|''Pik2''
|[[Os11g0687900]]
|10.1111/j.1469-8137.2010.03462.x
|
* The isolation and characterization of Pik, a rice blast resistance gene which emerged after rice domestication
|-
|599
|''Pik-p''
|[[Os11g0689100]]
|10.1007/s00122-010-1506-3
|
* The Pik-p resistance to Magnaporthe oryzae in rice is mediated by a pair of closely linked CC-NBS-LRR genes
|-
|600
|''Xa3''
|[[Os11g0692300]]
|10.1007/s00122-006-0388-x
|
* Annotated
|-
|601
|''Xa26''
|[[Os11g0692300]]
|10.1046/j.1365-313X.2003.01976.x
| Xa26, a gene conferring resistance to Xanthomonas oryzae pv. oryzae in rice, encodes an LRR receptor kinase-like protein
|
|-
|602
|''Pi-ta''
|[[Os12g0281300]]
|10.1105/tpc.12.11.2033
| A Single Amino Acid Difference Distinguishes Resistant and Susceptible Alleles of the Rice Blast Resistance Gene Pi-ta
|
|-
|606
|''OsCOIN''
|[[Os01g0104100]]
|10.1007/s00425-007-0548-5
|
|Finished
|-
|607
|''OsIRL''
|[[Os01g0106400]]
|10.1111/j.1399-3054.2009.01290.x
|
|Finished
|-
|609
|''OsDREB2A''
|[[Os01g0165000]]
|10.1007/s10529-011-0620-x
|
|Finished
|-
|610
|''OsIAA1''
|[[Os01g0178500]]
|10.1007/s11103-009-9474-1
|
|Annotated
|-
|611
|''OsCDR1''
|[[Os01g0178600]]
|10.1094/MPMI-22-12-1635
|
|Finished
|-
|613
|''NH1''
|[[Os01g0194300]]
|10.1094/MPMI-18-0511
|
|Annotated
|-
|614
|''OsRAA1''
|[[Os01g0257300]]
|10.1104/pp.104.041996
|
|Annotated
|-
|615
|''CYP734A6''
|[[Os01g0388000]]
|10.1111/j.1365-313X.2011.04567.x
|
|Finished
|-
|616
|''OsWRKY11''
|[[Os01g0626400]]
|10.1007/s00299-008-0614-x
|
|Annotated
|-
|617-1
|''SLRL1''
|[[Os01g0646300]]
|10.1111/j.1365-313X.2005.02562.x
|
|Finished
|-
|617-2
|''SLRL2''
|[[Os05g0574900]]
|10.1111/j.1365-313X.2005.02562.x
|
|Finished
|-
|618
|''RACK1A''
|[[Os01g0686800]]
|10.1105/tpc.107.054395
|
|Annotated
|-
|619
|''OsWRKY13''
|[[Os01g0750100]]
|10.1094/MPMI-20-5-0492
|
|Finished
|-
|620
|''OsKAT1''
|[[Os01g0756700]]
|10.1104/pp.107.101154
|
|Annotated
|-
|621
|''OsCIPK12''
|[[Os01g0759400]]
|10.1104/pp.107.101295
|
|Annotated
|-
|623
|''GH3-2''
|[[Os01g0764800]]
|10.1104/pp.110.163774
|
|Annotated
|-
|624
|''OsGH3.1''
|[[Os01g0785400]]
|10.1094/MPMI-22-2-0201
|
|Finished
|-
|626
|''AP37''
|[[Os01g0797600]]
|10.1104/pp.109.137554
|
|Finished
|-
|627
|''ZFP179''
|[[Os01g0839100]]
|10.1093/jxb/erq120
|
|Annotated
|-
|628
|''OsMYB3R-2''
|[[Os01g0841500]]
|10.1104/pp.108.133454
|
|Finished
|-
|630
|''SAPK4''
|[[Os01g0869900]]
|10.1186/1471-2229-8-49
|
|Finished
|-
|631
|''SNAC2''
|[[Os01g0884300]]
|10.1007/s11103-008-9309-5
|
|Finished
|-
|633
|''OsDREB1F''
|[[Os01g0968800]]
|10.1007/s11103-008-9340-6
|
|Annotated
|-
|635
|''BiP''
|[[Os02g0115900]]
|10.1093/pcp/pcp098
|
|Finished
|-
|636
|''BiP3''
|[[Os02g0115900]]
|10.1371/journal.pone.0009262
|
|Finished
|-
|637
|''OsRacB''
|[[Os02g0120800]]
|10.1016/j.plaphy.2005.12.001
|
|Finished
|-
|638
|''OsCYP2''
|[[Os02g0121300]]
|10.1186/1471-2229-11-34
|
|Finished
|-
|639
|''OsMAPK33''
|[[Os02g0148100]]
|10.1007/s12038-011-9002-8
|
|Annotated
|-
|641
|''OsWRKY71''
|[[Os02g0181300]]
|10.1016/j.jplph.2006.07.006
|
|Finished
|-
|642
|''OsAGAP''
|[[Os02g0198300]]
|10.1111/j.1365-313X.2006.02898.x
|
|Annotated
|-
|645
|''RCN2''
|[[Os02g0531600]]
|10.1046/j.1365-313X.2002.01255.x
|
|Annotated
|-
|647
|''OsTPP1''
|[[Os02g0661100]]
|10.1007/s00425-008-0729-x
|
|Annotated
|-
|648
|''MAIF1''
|[[Os02g0671100]]
|10.1093/mp/ssq066
|
|Finished
|-
|649
|''SBPase''
|[[Os02g0698000]]
|10.1007/s00299-006-0299-y
|
|Finished
|-
|650
|''OsFAD2''
|[[Os02g0716500]]
|10.1007/s11032-011-9587-5
|
|Finished
|-
|651
|''OsHAP3E''
|[[Os02g0725700]]
|10.1016/j.plantsci.2011.04.009
|
|Finished
|-
|652
|''OsSKIPa''
|[[Os02g0759800]]
|10.1073/pnas.0901940106
|
|Finished
|-
|653
|''Orysa;KRP1''
|[[Os02g0762400]]
|10.1104/pp.106.087056
|
|Finished
|-
|654
|''mtHsp70''
|[[Os02g0774300]]
|10.1016/j.febslet.2010.11.051
|
|Finished
|-
|657
|''RWC3''
|[[Os02g0823100]]
|10.1093/pcp/pch058
|
|Finished
|-
|658
|''CDPK13''
|[[Os03g0128700]]
|10.1007/s00438-007-0220-6
|
|Annotated
|-
|659
|''OsCDPK13''
|[[Os03g0128700]]
|10.1007/s11103-004-1178-y
|
|Annotated
|-
|661
|''OsTIFY11a''
|[[Os03g0180800]]
|10.1007/s11103-009-9524-8
|
|Annotated
|-
|662
|''GS1;2''
|[[Os03g0223400]]
|10.1007/s00299-008-0665-z
|
|Annotated
|-
|666
|''sHSP17.7''
|[[Os03g0267200]]
|10.1007/s00299-007-0470-0
|
|Annotated
|-
|667
|''OsSDIR1''
|[[Os03g0272300]]
|10.1007/s11103-011-9775-z
|
|Annotated
|-
|668
|''OsAPXa''
|[[Os03g0285700]]
|10.1007/s00299-010-0985-7
|
|Finished
|-
|669
|''OsCIPK03''
|[[Os03g0319400]]
|10.1104/pp.107.101295
|
|Annotated
|-
|671
|''OsIPT2''
|[[Os03g0356900]]
|10.1104/pp.106.085811
|
|Annotated
|-
|674
|''OSH1''
|[[Os03g0727000]]
|10.1105/tpc.5.9.1039
|
|Finished
|-
|675
|''OsbHLH148''
|[[Os03g0741100]]
|10.1111/j.1365-313X.2010.04477.x
|
|Annotated
|-
|676
|''OSH43''
|[[Os03g0771500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|677
|''OsIPT4''
|[[Os03g0810100]]
|10.1104/pp.106.085811
|
|Finished
|-
|678
|''SNAC1''
|[[Os03g0815100]]
|10.1073/pnas.0604882103
|
|Annotated
|-
|680
|''ZFP182''
|[[Os03g0820300]]
|10.1016/j.bbaexp.2007.02.006
|
|Annotated
|-
|685
|''OsOxi1''
|[[Os04g0488700]]
|10.1093/pcp/pcq132
|
|Annotated
|-
|686
|''OsRDCP1''
|[[Os04g0530500]]
|10.1016/j.plantsci.2011.02.008
|
|Annotated
|-
|687
|''OsDREB1E''
|[[Os04g0572400]]
|10.1007/s10529-008-9811-5
|
|Finished
|-
|688
|''OsCDPK7''
|[[Os04g0584600]]
|10.1046/j.1365-313x.2000.00787.x
|
|Annotated
|-
|689
|''OsAP2-39''
|[[Os04g0610400]]
|10.1371/journal.pone.0025216
|
|Finished
|-
|690
|''ostgap1''
|[[Os04g0637000]]
|10.1074/jbc.M109.036871
|
|Finished
|-
|691
|''GS2''
|[[Os04g0659100]]
|10.1023/A:1006408712416
|
|Finished
|-
|692
|''OsRR6''
|[[Os04g0673300]]
|10.1093/pcp/pcm022
|
|Finished
|-
|694
|''OSH71''
|[[Os05g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|695
|''OsLti6b''
|[[Os05g0138300]]
|10.1007/s00299-006-0297-0
|
|Annotated
|-
|696
|''OsPYL/RCAR5''
|[[Os05g0213500]]
|10.1093/jxb/err338
|
|Annotated
|-
|698
|''OsWRKY53''
|[[Os05g0343400]]
|10.1016/j.bbaexp.2007.04.006
|
|Finished
|-
|699
|''OsDREB2B''
|[[Os05g0346200]]
|10.1007/s10529-008-9811-5
|
|Finished
|-
|700
|''DEPG1''
|[[Os05g0365300]]
|10.1007/s11033-011-1122-6
|Over-expression in the nucleotide-binding site-leucine rich repeat gene DEPG1 increases susceptibility to bacterial leaf streak disease in transgenic rice plants
|Susceptibility to Biotic Stress
|-
|701
|''Gns1''
|[[Os05g0375400]]
|10.1023/A:1020714426540
|Characterization of transgenic rice plants over-expressing the stress-inducible beta-glucanase gene Gns1
|
|-
|702
|''OsISA2''
|[[Os05g0393700]]
|10.1104/pp.111.173435
|Functional diversity of isoamylase oligomers: the ISA1 homo-oligomer is essential for amylopectin biosynthesis in rice endosperm
|
|-
|703
|''OsTPS1''
|[[Os05g0518600]]
|10.1007/s00425-011-1458-0
|Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice
|Abiotic stress
|-
|704
|''OsLEA3-1''
|[[Os05g0542500]]
|10.1007/s00122-007-0538-9
|
|Annotated
|-
|705-1
|''OsIPT7''
|[[Os05g0551700]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-2
|''OsIPT5''
|[[Os07g0211700]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-3
|''OsIPT4''
|[[Os03g0810100]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-4
|''OsIPT2''
|[[Os03g0356900]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-5
|''OsIPT8''
|[[Os01g0688300]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-6
|''OsIPT10''
|[[Os06g0729800]]
|10.1104/pp.106.085811
|
|Finished
|-
|706
|''OsRAN2''
|[[Os05g0574500]]
|10.1111/j.1365-3040.2010.02225.x
|
|Annotated
|-
|707
|''OsHDT1''
|[[Os05g0597100]]
|10.1371/journal.pone.0021789
|
|Annotated
|-
|708
|''OsDREB1C''
|[[Os06g0127100]]
|10.1093/pcp/pci230
|
|Annotated
|-
|709
|''OsENOD93-1''
|[[Os06g0142350]]
|10.1111/j.1365-3040.2009.02032.x
|
|Annotated
|-
|710
|''OsPTF1''
|[[Os06g0193400]]
|10.1104/pp.105.063115
|
|Annotated
|-
|711
|''bu1''
|[[Os06g0226500]]
|10.1104/pp.109.140806
|
|Finished
|-
|712
|''HOX1a''
|[[Os06g0229300]]
|10.1111/j.1744-7909.2011.01075.x
|
|Finished
|-
|713
|''OsGLK1''
|[[Os06g0348800]]
|10.1093/pcp/pcp138
|
|Annotated
|-
|714-1
|''OsHDAC1''
|[[Os06g0583400]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|714-2
|''OsHDAC2''
|[[Os02g0215200]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|714-3
|''OsHDAC3''
|[[Os02g0214900]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|715
|''CYP734A4''
|[[Os06g0600400]]
|10.1111/j.1365-313X.2011.04567.x
|
|Finished
|-
|716
|''OsSPX1''
|[[Os06g0603600]]
|10.1111/j.1365-313X.2008.03734.x
|
|Finished
|-
|717
|''OsiSAP8''
|[[Os06g0612800]]
|10.1007/s11103-007-9284-2
|
|Finished
|-
|718
|''OVP1''
|[[Os06g0644200]]
|10.1016/j.plaphy.2010.09.014
|
|Finished
|-
|721
|''YK1''
|[[Os06g0651100]]
|10.1023/A:1019275218830
|
|Finished
|-
|722
|''OsPIN2''
|[[Os06g0660200]]
|10.1111/j.1467-7652.2011.00637.x
|
|Finished
|-
|723-1
|''OSH1''
|[[Os03g0727000]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-2
|''OSH15''
|[[Os07g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-3
|''OSH43''
|[[Os03g0771500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-4
|''OSH6''
|[[Os01g0302500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-5
|''OSH71''
|[[Os05g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|725
|''OsNek3''
|[[Os07g0176600]]
|10.1093/pcp/pcp026
|
|Finished
|-
|726
|''OsNRAMP1''
|[[Os07g0258400]]
|10.1093/jxb/err136
|
|Finished
|-
|727
|''OsPHR2''
|[[Os07g0438800]]
|10.1104/pp.107.111443
|
|Finished
|-
|728
|''CrtintP1''
|[[Os07g0498800]]
|10.1007/s00438-007-0220-6
|
|Finished
|-
|729
|''GH3-8''
|[[Os07g0592600]]
|10.1105/tpc.107.055657
|
|Finished
|-
|730
|''OsMADS18''
|[[Os07g0605200]]
|10.1104/pp.104.045039
|
|Finished
|-
|731
|''OsNHX1''
|[[Os07g0666900]]
|10.1093/pcp/pch014
|
|Finished
|-
|733
|''OsGAPC3''
|[[Os08g0126300]]
|10.1007/s11240-011-9950-6
|
|Finished
|-
|735
|''OsDOG''
|[[Os08g0504700]]
|10.1016/j.jplph.2010.12.013
|
|Finished
|-
|737
|''OsCPK21''
|[[Os08g0540400]]
|10.1007/s11103-010-9717-1
|
|Finished
|-
|740
|''OsCO3''
|[[Os09g0240200]]
|10.1007/s00425-008-0742-0
|
|Finished
|-
|741
|''OsWRKY76''
|[[Os09g0417600]]
|10.1007/s12284-010-9039-6
|
|Finished
|-
|743
|''OsbZIP72''
|[[Os09g0456200]]
|10.1007/s00425-008-0857-3
|
|Finished
|-
|744
|''OsEATB''
|[[Os09g0457900]]
|10.1104/pp.111.179945
|
|Finished
|-
|745
|''Oshox4''
|[[Os09g0470500]]
|10.1007/s11103-007-9270-8
|
|Finished
|-
|746
|''OsTFX1''
|[[Os09g0474000]]
|10.1073/pnas.0701742104
|
|Finished
|-
|747
|''RF2a''
|[[Os09g0516200]]
|10.1073/pnas.0810303105
|
|Finished
|-
|748
|''OsDREB1B''
|[[Os09g0522000]]
|10.1093/pcp/pci230
|
|Finished
|-
|749
|''OsDREB1A''
|[[Os09g0522200]]
|10.1093/pcp/pci230
|
|Finished
|-
|750
|''OsPIP2;7''
|[[Os09g0541000]]
|10.1093/pcp/pcn166
|
|Finished
|-
|751
|''SAUR39''
|[[Os09g0545300]]
|10.1104/pp.109.143875
|
|Finished
|-
|753-1
|''OsSPX1''
|[[Os06g0603600]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753-2
|''OsSPX2''
|[[Os02g0202200]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX3''
|[[Os10g0392600]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX4''
|[[Os03g0827500]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX5''
|[[Os03g0406100]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX6''
|[[Os07g0614700]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|754
|''OsiICK6''
|[[Os10g0471700]]
|10.1093/aob/mcr057
|
|Finished
|-
|755
|''OsMADS56''
|[[Os10g0536100]]
|10.1111/j.1365-3040.2009.02008.x
|
|Finished
|-
|756
|''MYBS3''
|[[Os10g0561400]]
|10.1104/pp.110.153015
|
|Annotated
|-
|757
|''OsMSRA4.1''
|[[Os10g0563600]]
|10.1007/s00425-009-0934-2
|
|Annotated
|-
|758
|''Rir1b''
|[[Os10g0569400]]
|10.1023/A:1006423232753
|
|Finished
|-
|759
|''WOX3''
|[[Os11g0102100]]
|10.1104/pp.107.095737
|
|Annotated
|-
|760
|''OsCIPK15''
|[[Os11g0113700]]
|10.1104/pp.107.101295
|
|Finished
|-
|761
|''OsNAC10''
|[[Os11g0126900]]
|10.1104/pp.110.154773
|
|Finished
|-
|762
|''ONAC045''
|[[Os11g0127600]]
|10.1016/j.bbrc.2008.12.163
|
|Finished
|-
|763
|''RCN1''
|[[Os11g0152500]]
|10.1046/j.1365-313X.2002.01255.x
|
|Annotated
|-
|764
|''OsAsr1''
|[[Os11g0167800]]
|10.1007/s10059-009-0055-6
|
|Annotated
|-
|765-1
|''OsPR4a''
|[[Os11g0592200]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-2
|''OsPR4b''
|[[Os11g0592100]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-3
|''OsPR4c''
|[[Os11g0592000]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-4
|''OsPR4d''
|[[Os11g0591800]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-5
|''OsPR4e''
|[[Os11g0592200]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|766
|''OsMT1a''
|[[Os11g0704500]]
|10.1007/s11103-009-9466-1
|
|Finished
|-
|767
|''OsWAK1''
|[[Os11g0690066]]
|10.1007/s11103-008-9430-5
|
|Annotated
|-
|768
|''ZFP252''
|[[Os12g0583700]]
|10.1016/j.febslet.2008.02.052
|
|Finished
|-
|769
|''OsPID''
|[[Os12g0614600]]
|10.1093/pcp/pcm024
|
|Finished
|-
|771
|''OsTLP27''
|[[Os01g0102300]]
|10.1016/j.plantsci.2012.06.006
|
|Finished
|-
|772
|''OsHsp17.0''
|[[Os01g0136200]]
|10.1016/j.jplph.2011.12.014
|
|Finished
|-
|775
|''OsMKK6''
|[[Os01g0510100]]
|10.1016/j.jplph.2011.11.012
|
|Finished
|-
|776
|''OsRDR6''
|[[Os01g0527600]]
|10.1111/j.1365-313X.2012.05001.x
|
|Finished
|-
|777
|''RAD51C''
|[[Os01g0578000]]
|10.1093/jxb/ers190
|
|Finished
|-
|779
|''CFO1''
|[[Os01g0726400]]
|10.1104/pp.112.200980
|
|Finished
|-
|780
|''OsPAP10a''
|[[Os01g0776600]]
|10.1111/j.1744-7909.2012.01143.x
|
|Finished
|-
|782
|''OsCOI1''
|[[Os01g0853400]]
|10.1371/journal.pone.0036214
|
|Finished
|-
|783
|''OsMGT1''
|[[Os01g0869200]]
|10.1104/pp.112.199778
|
|Finished
|-
|784
|''PsbS''
|[[Os01g0869800]]
|10.1111/j.1365-313X.2012.04995.x
|
|Finished
|-
|785
|''OsHPL3''
|[[Os02g0110200]]
|10.1111/j.1365-313X.2012.05027.x
|
|Finished
|-
|786
|''MADS29''
|[[Os02g0170300]]
|10.1105/tpc.111.094854
|
|Finished
|-
|787
|''MTR1''
|[[Os02g0491300]]
|10.1016/j.devcel.2012.04.011
|
|Finished
|-
|788
|''cry1a''
|[[Os02g0573200]]
|10.1093/pcp/pcs097
|
|Finished
|-
|788-2
|''cry1b''
|[[Os04g0452100]]
|10.1093/pcp/pcs097
|
|Finished
|-
|789
|''OsABC1-2''
|[[Os02g0575500]]
|10.1016/j.gene.2012.02.017
|
|Finished
|-
|791
|''OsHk6''
|[[Os02g0738400]]
|10.1093/pcp/pcs079
|
|Finished
|-
|1227
|''OsHk3''
|[[Os01g0923700]]
|10.1093/pcp/pcs079
|
|Finished
|-
|1228
|''OsHk4''
|[[Os03g0717700]]
|10.1093/pcp/pcs079
|
|Finished
|-
|792
|''D50''
|[[Os02g0477700]]
|10.1111/j.1365-3040.2012.02534.x
|
|Finished
|-
|793
|''th1''
|[[Os02g0811000]]
|10.1007/s11103-011-9868-8
|Annotated
|
|-
|794
|''osdrm2''
|[[Os03g0110800]]
|10.1111/j.1365-313X.2012.04974.x
| Targeted disruption of an orthologue of DOMAINS REARRANGED METHYLASE 2, OsDRM2, impairs the growth of rice plants by abnormal DNA methylation
|
|-
|795
|''te''
|[[Os03g0123300]]
|10.1038/ncomms1716
|
|Finished
|-
|796
|''OsMYB2''
|[[Os03g0315400]]
|10.1093/jxb/err431
|The rice Os03g0315400 was reported as OsMYB2 in 2012 [1] by researchers from China.
|
|-
|797
|''OsCam1-1''
|[[Os03g0319300]]
|10.1007/s12374-011-0154-8
| The rice Os03g0319300 was reported as OsCam1-1 in 2012 [1] by researchers from Thailand.
|
|-
|798
|''OsLEA3-2''
|[[Os03g0322900]]
|10.1371/journal.pone.0045117
| OsLEA3-2, an Abiotic Stress Induced Gene of Rice Plays a Key Role in Salt and Drought Tolerance
|
|-
|800
|''ysa''
|[[Os03g0597200]]
|10.1104/pp.112.195081
|
|Disruption of a Rice Pentatricopeptide Repeat Protein Causes a Seedling-Specific Albino Phenotype and Its Utilization to Enhance Seed Purity in Hybrid Rice Production
|-
|801
|''OsSh1''
|[[Os03g0650000]]
|10.1038/ng.2281
| Parallel domestication of the Shattering1 genes in cereals
|
|-
|802
|''OsSWAP70A''
|[[Os03g0666200]]
|10.1111/j.1365-313X.2011.04874.x
|Annotated
|
|-
|803
|''OsDDM1b''
|[[Os03g0722400]]
|10.1007/s00438-012-0717-5
| DDM1 (Decrease in DNA Methylation) genes in rice (Oryza sativa)
|
|-
|804
|''OsDDM1a''
|[[Os09g0442700]]
|10.1007/s00438-012-0717-5
| DDM1 (Decrease in DNA Methylation) genes in rice (Oryza sativa)
|
|-
|806
|''OsPIL1''
|[[Os03g0782500]]
|10.1073/pnas.1207324109
|Annotated
|
|-
|807
|''gh1''
|[[Os03g0819600]]
|10.1007/s00425-012-1598-x
| A mutation in the rice chalcone isomerase gene causes the golden hull and internode 1 phenotype
|
|-
|808
|''OsPT1''
|[[Os03g0150600]]
|10.1104/pp.112.196345
|A Constitutive Expressed Phosphate Transporter, OsPht1;1, Modulates Phosphate Uptake and Translocation in Phosphate-Replete Rice
|
|-
|810
|''OsVIT1''
|[[Os04g0463400]]
|10.1111/j.1365-313X.2012.05088.x
| Annotated
|
|-
|811
|''YSL16''
|[[Os04g0542800]]
|10.1105/tpc.112.103820
| Annotated
|
|-
|812
|''cZOGT1''
|[[Os04g0556500]]
|10.1104/pp.112.196733
| Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|-
|813
|''cZOGT2''
|[[Os04g0556600]]
|10.1104/pp.112.196733
|Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|
|-
|1026
|''cZOGT3''
|[[Os04g0565400]]
|10.1104/pp.112.196733
| Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|
|-
|814
|''xiao''
|[[Os04g0576900]]
|10.1111/j.1365-313X.2011.04877.x
|XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassino steroids and cell cycling in rice
|
|-
|815
|''MPR25''
|[[Os04g0602600]]
|10.1111/j.1365-313X.2012.05091.x
| Annotated
|
|-
|816
|''shat1''
|[[Os04g0649100]]
|10.1105/tpc.111.094383
| Genetic Control of Seed Shattering in Rice by the APETALA2 Transcription Factor SHATTERING ABORTION1
|
|-
|817
|''SLAC1''
|[[Os04g0674700]]
|10.1093/jxb/ers216
| Increased leaf photosynthesis caused by elevated stomatal conductance in a rice mutant deficient in SLAC1, a guard cell anion channel protein
|
|-
|819
|''OsMYB2P-1 1''
|[[Os05g0140100]]
|10.1104/pp.112.194217
| OsMYB2P-1, an R2R3 MYB Transcription Factor, Is Involved in the Regulation of Phosphate-Starvation Responses and Root Architecture in Rice
|
|-
|820
|''OsSYP71''
|[[Os05g0553700]]
|10.1016/j.gene.2012.05.011
| Overexpression of the Qc-SNARE gene OsSYP71 enhances tolerance to oxidative stress and resistance to rice blast in rice
|
|-
|821
|''HDT701''
|[[Os05g0597100]]
|10.1105/tpc.112.101972
| HDT701, a Histone H4 Deacetylase, Negatively Regulates Plant Innate Immunity by Modulating Histone H4 Acetylation of Defense-Related Genes in Rice
|
|-
|822
|''OsELF3-1''
|[[Os06g0142600]]
|10.1371/journal.pone.0043705
| Annotated
|
|-
|823
|''Hd17''
|[[Os06g0142600]]
|10.1093/pcp/pcs028
| Natural Variation in Hd17, a Homolog of Arabidopsis ELF3 That is Involved in Rice Photoperiodic Flowering
|-
|825
|''LYP6''
|[[Os06g0208800]]
|10.1105/tpc.112.102475
| Annotated
|
|-
|826
|''OsbZIP46''
|[[Os06g0211200]]
|10.1104/pp.111.190389
| Constitutive Activation of Transcription Factor OsbZIP46 Improves Drought Tolerance in Rice
|
|-
|830
|''RPL1''
|[[Os06g0245600]]
|10.1093/mp/ssr091
| RPL1, a Gene Involved in Epigenetic Processes Regulates Phenotypic Plasticity in Rice
|
|-
|831
|''OsHSBP2''
|[[Os06g0274000]]
|10.1093/jxb/ers245
| Functional analysis of OsHSBP1 and OsHSBP2 revealed
|-
|1027
|''OsHSBP1''
|[[Os09g0375100]]
|10.1093/jxb/ers245
| Functional analysis of OsHSBP1 and OsHSBP2 revealed
|-
|832
|''OsMIOX''
|[[Os06g0561000]]
|10.1016/j.plantsci.2012.08.003
| Annotated
|
|-
|833
|''SE5''
|[[Os06g0603000]]
|10.1007/s11103-012-9945-7
| Annotated
|
|-
|834
|''OsCOM1''
|[[Os06g0613400]]
|10.1111/j.1365-313X.2012.05025.x
| The role of OsCOM1 in homologous chromosome synapsis and recombination in rice meiosis
|
|-
|835
|''OsbZIP52/RISBZ5''
|[[Os06g0662200]]
|10.1007/s00425-011-1564-z
| Annotated
|
|-
|836
|''SRL1''
|[[Os07g0102300]]
|10.1104/pp.112.199968
| Annotated
|
|-
|837
|''MADS15''
|[[Os07g0108900]]
|10.1105/tpc.112.097105
| Annotated
|
|-
|840
|''OsSWAP70B''
|[[Os07g0138100]]
|10.1111/j.1365-313X.2011.04874.x
| SWAP70 functions as a Rac/Rop guanine nucleotide-exchange factor in rice
|
|-
|841
|''spl5''
|[[Os07g0203700]]
|10.1007/s11032-011-9677-4
| SPL5, a cell death and defense-related gene, encodes a putative splicing factor 3b subunit 3 (SF3b3) in rice
|
|-
|842
|''Nramp5''
|[[Os07g0257200]]
|10.1105/tpc.112.096925
| Annotated
|
|-
|843
|''OsCHR4''
|[[Os07g0497000]]
|10.1007/s00425-012-1667-1
| Molecular cloning and characterization of OsCHR4, a rice chromatin-remodeling factor required for early chloroplast development in adaxial mesophyll
|
|-
|844
|''chr729''
|[[Os07g0497100]]
|10.1073/pnas.1203148109
| CHD3 protein recognizes and regulates methylated histone H3 lysines 4 and 27 over a subset of targets in the rice genome
|
|-
|845
|''OSRIP18''
|[[Os07g0556800]]
|10.1007/s11248-011-9568-9
| Annotated
|
|-
|846
|''ObgC''
|[[Os07g0669200]]
|10.1111/j.1365-313X.2012.04976.x
| Functional characterization of ObgC in ribosome biogenesis during chloroplast development
|
|-
|847
|''cslf6''
|[[Os08g0160500]]
|10.1104/pp.112.195495
| Loss of Cellulose Synthase-Like F6 Function Affects Mixed-Linkage Glucan Deposition, Cell Wall Mechanical Properties, and Defense Responses in Vegetative Tissues of Rice
|
|-
|848
|''OsLIS-L1''
|[[Os08g0162100]]
|10.1007/s00425-011-1532-7
| Annotated
|
|-
|851
|''WRKY30''
|[[Os08g0499300]]
|10.1007/s00425-012-1668-0
| Annotated
|
|-
|852
|''Orysa;CDKB2;1''
|[[Os08g0512600]]
|10.1111/j.1365-313X.2011.04847.x
| CDKB2 is involved in mitosis and DNA damage response in rice
|
|-
|853
|''qGW8''
|[[Os08g0531600]]
|10.1038/ng.2327
| Annotated
|
|-
|854
|''SDG724''
|[[Os09g0307800]]
|10.1105/tpc.112.101436
| Annotated
|
|-
|856
|''OsVIT2''
|[[Os09g0396900]]
|10.1111/j.1365-313X.2012.05088.x
| Annotated
|
|-
|857
|''OsDDM1a''
|[[Os09g0442700]]
|10.1007/s00438-012-0717-5
| Annotated
|
|-
|858
|''LYP4''
|[[Os09g0452200]]
|10.1105/tpc.112.102475
| Annotated
|
|-
|859
|''BC15/OsCTL1''
|[[Os09g0494200]]
|10.1104/pp.112.195529
|Annotated
|
|-
|860
|''LGD1''
|[[Os09g0502100]]
|10.1111/j.1365-313X.2012.04989.x
|Annotated
|
|-
|861
|''BSR1''
|[[Os09g0533600]]
|10.1111/j.1467-7652.2010.00568.x
|Screening for resistance against Pseudomonas syringae in rice-FOX Arabidopsis lines identified a putative receptor-like cytoplasmic kinase gene that confers resistance to major bacterial and fungal pathogens in Arabidopsis and rice.
|Resistance
|-
|862
|''OsLDC-like 1''
|[[Os09g0547500]]
|10.1007/s10059-012-0067-5
|Increased Polyamine Biosynthesis Enhances Stress Tolerance by Preventing the Accumulation of Reactive Oxygen Species: T-DNA Mutational Analysis of Oryza sativa Lysine Decarboxylase-like Protein 1
|
|-
|863
|''OsDEES1''
|[[Os09g0561600]]
|10.1104/pp.112.203943
|Annotated
|
|-
|864
|''OsFbx352''
|[[Os10g0127900]]
|10.1093/jxb/ers206
|Annotated
|
|-
|865
|''rl14''
|[[Os10g0558900]]
|10.1111/j.1467-7652.2012.00679.x
|Annotated
|
|-
|866
|''ospk1''
|[[Os11g0148500]]
|10.1007/s11105-011-0386-2
| Downregulation of OsPK1 Contributes to Oxidative Stress and the Variations in ABA/GA Balance in Rice
|
|-
|867
|''MIL2''
|[[Os12g0152500]]
|10.1111/j.1469-8137.2012.04270.x
| MIL2 (MICROSPORELESS2) regulates early cell differentiation in the rice anther
|
|-
|868
|''PSTOL1''
|[[BAK26566]]
|10.1038/nature11346
|
|-
|869
|''p/tms12-1''
|[[smRNA615912]]
|10.1038/cr.2012.28
|
|-
|870
|''OsHsp23.7''
|[[Os12g0569700]]
|10.1016/j.jplph.2011.12.014
| Annotated
|
|-
|871
|''Amy1A''
|[[Os02g0765600]]
|10.1111/j.1467-7652.2012.00741.x
| Annotated
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|872
|''Amy2A''
|[[Os06g0713800]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|873
|''Amy3A''
|[[Os09g0457400]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|874
|''Amy3B''
|[[Os09g0457600]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1236
|''Amy3C''
|[[Os09g0457800]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1237
|''Amy3D''
|[[Os08g0473900]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1238
|''Amy3E''
|[[Os08g0473600]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|875
|''ylc1''
|[[Os09g0380200]]
|10.1007/s00425-012-1756-1
| Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lu
|
|-
|878
|''OsIAGLU''
|[[Os03g0693600]]
|10.1007/s12374-012-0238-0
| Tiller Formation in Rice is Altered by Overexpression of OsIAGLU Gene Encoding an IAA-conjugating Enzyme or Exogenous Treatment of Free IAA
|
|-
|879
|''OsOAT''
|[[Os03g0643300]]
|10.1016/j.plantsci.2012.09.002
| Annotated
|
|-
|1230
|''OsAPS1''
|[[Os09g0298200]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1231
|''OsAPS2''
|[[Os08g0345800]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1232
|''OsAGPL1''
|[[Os03g0735000]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1234
|''OsAPL3''
|[[Os05g0580000]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1235
|''OsAPL4''
|[[Os07g0243200]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|881
|''OsGH3-2''
|[[Os01g0764800]]
|10.1093/jxb/ers300
| Annotated
|
|-
|882
|''OsDMI3''
|[[Os05g0489900]]
|10.1093/mp/sss068
|
|Annotated
|-
|883
|''Psi?LDMAR''
|[[Os12g0545900]]
|10.1093/mp/sss095
| Annotated
|
|-
|884
|''OsJAZ8''
|[[Os09g0439200]]
|10.1093/pcp/pcs145
| Annotated
|
|-
|885
|''Osj10gBTF3''
|[[Os10g0483000]]
|10.1093/pcp/pcs146
| Inhibition of a Basal Transcription Factor 3-Like Gene Osj10gBTF3 in Rice Results in Significant Plant Miniaturization and Typical Pollen Abortion
|
|-
|886
|''LPA1''
|[[Os03g0237250]]
|10.1104/pp.112.208496
| Annotated
|
|-
|887
|''PT11''
|[[Os01g0657100]]
|10.1105/tpc.112.104901
| Nonredundant Regulation of Rice Arbuscular Mycorrhizal Symbiosis by Two Members of the PHOSPHATE TRANSPORTER1 Gene Family
|
|-
|888
|''PT13''
|[[ Os04g0186800]]
|10.1105/tpc.112.104901
| Nonredundant Regulation of Rice Arbuscular Mycorrhizal Symbiosis by Two Members of the PHOSPHATE TRANSPORTER1 Gene Family
|
|-
|889
|''OsMYB55''
|[[Os05g0553400]]
|10.1371/journal.pone.0052030
| Annotated
|
|-
|890
|''DDF1''
|[[Os06g0138700]]
|10.1111/j.1365-313X.2012.05126.x
|Dwarf and deformed flower 1, encoding an F‐box protein, is critical for vegetative and floral development in rice (Oryza sativa L.)
|
|-
|891
|''OsPIN3t''
|[[Os01g0643300]]
|10.1111/j.1365-313X.2012.05121.x
| Annotated
|
|-
|892
|''OsbHLH133''
|[[Os12g0508500]]
|10.1111/j.1365-3040.2012.02569.x
| Identification of OsbHLH133 as a regulator of iron distribution between roots and shoots in Oryza sativa
|
|-
|893
|''PGR5''
|[[Os08g0566600]]
|10.1093/pcp/pcs153
| PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice
|
|-
|894
|''OsNRT2.3a''
|[[Os01g0704100]]
|10.1104/pp.112.204461
| Annotated
|
|-
|895
|''bls1''
|[[Os02g0811000]]
|10.1007/s11105-012-0480-0
| BEAK LIKE SPIKELET1 is Required for Lateral Development of Lemma and Palea in Ri
|
|-
|896
|''UIP1''
|[[Os02g0818000]]
|10.1007/s11816-012-0239-y
| Transgenic overexpression of UIP1, an interactor of the 3 0 untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought
|
|-
|897
|''OrbHLH001''
|[[Os01g0928000]]
|10.1016/j.jplph.2012.08.019
| Annotated
|
|-
|898
|''CSA''
|[[Os01g0274800]]
|10.1073/pnas.1213041110
|Annotated
|
|-
|899
|''qGL3''
|[[Os03g0646900]]
|10.1073/pnas.1219776110
|Annotated
|
|-
|900
|''OsPPKL2''
|[[Os05g0144400]]
|10.1073/pnas.1219776110
| Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice
|
|-
|901
|''OsPPKL3''
|[[Os12g0617900]]
|10.1073/pnas.1219776110
| Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice
|
|-
|902
|''OsSRO1c''
|[[Os03g0230300]]
|10.1093/jxb/ers349
|
* Annotated
|-
|903
|''OsGT1''
|[[Os01g0262600]]
|10.1104/pp.112.210948
|
* Annotated
|-
|904
|''FIE1''
|[[Os08g0137250]]
|10.1105/tpc.112.102269
|
* Annotated
|-
|905
|''APIP6''
|[[Os05g0154600]]
|10.1105/tpc.112.105429
| The Magnaporthe oryzae Effector AvrPiz-t Targets the RING E3 Ubiquitin Ligase APIP6 to Suppress Pathogen Associated Molecular Pattern–Triggered Immunity in Rice
|
|-
|906
|''BRK1''
|[[Os07g0508500]]
|10.1105/tpc.112.105874
| BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis
|
|-
|907
|''OsARG''
|[[Os04g0106300]]
|10.1111/j.1365-313x.2012.05122.x
|
* Annotated
|-
|908
|''DEC''
|[[Os12g0465700]]
|10.1111/j.1365-313x.2012.05123.x
| Rice DECUSSATE controls phyllotaxy by affecting the cytokinin signaling pathway
|
|-
|909
|''OsIDD10''
|[[Os04g0566400]]
|10.1111/nph.12075
| Regulatory role of indeterminate domain 10 (IDD10) in ammonium-dependent gene expression in rice roots
|
|-
|910
|''OsARF16''
|[[Os06g0196700]]
|10.1111/pce.12001
|
* Annotated
|-
|911
|''OsMADS29''
|[[Os02g0170300]]
|10.1371/journal.pone.0051435
|
|Annotated
|-
|912
|''OsPDCD5''
|[[Os05g0547850]]
|10.1007/s11032-012-9793-9
|
|Annotated
|-
|913
|''OsCDPK1''
|[[Os03g0128700]]
|10.1007/s11103-012-0006-z
|
|Annotated
|-
|914
|''PDA1''
|[[Os06g0607700]]
|10.1007/s12374-013-0902-z
|
|Annotated
|-
|915
|''JMJ703''
|[[Os05g0196500]]
|10.1073/pnas.1217020110
|
|Annotated
|-
|916
|''OsVIL2''
|[[Os02g0152500]]
|10.1111/tpj.12057
| OsVIL2 functions with PRC2 to induce flowering by repressing OsLFL1 in rice
|
|-
|917
|''AIP1''
|[[Os01g0125800]]
|10.1111/tpj.12065
| Oryza sativa actin-interacting protein 1 is required for rice growth by promoting actin turnover
|
|-
|918
|''Xb25''
|[[Os09g0513000]]
|10.1111/tpj.12076
| The XA21 binding protein XB25 is required for maintaining XA21-mediated disease resistance
|
|-
|919
|''DTH2''
|[[Os02g0724000]]
|10.1073/pnas.1213962110
|
|Annotated
|-
|920
|''reg1''
|[[Os03g0786400]]
|10.1073/pnas.1300359110
|
|Annotated
|-
|924
|''fgl''
|[[Os10g0496900]]
|10.1111/tpj.12110
|
|Annotated
|-
|925
|''Ehd4''
|[[Os03g0112700]]
|10.1371/journal.pgen.1003281
|
|Annotated
|-
|926
|''GnTI''
|[[Os02g0833000]]
|10.1111/tpj.12087
| N-glycan maturation is crucial for cytokinin-mediated development and cellulose synthesis in Oryza sativa
|
|-
|927
|''OsFH1''
|[[Os01g0897700]]
|10.1007-s00425-013-1838-8
|
|Annotated
|-
|928
|''moc2''
|[[Os01g0866400]]
|10.5511/plantbiotechnology.12.1210a
| Rice monoculm mutation moc2, which inhibits outgrowth of the second tillers, is ascribed to lack of a fructose-1,6-bisphosphatase
|
|-
|929
|''OsHsfA7''
|[[Os01g0571300]]
|10.5483/BMBRep.2013.46.1.090
|
|Annotated
|-
|930
|''OsPIANK1''
|[[Os11g0182500]]
|10.1371/journal.pone.0059699
| Functional Analysis and Expressional Characterization of Rice Ankyrin Repeat-Containing Protein, OsPIANK1, in Basal Defense against Magnaporthe oryzae Attack
|
|-
|931
|''OsFIE2''
|[[Os08g0137100]]
|10.1371/journal.pgen.1003322
|
|Annotated
|-
|933
|''OsORC3''
|[[Os10g0402200]]
|10.1111/tpj.12126
| OsORC3 is required for lateral root development in rice
|
|-
|934
|''OsAOC''
|[[Os03g0438100]]
|10.1111/tpj.12115
| Identification of rice Allene Oxide Cyclase mutants and the function of jasmonate for defence against Magnaporthe oryzae
|
|-
|935
|''OsSNDP1''
|[[Os10g0122600]]
|10.1007-s11103-013-0033-4
| OsSNDP1, a Sec14-nodulin domain-containing protein, plays a critical role in root hair elongation in rice
|
|-
|936
|''OsRP1L1''
|[[Os05g0365300]]
|10.1007-s11105-012-0537-0
|
|Annotated
|-
|937
|''OsVPS22''
|[[Os09g0529700]]
|10.1007/s11033-012-2422-1
| Knockout of the VPS22 component of the ESCRT-II complex in rice (Oryza sativa L.) causes chalky endosperm and early seedling lethality
|
|-
|938
|''OsTZF1''
|[[Os05g0195200]]
|10.1104/pp.112.205385
|
|Annotated
|-
|939
|''OsAt10''
|[[Os06g0594700]]
|10.1104/pp.112.208694
| Overexpression of a BAHD Acyltransferase, OsAt10, Alters Rice Cell Wall Hydroxycinnamic Acid Content and Saccharification
|
|-
|940
|''Cga1''
|[[Os02g0220400]]
|10.1104/pp.113.217265
|
|Annotated
|-
|941
|''nal2''
|[[Os11g0102100]]
|10.1111/nph.12231
| A WUSCHEL-LIKE HOMEOBOX Gene Represses a YABBY Gene Expression Required for Rice Leaf Development
|
|-
|942
|''nal3''
|[[Os12g0101600]]
|10.1111/nph.12231
|
|Annotated
|-
|943
|''OsPTR9''
|[[Os06g0706400]]
|10.1111/pbi.12031
|
|Annotated
|-
|944
|''OsDHAR1''
|[[Os05g0116100]]
|10.1007/s00425-013-1862-8
| Homologous expression of cytosolic dehydroascorbate reductase increases grain yield and biomass under paddy field conditions in transgenic rice
|
|-
|945
|''ASR1''
|[[Os11g0167800]]
|10.1007/s10059-013-0036-7
|
|Annotated
|-
|946
|''ASR3''
|[[Os02g0543000]]
|10.1007/s10059-013-0036-7
| Abiotic Stress Responsive Rice ASR1 and ASR3 Exhibit Different Tissue-Dependent Sugar and Hormone-Sensitivities
|
|-
|947
|''OsDIL1''
|[[Os10g0148000]]
|10.1007/s11103-013-0057-9
|
|Annotated
|-
|948
|''SLL1''
|[[Os04g0379900]]
|10.1016/j.plantsci.2013.01.003
| SLL1, which encodes a member of the stearoyl-acyl carrier protein fatty acid desaturase family, is involve
|
|-
|949
|''Oscyp71Z2''
|[[Os07g0217600]]
|10.1016/j.plantsci.2013.02.005
| Oscyp71Z2 involves diterpenoid phytoalexin biosynthesis that contributes to bacterial blight resistance in rice
|
|-
|950
|''OsGPX3''
|[[Os02g0664000]]
|10.1016/j.plantsci.2013.03.017
|The mitochondrial glutathione peroxidase GPX3 is essential for H 2 O 2 homeostasis and root and shoot development in rice
|
|-
|951
|''OsGS1;2''
|[[Os03g0223400]]
|10.1093/pcp/pct046
|
|Annotated
|-
|952
|''MSF1''
|[[Os05g0497200]]
|10.1104/pp.113.216044
|Annotated
|
|-
|953
|''CAP1''
|[[Os02g0141300]]
|10.1104/pp.113.216523
|
|Annotated
|-
|954
|''glup6''
|[[Os03g0262900]]
|10.1104/pp.113.217869
|Annotated
|
|-
|955
|''OsGDCH''
|[[Os10g0516100]]
|10.1111/pce.12078
| Knockdown of GDCH gene reveals reactive oxygen species-induced leaf senescence in rice
|
|-
|956
|''RGA4''
|[[Os11g0225100]]
|10.1105/tpc.112.107201
|
|Annotated
|-
|957
|''RGA5''
|[[Os11g0225300]]
|10.1105/tpc.112.10720
| The Rice Resistance Protein Pair RGA4/RGA5 Recognizes the Magnaporthe oryzae Effectors AVR-Pia and AVR1-CO39 by Direct Binding
|
|-
|958
|''LOX3''
|[[Os03g0700400]]
|10.1007/s12374-013-0085-7
| Molecular Genetic Characterization of Rice Seed Lipoxygenase 3 and Assessment of Its Effects on Seed Longevity
|
|-
|959
|''Sar1a''
|[[Os01g0338000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|-
|960
|''Sar1b''
|[[Os12g0560300 ]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|961
|''Sar1c''
|[[Os01g0254000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|961
|''Sar1d''
|[[Os06g0225000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|962
|''vyl''
|[[Os03g0411500]]
|10.1104/pp.113.217604
|
|Annotated
|-
|963
|''SERF1''
|[[Os05g0420300]]
|10.1105/tpc.113.113068
| SALT-RESPONSIVE ERF1 Regulates Reactive Oxygen Species–Dependent Signaling during the Initial Response to Salt Stress in Rice
|
|-
|964
|''dep''
|[[Os05g0118700]]
|10.1186/1939-8433-5-28
|A WUSCHEL-related homeobox 3B gene, depilous (dep), confers glabrousness of rice leaves and glumes
|
|-
|965
|''LC1''
|[[Os01g0785400]]
|10.1093/mp/sss064
|
|
|-
|966
|''TUD1''
|[[Os03g0232600]]
|10.1371/journal.pgen.1003391
|Annotated
|
|-
|967
|''GL3.1''
|[[Os03g0646900]]
|10.1038/cr.2012.151
|
|Annotated
|-
|971
|''Oshox22''
|[[Os04g0541700]]
|10.1007/s11103-012-9967-1
|Annotated
|
|-
|972
|''OsLG1''
|[[Os04g0656500]]
|10.1038/ng.2567
| OsLG1 regulates a closed panicle trait in domesticated rice
|
|-
|973
|''OsMSH5''
|[[Os05g0498300]]
|10.1093/mp/sss145
|Annotated
|
|-
|974
|''ABCG15''
|[[Os06g0607700]]
|10.1093/pcp/pcs162
|Annotated
|
|-
|975
|''TGW6''
|[[Os06g0623700]]
|10.1038/ng.2612
|Loss of function of the IAA-glucose hydrolase gene TGW6 enhances rice grain weight and increases yield
|
|-
|976
|''OsFD2''
|[[Os06g0720900]]
|10.1093/pcp/pct005
| Functional Diversification of FD Transcription Factors in Rice, Components of Florigen Activation Complexes
|Annotated
|-
|127
|''OsFD1''
|[[Os09g0540800]]
|10.1038/nature10272
| Functional Diversification of FD Transcription Factors in Rice, Components of Florigen Activation Complexes
|-
|977
|''OsDGL1''
|[[Os07g0209000]]
|10.1093/pcp/pcs159
| OsDGL1, a Homolog of an Oligosaccharyltransferase Complex Subunit, is Involved in N-Glycosylation and Root Development in Rice
|
|-
|978
|''Rurm1''
|[[Os07g0466300]]
|10.1093/mp/sst042
|Loss-of-Function of a Ubiquitin-Related Modifier Promotes the Mobilization of the Active MITE mPing
|
|-
|979
|''RSS3''
|[[Os11g0446000]]
|10.1105/tpc.113.112052
|
|Annotated
|-
|980
|''OsRecQl4''
|[[Os04g0433800]]
|10.1093/pcp/pcs155
| DNA replication arrest leads to enhanced homologous recombination and cell death in meristems of rice OsRecQl4 mutants
|
|-
|981
|''OsExo1''
|[[Os01g0777300]]
|10.1093/pcp/pcs155
| Rice exonuclease-1 homologue, OsEXO1, that interacts with DNA polymerase k and RPA subunit proteins, is involved in cell proliferation
|
|-
|982
|''OsIRX10''
|[[Os01g0926700]]
|10.1093/mp/sss135
| Inactivation of OsIRX10 Leads to Decreased Xylan Content in Rice Culm Cell Walls and Improved Biomass Saccharification
|
|-
|983
|''OsCpn60α1''
|[[Os12g0277500]]
|10.1007/s10059-013-2337-2
| OsCpn60α1, Encoding the Plastid Chaperonin 60α Subunit, Is Essential for Folding of rbcL
|
|-
|985
|''Dro1''
|[[Os09g0439800]]
|10.1038/ng.2725
|Annotated
|
|-
|986
|''OsSAG12-1''
|[[Os01g0907600]]
|10.1007/s12038-013-9334-7
| Down-regulation of OsSAG12-1 results in enhanced senescence and pathogen-induced cell death in transgenic rice plants
|
|-
|987
|''BGL11(t)''
|[[Os11g0592900]]
|10.1007/s13258-013-0094-4
| Identification and characterization of BGL11(t), a novel gene regulating leaf-color mutation in rice (Oryza sativa L.)
|
|-
|990
|''OsDET1''
|[[Os01g0104600]]
|10.1016/j.plantsci.2013.06.003
| Mutation of OsDET1 increases chlorophyll content in rice
|
|-
|991
|''OsVHA-A''
|[[Os06g0662000]]
|10.1371/journal.pone.0069046
|Annotated
|
|-
|992
|''TIFY11b''
|[[Os03g0181100]]
|10.1271/bbb.120545
| Overexpression of a Rice TIFY Gene Increases Grain Size through Enhanced Accumulation of Carbohydrates in the Stem
|
|-
|994
|''GE''
|[[Os07g0603700]]
|10.1111/tpj.12223
| GIANT EMBRYO encodes CYP78A13, required for proper size balance between embryo and endosperm in rice
|
|-
|999
|''OsAP65''
|[[Os07g0592200]]
|10.1093/jxb/ert173
| OsAP65, a rice aspartic protease, is essential for male fertility and plays a role in pollen germination and pollen tube growth
|
|-
|1000
|''OsbZIP58''
|[[Os07g0182000]]
|10.1093/jxb/ert187
| OsbZIP58, a basic leucine zipper transcription factor, regulates starch biosynthesis in rice endosperm
|
|-
|1001
|''YGL138(t)''
|[[Os11g0153600]]
|10.1186/1939-8433-6-7
| YGL138(t), encoding a putative signal recognition
particle 54 kDa protein, is involved in chloroplast
development of rice
|Development
|-
|1003
|''OsGA20ox3''
|[[Os07g0169700]]
|10.1094/MPMI-05-12-0138-R
| Gibberellin 20-Oxidase Gene OsGA20ox3 Regulates
Plant Stature and Disease Development in Rice
|Stress
|-
|1004
|''Hd16''
|[[Os03g0793500]]
|10.1111/tpj.12268
|
|Annotated
|-
|1005
|''Bh4''
|[[Os04g0460200]]
|10.1104/pp.110.168500
| Genetic Control of a Transition from Black to Straw-White Seed Hull in Rice Domestication
|Development
|-
|1006
|''OsSUV3''
|[[Os03g0746500]]
|10.1111/tpj.12277
|
|Annotated
|-
|1007
|''OsMPS''
|[[Os02g0618400]]
|10.1111/tpj.12286
|
|Annotated
|-
|1008
|''OsCDT3''
|[[Os01g0178300]]
|10.1111/tpj.12296
|A plasma membrane-localized small peptide is involved in rice aluminum tolerance
|Stress
|-
|1009
|''CRC1''
|[[Os04g0479000]]
|10.1105/tpc.113.113175
| CENTRAL REGION COMPONENT1, a Novel Synaptonemal Complex Component, Is Essential for Meiotic Recombination Initiation in Rice
|Development
|-
|1010
|''ASL1''
|[[Os01g0678600]]
|10.1534/g3.113.007856
|Disruption of the Rice Plastid Ribosomal Protein S20 Leads to Chloroplast Developmental Defects and Seedling Lethality
|Development
|-
|1011
|''OsNAP''
|[[Os03g0327800]]
|10.1186/1471-2229-13-132
|
|Annotated
|-
|1012
|''GS6''
|[[Os06g0127800]]
|10.1111/jipb.12062
|
|Annotated
|-
|1013
|''OsHOS1''
|[[Os03g0737200]]
|10.1007/s11103-013-0092-6
| Isolation and characterization of rice (Oryza sativa L.) E3-ubiquitin ligase OsHOS1 gene in the modulation of cold stress response
|Stress
|-
|1014
|''SGRL''
|[[Os04g0692600]]
|10.1016/j.jplph.2013.05.016
|
|The Stay-Green Rice like (SGRL) gene regulates chlorophyll degradation in rice
|-
|1017
|''An-1''
|[[Os04g0350700]]
|10.1105/tpc.113.113589
|
|Annotated
|-
|1018
|''OslecRK''
|[[Os04g0201900]]
|10.1111/tpj.12328
|
|A rice lectin receptor-like kinase that is involved in innateimmune responses also contributes to seed germination
|-
|1020
|''OsVOZ2''
|[[Os05g0515700]]
|10.1371/journal.pone.0073346
|Xanthomonas oryzae pv. oryzae Type III Effector XopN Targets OsVOZ2 and a Putative Thiamine Synthase as a Virulence Factor in Rice
|Stress
|-
|1021
|''OsHsfB2b''
|[[Os08g0546800]]
|10.1007/s00299-013-1492-4
|
|Annotated
|-
|1022
|''OsGRX8''
|[[Os02g0512400]]
|10.1007/s00425-013-1940-y
|Modified expression of an auxin‐responsive rice CC‐type glutaredoxin gene affects multiple abiotic stress responses
| stress
|-
|1023
|''DAO''
|[[Os04g0475600]]
|10.1016/j.devcel.2013.09.005
|
|Annotated
|-
|1024
|''OsHMA5''
|[[Os04g0556000]]
|10.1104/pp.113.226225
|A Member of the Heavy Metal P-Type ATPase OsHMA5 Is Involved in Xylem Loading of Copper in Rice
|Stress
|-
|1025
|''Osoxo4''
|[[Os03g0693700]]
|10.1111/mpp.12055
|
|Rice oxalate oxidase gene driven by green tissue-specific promoter increases tolerance to sheath blight pathogen (Rhizoctonia solani) in transgenic rice
|-
|1026
|''OsSTN8''
|[[Os05g0480000]]
|10.1111/tpj.12331
|
|Loss-of-function of OsSTN8 suppresses the photosystem II core protein phosphorylation and interferes with the photosystem II repair mechanism in rice
|-
|1027
|''OsEXPA8''
|[[Os01g0248900]]
|10.1371/journal.pone.0075997
|
|Overexpression of OsEXPA8, a root-specific gene, improves rice growth and root system architecture by facilitating cell extension
|-
|1028
|''OsPRR37''
|[[Os07g0695100]]
|10.1093/mp/sst088
|
|Natural Variation in OsPRR37 Regulates Heading Date and Contributes to Rice Cultivation at a Wide Range of Latitudes
|-
|1029
|''OsMADS57''
|[[Os02g0731200]]
|10.1038/ncomms2542
|
|Annotated
|-
|1030
|''DWA1''
|[[Os04g0473900]]
|10.1073/pnas.1316412110
|
|Annotated
|-
|1031
|''gpa2''
|[[Os03g0262900]]
|10.1093/mp/sst081
|
|Annotated
|-
|1032
|''MHZ7/OsEIN2''
|[[Os07g0155600]]
|10.1093/mp/sst087
|
|Annotated
|-
|1033
|''YGL2''
|[[Os06g0603000]]
|10.1007/s00299-013-1498-y
|
|Annotated
|-
|1034
|''OsMTP8.1''
|[[Os03g0226400]]
|10.1093/jxb/ert243
|Mn tolerance in rice is mediated by MTP8.1, a member of the cation diffusion facilitator family
|
|-
|1035
|''this1''
|[[Os01g0751600]]
|10.1093/jxb/ert256
| THIS1 is a putative lipase that regulates tillering, plant height, and spikelet fertility in rice
|
|-
|1036
|''OsABCG15''
|[[Os06g0607700]]
|10.1111/jipb.12053
|
|The ATP‐binding Cassette Transporter OsABCG15 is Required for Anther Development and Pollen Fertility in Rice
|-
|1037
|''OsRRMh''
|[[Os09g0516300]]
|10.1111/jipb.12056
| OsRRMh, a Spen-like gene, plays an important role during the vegetative to reproductive transition in rice.
|
|-
|1038
|''OsCTR2''
|[[Os02g0527600]]
|10.1093/jxb/ert272
| Rice CONSTITUTIVE TRIPLE-RESPONSE2 is involved in the ethylene-receptor signalling and regulation of various aspects of rice growth and development
|
|-
|1039
|''OsbZIP71''
|[[Os09g0306400]]
|10.1007/s11103-013-0115-3
|
|Annotated
|-
|1040
|''OsHox33''
|[[Os12g0612700]]
|10.1007/s11427-013-4565-2
|Knockdown of OsHox33, a member of the class III homeodomain-leucine zipper gene family, accelerates leaf senescence in rice
|
|-
|1041
|''OsGAPDHB''
|[[Os03g0129300]]
|10.1016/j.plantsci.2013.09.010
|A proteomic study of rice cultivar TNG67 and its high aroma mutant SA0420.
|
|-
|1042
|''OsAPX7''
|[[Os04g0434800]]
|10.1016/j.plantsci.2013.10.001
| The knockdown of chloroplastic ascorbate peroxidases reveals its regulatory role in the photosynthesis and protection under photo-oxidative stress in rice
|
|-
|1043
|''OsAPX8''
|[[Os02g0553200]]
|10.1016/j.plantsci.2013.10.001
|
|Annotated
|-
|1044
|''OsRNS4''
|[[Os09g0537700]]
|10.1016/j.plantsci.2013.10.003
|
|Annotated
|-
|1045
|''D53''
|[[Os11g0104300]]
|"10.1038/nature12870, 10.1038/nature12878"
|
|Annotated
|-
|1046
|''OsHRZ1''
|[[Os01g0689451]]
|10.1038/ncomms3792
| Iron-binding haemerythrin RING ubiquitin ligases regulate plant iron responses and accumulation
|
|-
|1047
|''OsHRZ2''
|[[Os05g0551000]]
|10.1038/ncomms3792
|Iron-binding haemerythrin RING ubiquitin ligases regulate plant iron responses and accumulation
|
|-
|1048
|''PTB1''
|[[Os05g0145000]]
|10.1038/ncomms3793
| Natural variation in PTB1 regulates rice seed setting rate by controlling pollen tube growth
|
|-
|1050
|''OsBOR4''
|[[Os05g0176800]]
|10.1093/pcp/pct136
|
|Annotated
|-
|1051
|''LYL1''
|[[Os02g0744900]]
|10.1371/journal.pone.0075299
| Mutation of the Light-Induced Yellow Leaf 1 Gene, Which Encodes a Geranylgeranyl Reductase, Affects Chlorophyll Biosynthesis and Light Sensitivity in Rice
|
|-
|1052
|''OsEBS''
|[[Os05g0591400]]
|10.1111/pbi.12097
|Identification and characterization of OsEBS, a gene involved in enhanced plant biomass and spikelet number in rice
|
|-
|1053
|''SOR1''
|[[Os04g0101800]]
|10.1186/1939-8433-6-30
| Isolation of a novel mutant gene for soil-surface rooting in rice (Oryza sativa L.)
|
|-
|1054
|''OsCPK10''
|[[Os03g0788500]]
|10.1016/j.plaphy.2013.10.004
|
|Annotated
|-
|1055
|''JMJ705''
|[[Os01g0907400]]
|10.1105/tpc.113.118802
| Jumonji C Domain Protein JMJ705-Mediated Removal of Histone H3 Lysine 27 Trimethylation Is Involved in Defense-Related Gene Activation in Rice
|Stress
|-
|1056
|''OsCCaMK''
|[[Os05g0489900]]
|10.1128/AEM.03646-13.
| A rice gene for microbial symbiosis, OsCCaMK, reduces CH 4 flux in a paddy field with low nitrogen input
|Stress
|-
|1061
|''LH8''
|[[Os08g0174500]]
|10.1038/srep04263
|
|Annotated
|-
|1063
|''OsTrx1''
|[[Os09g0134500]]
|10.1104/pp.113.228049
| Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3
|
|-
|1071
|''RIXI''
|[[Os11g0701800]]
|10.1007/s10658-013-0342-0
| Functional characterization of a new pathogen induced xylanase inhibitor (RIXI) from rice
|
|-
|1072
|''TCD9''
|[[Os09g0563300]]
|10.1016/j.plantsci.2013.11.003
|Importance of the rice TCD9 encoding α subunit of chaperonin protein 60 (Cpn60α) for the chloroplast development during the early leaf stage.
|
|-
|1074
|''OsBURP16''
|[[Os10g0409400]]
|10.1111/pce.12223
| Overexpression of stress-inducible OsBURP16, the β subunit of polygalacturonase 1, decreases pectin content and cell adhesion and increases abiotic stress sensitivity in rice
|
|-
|1075
|''OsDSR2''
|[[Os01g0839200]]
|10.1007/s00299-013-1532-0
|Overexpression of a new stress-repressive gene OsDSR2 encodinga protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice
|
|-
|1076
|''ssg4''
|[[Os01g0179400]]
|10.1104/pp.113.229591
| Amyloplast-Localized SUBSTANDARD STARCH GRAIN4 Protein Influences the Size of Starch Grains in Rice Endosperm
|
|-
|1080
|''OsAMT1;1''
|[[Os04g0509600]]
|10.1093/jxb/ert458
| AMT1;1 transgenic rice plants with enhanced NH4+ permeability show superior growth and higher yield under optimal and suboptimal NH4+ conditions
|
|-
|1082
|''WLP1''
|[[Os01g0749200]]
|10.1007/s11103-013-0134-0
| The rice nuclear gene WLP1 encoding a chloroplast ribosome L13 protein is needed for chloroplast development in rice grown under low temperature conditions
|
|-
|1083
|''ADH1''
|[[Os11g0210300]]
|10.1093/aob/mct305
|
|Annotated
|-
|1084
|''OsAlba1''
|[[Os01g0173100]]
|10.1016/j.phytochem.2014.01.015
|
|Annotated
|-
|1086
|''OsDCL3a''
|[[Os01g0909200]]
|10.1073/pnas.1318131111
|
|Annotated
|-
|1087
|''SGL''
|[[Os05g0154700]]
|10.1007/s00299-013-1524-0
|
|Annotated
|-
|1088
|''OsHI-XIP''
|[[Os05g0247100]]
|10.1007/s11105-013-0661-5
| Overexpression of a Xylanase Inhibitor Gene, OsHI-XIP, Enhances Resistance in Rice to Herbivore
|
|-
|1089
|''OsZHD1''
|[[Os09g0466400]]
|10.1007/s00425-013-2009-7
|
|Annotated
|-
|1090
|''CYP96B4''
|[[Os03g0140400]]
|10.1371/journal.pone.0088068
| The rice semi-dwarf mutant sd37, caused by a mutation in CYP96B4, plays an important role in the fine-tuning of plant growth.
|
|-
|1092
|''FLO6''
|[[Os03g0686900]]
|10.1111/tpj.12444
| FLOURY ENDOSPERM6 encodes a CBM48 domain-containing protein involved in compound granule formation and starch synthesis in rice endosperm
|
|-
|1093
|''OsKS2''
|[[Os04g0612000]]
|10.1111/plb.12069
|
|Annotated
|-
|1094
|''OsDG2''
|[[Os02g0606000]]
| 10.1007/s00299-013-1549-4
| The rice OsDG2 encoding a glycine-rich protein is involved in the regulation of chloroplast development during early seedling stage
|
|-
|1095
|''Hwi2''
|[[Os01g0795400]]
|10.1038/ncomms4357
|
|A two-locus interaction causes interspecific hybrid weakness in rice
|-
|1222
|''Hwi1''
|[[Os11g0173500]]
|10.1038/ncomms4357
|
|A two-locus interaction causes interspecific hybrid weakness in rice
|-
|1096
|''OsGLO4''
|[[Os07g0152900]]
|10.1111/ppl.12104
| Suppression of glycolate oxidase causes glyoxylate accumulation that inhibits photosynthesis through deactivating Rubisco in rice
|
|-
|1097
|''DL''
|[[Os03g0215200]]
|10.1111/tpj/12411
|
|Annotated
|-
|1098
|''OsETT2''
|[[Os01g0670800]]
|10.1111/tpj/12411
| The DROOPING LEAF and OsETTIN2 genes promote awndevelopment in rice
|
|-
|1099
|''SHL2''
|[[Os01g0527600]]
|10.1111/tpj/12411
| Rice RNA-dependent RNA polymerase 6 acts in small RNA biogenesis and spikelet development.
|
|-
|1100
|''OsLIS''
|[[Os02g0121700]]
|10.1111/pce.12169
| Jasmonate induction of the monoterpene linalool confers resistance to rice bacterial blight and its biosynthesis is regulated by JAZ protein in rice
|
|-
|1101
|''OsPT9''
|[[Os06g0324800]]
|10.1111/pce.12224
|Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in rice.
|
|-
|1102
|''OsPT10''
|[[Os06g0325200]]
|10.1111/pce.12224
| Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in rice.
|
|-
|1106
|''LTG1''
|[[Os02g0622100]]
|10.1111/tpj.12487
| Annotated
|-
|1107
|''OsRPK1''
|[[Os05g0486100]]
|10.1016/j.bbagen.2014.01.003
|
|Annotated
|-
|1108
|''d89''
|[[Os05g0333200]]
|10.1007/s10681-014-1071-y
|
|Annotated
|-
|1112
|''OsEMF2b''
|[[Os09g0306800]]
|10.1007/s11105-014-0733-1
| OsEMF2b Acts as a Regulator of Flowering Transition and Floral Organ Identity by Mediating H3K27me3 Deposition at OsLFL1 and OsMADS4 in Rice
|
|-
|1117
|''OsFIE1''
|[[Os08g0137250]]
|10.1104/pp.113.232413
|
|Annotated
|-
|1118
|''OsUGE1''
|[[Os05g0595100]]
|10.1371/journal.pone.0096158
| Functional Characterization of the Rice UDP-glucose 4- epimerase 1, OsUGE1: A Potential Role in Cell Wall Carbohydrate Partitioning during Limiting Nitrogen Conditions
|
|-
|1119
|''OsATG7''
|[[Os01g0614900]]
|10.4161/auto.28279
| OsATG7 is required for autophagy-dependent lipid metabolism in rice postmeiotic anther development
|
|-
|1120
|''chalk5''
|[[Os05g0156900]]
|10.1038/ng.2923
| Chalk5 encodes a vacuolar H + -translocating pyrophosphatase influencing grain chalkiness in rice
|
|-
|1122
|''cl7(t)''
|[[Os07g0616000]]
|10.1093/jxb/eru074
|Rice DENSE AND ERECT PANICLE 2 is essential for determining panicle outgrowth and elongation
|
|-
|1123
|''OsGPX1''
|[[Os04g0556300]]
|10.1007/s10535-014-0394-9
|Chloroplastic and mitochondrial GPX genes play a critical role in rice development
|
|-
|1124
|''OsGPX4''
|[[Os06g0185900]]
|10.1007/s10535-014-0394-9
| Chloroplastic and mitochondrial GPX genes play a critical role in rice development
|
|-
|1125
|''D1352''
|[[Os03g0232600]]
|10.1007/s11032-014-0021-7
|
|Annotated
|-
|1126
|''OsAHP1''
|[[Os08g0557700]]
|10.1104/pp.113.232629
| Two Rice Authentic Histidine Phosphotransfer Proteins, OsAHP1 and OsAHP2, Mediate Cytokinin Signaling and Stress Responses in Rice
|
|-
|1127
|''OsAHP2''
|[[Os09g0567400]]
|10.1104/pp.113.232629
| Two Rice Authentic Histidine Phosphotransfer Proteins, OsAHP1 and OsAHP2, Mediate Cytokinin Signaling and Stress Responses in Rice
|
|-
|1128
|''OsWR2''
|[[Os06g0604000]]
|10.1007/s11105-013-0687-8
|
|Annotated
|-
|1129
|''Se14''
|[[Os03g0151300]]
|10.1371/journal.pone.0096064
| Se14, Encoding a JmjC Domain-Containing Protein, Plays Key Roles in Long-Day Suppression of Rice Flowering through the Demethylation of H3K4me3 of RFT1
|
|-
|1130
|''MET1b''
|[[Os07g0182900]]
|10.1007/s11103-014-0178-9
|
|Annotated
|-
|1131
|''MET1a''
|[[Os03g0798300]]
|10.1007/s11103-014-0178-9
| Homologous recombination-mediated knock-in targeting of the MET1a gene for a maintenance DNA methyltransferase reproducibly reveals dosage-dependent spatiotemporal gene expression in rice
|
|-
|1133
|''smos1''
|[[Os05g0389000]]
|10.1093/pcp/pcu023
| A Novel AP2-Type Transcription Factor, SMALL ORGAN SIZE1, Controls Organ Size Downstream of an Auxin Signaling Pathway
|
|-
|1135
|''OsCPK4''
|[[Os02g0126400]]
|10.1104/pp.113.230268
|
|Annotated
|-
|1136
|''OsPAD4''
|[[Os11g0195500]]
|10.1111/tpj.12500
| Rice OsPAD4 functions differently from Arabidopsis AtPAD4 in host-pathogen interactions
|
|-
|1137
|''OsMOGS''
|[[Os01g0921200]]
|10.1111/tpj.12497
|
|Annotated
|-
|1138
|''OsJAR1''
|[[Os05g0586200]]
|10.1111/pce.12201
|
|Annotated
|-
|1139
|''OsMADS34''
|[[Os03g0756100]]
|10.1111/nph.12657
|
|Annotated
|-
|1140
|''OsMRP5''
|[[Os03g0142800]]
|10.1007/s11248-014-9792-1
| Seed-specific silencing of OsMRP5 reduces seed phytic acid and weight in rice
|
|-
|1141
|''TMS 9-1(OsMS1)''
|[[Os09g0449000]]
|10.1007/s00122-014-2289-8
|
|Annotated
|-
|1142
|''epsps''
|[[Os06g0133900]]
|10.1111/nph.12428
|A novel 5-enolpyruvoylshikimate-3-phosphate (EPSP) synthase transgene for glyphosate resistance stimulates growth and fecundity in weedy rice (Oryza sativa) without herbicide
|
|-
|1143
|''DWT1''
|[[Os01g0667400]]
|10.1371/journal.pgen.1004154
|
|Annotated
|-
|1144
|''DP2''
|[[Os02g0531600]]
|10.1007/s13258-013-0169-2
| Morphological characteristics and gene mapping of a dense panicle (dp2) mutant in rice (Oryza sativa L.)
|
|-
|1145
|''OsRACK1A''
|[[Os01g0686800]]
|10.1371/journal.pone.0097120
|OsRACK1 Is Involved in Abscisic Acid- and H 2 O 2 - Mediated Signaling to Regulate Seed Germination in Rice (Oryza sativa, L.)
|
|-
|1223
|''OsCAF1A''
|[[Os08g0440300]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1146
|''OsCAF1B''
|[[Os04g0684900]]
|10.1007/s11103-014-0196-7
|
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|-
|1147
|''OsCAF1G''
|[[Os09g0416800]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1148
|''OsCAF1H''
|[[Os02g0796300]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1149
|''OsLOX2 (L-2)''
|[[Os03g0738600]]
|10.1007/s11248-014-9803-2
| OsLOX2, a rice type I lipoxygenase, confers opposite effects on seed germination and longevity
|
|-
|1150
|''OsNAC111''
|[[Os10g0177000]]
|10.1094/mpmi-03-14-0065-r
| OsNAC111, a Blast Disease–Responsive Transcription Factor in Rice, Positively Regulates the Expression of Defense-Related Genes
|
|-
|1152
|''OsCKX4''
|[[Os01g0940000]]
|10.1104/pp.114.238584
|
|Annotated
|-
|1155
|''DIF1''
|[[Os01g0626400]]
|10.1371/journal.pone.0102529
|
|Annotated
|-
|1164
|''CYP93G1''
|[[Os04g0101400]]
|10.1104/pp.114.239723
| Cytochrome P450 93G1 Is a Flavone Synthase II That Channels Flavanones to the Biosynthesis of Tricin O-Linked Conjugates in Rice
|
|-
|1224
|''CYP93G2''
|[[Os06g0102100]]
|10.1104/pp.114.239723
| CYP93G2 Is a Flavanone 2-Hydroxylase Required for C-Glycosylflavone Biosynthesis in Rice
|
|-
|1165
|''OsMYB4P''
|[[Os11g0558200]]
|10.1016/j.plaphy.2014.02.024
| Overexpression of OsMYB4P, an R2R3-type MYB transcriptional activator, increases phosphate acquisition in rice
|
|-
|1166
|''rip-3 (a-tubulin)''
|[[Os03g0726100]]
|10.1016/j.plaphy.2014.04.011
| Water-stress-induced inhibition of a -tubulin gene expression during growth, and its implications for reproductive success in rice
|
|-
|1167
|''OsRDR1''
|[[Os02g0736200]]
|10.1186/1471-2229-14-177
| Mutation of the RDR1 gene caused genome-wide changes in gene expression, regional variation in small RNA clusters and localized alteration in DNA methylation in rice
|
|-
|1168
|''ygl7''
|[[Os03g0811100]]
|10.1371/journal.pone.0099564
|
|Annotated
|-
|1169
|''OsDREB6''
|[[Os09g0369000]]
|10.1007/s12374-013-0480-0
| Characterization of OsDREB6 Responsive to Osmotic and Cold Stresses in Rice
|
|-
|1170
|''OsPAO7''
|[[Os09g0368500]]
|10.1093/pcp/pcu047
| Polyamine Oxidase 7 is a Terminal Catabolism-Type Enzyme in Oryza sativa and is Specifically Expressed in Anthers
|
|-
|1172
|''OsAGPL2''
|[[Os01g0633100]]
|10.1093/pcp/pcu057
| The Rice Endosperm ADP-Glucose Pyrophosphorylase Large Subunit is Essential for Optimal Catalysis and Allosteric Regulation of the Heterotetrameric Enzyme
|
|-
|1173
|''OsMYB103L''
|[[Os08g0151300]]
|10.1186/1471-2229-14-158
| OsMYB103L, an R2R3-MYB transcription factor, influences leaf rolling and mechanical strength in rice
|
|-
|1174
|''DRO1''
|[[Os09g0439800]]
|10.1038/srep05563
|
|Annotated
|-
|1175
|''FIB''
|[[Os01g0169800]]
|10.1111/tpj.12517
|
|Annotated
|-
|1176
|''OsNIP3;1''
|[[Os10g0513200]]
|10.1111/tpj.12511
| OsNIP3;1, a rice boric acid channel, regulates boron distribution and is essential for growth under boron-deficient conditions
|
|-
|1177
|''OsETOL1''
|[[Os03g0294700]]
|10.1111/tpj.12508
|
|Annotated
|-
|1178
|''OsGLY1-11.2''
|[[Os08g0191700]]
|10.1111/tpj.12521
| A unique Ni 2+ -dependent and methylglyoxal-inducible rice glyoxalase I possesses a single active site and functions in abiotic stress response
|
|-
|1179
|''OsKTN80a''
|[[Os10g0494800]]
|10.1111/jipb.12170
| Overexpression of OsKTN80a, a katanin P80 ortholog, caused the repressed cell elongation and stalled cell division mediated by microtubule apparatus defects in primary root in Oryza Sativa
|
|-
|1180
|''WRKY45''
|[[Os05g0322900]]
|10.1007/s11103-014-0221-x
|
|Annotated
|-
|1181
|''OsRZFP34''
|[[Os01g0719100]]
|10.1007/s11103-014-0217-6
|Expression of a gene encoding a rice RING zinc‐finger protein, OsRZFP34, enhances stomata opening
|Stress
|-
|1182
|''OsSPS1''
|[[Os01g0919400]]
|10.1016/j.plantsci.2014.05.018
|
|Annotated
|-
|1183
|''AM1''
|[[Os04g0682800]]
|10.1007/s00299-014-1639-y
|
|Annotated
|-
|1184
|''OsMPK3''
|[[Os02g0148100]]
|10.1007/s00299-014-1620-9
|
|Annotated
|-
|1186
|''OsMet1-2''
|[[Os07g0182900]]
|10.1073/pnas.1410761111
|
|Annotated
|-
|1189
|''sped1''
|[[Os06g0597500]]
|10.1534/genetics.114.163931
|Regulation of Inflorescence Branch Development in Rice Through a Novel Pathway Involving the Pentatricopeptide Repeat Protein sped1-D
|
|-
|1190
|''OsXXT1''
|[[Os03g0300000]]
|10.1093/jxb/eru189
| Mutation in xyloglucan 6-xylosytransferase results in abnormal root hair development in Oryza sativa
|
|-
|1191
|''Nrat1''
|[[Os02g0131800]]
|10.1093/jxb/eru201
|
|Annotated
|-
|1192
|''SLCHL4 (NAL1)''
|[[Os04g0615000]]
|10.1093/mp/ssu055
|
|Annotated
|-
|1193
|''OsNMD3''
|[[Os10g0573900]]
|10.1093/jxb/eru150
|
|Annotated
|-
|1194
|''OsRAN1''
|[[Os01g0611100]]
|10.1093/jxb/eru178
|
|Annotated
|-
|1195
|''OsABCB14''
|[[Os04g0459000]]
|10.1111/tpj.12544
| OsABCB14 functions in auxin transport and iron homeostasis in rice (Oryza sativa.L)
|
|-
|1196
|''OsRAD51D''
|[[Os09g0104200]]
|10.1111/tpj.12558
|
|Annotated
|-
|1198
|''Roc5(rl(t))''
|[[Os02g0674800]]
|10.1007/s11434-014-0357-8
|Isolation and characterization of rl (t) , a gene that controls leaf rolling in rice
|
|-
|1200
|''OsB12D1''
|[[Os07g0604700]]
|10.3390/ijms150813461
|The Mitochondrion-Located Protein OsB12D1 Enhances Flooding Tolerance during Seed Germination and Early Seedling Growth in Rice
|Stress
|-
|1201
|''OsHO2''
|[[Os03g0395000]]
|10.1007/s00425-014-2116-0
|Annotated
|Biosynthesis
|-
|1202
|''CL4 (= dwarf11)''
|[[Os04g0469800]]
|10.1007/s11434-014-0568-z
|Annotated
|Development
|-
|1203
|''OsEXPA3''
|[[Os05g0276500]]
|10.2135/cropsci2013.11.0746
|Repression of OsEXPA3 Expression Leadsto Root System Growth Suppression in Rice
|Stress,Development
|-
|1204
|''bHLH142''
|[[Os01g0293100]]
|10.1105/tpc.114.126292
|Annotated
|Development
|-
|1205
|''SIT1''
|[[Os02g0640500]]
|10.1105/tpc.114.125187
|The Receptor-Like Kinase SIT1 Mediates Salt
Sensitivity by Activating MAPK3/6 and Regulating
Ethylene Homeostasis in Rice
|Stress
|-
|1206
|''SIT2''
|[[Os04g0531400]]
|10.1105/tpc.114.125187
| The Receptor-Like Kinase SIT1 Mediates Salt
Sensitivity by Activating MAPK3/6 and Regulating
Ethylene Homeostasis in Rice
|Stress
|-
|1207
|''CPK18''
|[[Os07g0409900]]
|10.1105/tpc.114.126441
| Direct Phosphorylation and Activation of a Mitogen-Activated
Protein Kinase by a Calcium-Dependent Protein
Kinase in Rice
|Stress
|-
|1208
|''OsHPR1''
|[[Os02g0101500]]
|10.1111/jipb.12125
| Two hydroxypyruvate reductases encoded by OsHPR1 and OsHPR2 are involved in
photorespiratory metabolism in rice
|Metabolism
|-
|1222
|''OsHPR2''
|[[Os01g0228600]]
|10.1111/jipb.12125
| Two hydroxypyruvate reductases encoded by OsHPR1 and OsHPR2 are involved in
photorespiratory metabolism in rice
|Metabolism
|-
|1209
|''OsCAD2''
|[[Os02g0187800]]
|10.1038/srep06567
|Annotated
|
|-
|1210
|''OsSLI1''
|[[Os02g0649300]]
|10.1155/2014/809353
|OsSLI1, a Homeodomain Containing Transcription Activator, Involves Abscisic Acid Related Stress Response in Rice (Oryza sativa L.)
|Stress,Development
|-
|1211
|''OsMKK1 (MAPKK)''
|[[Os06g0147800]]
|10.1016/j.plantsci.2014.08.007
|The mitogen-activated protein kinase cascade MKK1-MPK4 mediates salt signaling in rice
|Stress
|-
|1212
|''SPK1(SYG1)''
|[[Os06g0603600]]
|10.1073/pnas.1404680111
|Annotated
|Finished
|-
|1213
|''SPK2(SYG2)''
|[[Os02g0202200]]
|10.1073/pnas.1404680111
| Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner
|
|-
|1215
|''OsAAP6''
|[[Os01g0878700]]
|10.1038/ncomms5847
| OsAAP6 functions as an important regulator of grain protein content and nutritional quality in rice
|
|-
|1216
|''OsSOT1(STV11)''
|[[Os11g0505300]]
|10.1038/ncomms5768
| STV11 encodes a sulphotransferase and confers durable resistance to rice stripe virus
|
|-
|1217
|''tms5''
|[[Os02g0214300]]
|10.1038/srep06567
|
|Annotated
|-
|1218
|''CYP703A3''
|[[Os08g0131100]]
|10.1111/jipb.12212
|Rice CYP703A3, a cytochrome P450 hydroxylase, is essential for development of anther cuticle and pollen exine
|Development
|-
|1219
|''OsGUN4''
|[[Os11g0267000]]
|10.1007/s00122-014-2393-9
|A down-regulated epi-allele of the genomes uncoupled 4 gene generates a xantha marker trait in rice.
|Color
|-
|1220
|''OsBADH1''
|[[Os04g0464200]]
|OsBADH1 is possibly involved in acetaldehyde oxidation in rice plant peroxisomes
|OsBADH1 is possibly involved in acetaldehyde oxidation in rice plant peroxisomes
|Stress
|-
|243
|''gh2''
|[[Os02g0187800]]
|10.1104/pp.105.073007
|Increased lodging resistance in long-culm, low-lignin gh2 rice for improved feed and bioenergy production
|Stress
|-
|1221
|''OsABCC1''
|[[Os04g0620000]]
|10.1073/pnas.1414968111
|A rice ABC transporter, OsABCC1, reduces arsenic accumulation in the grain
|Stress
|-
|demo
|demo
|[[Os04g0459000]]
|demo
|demo
|demo
|}

Os02g0674800

2017-03-08T05:42:24Z

Xysj1981:

The rice gene '''Os02g0674800''' is usually called '''''Roc5''''' or '''''oul1'''''. It encodes a protein belonging to the gene family of the Homeodomain Leucine Zipper Class IV, which controls the phynotype "Leaf Rolling" in rice<ref name="ref1" />..

==Annotated Information==
===Function===
The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />.

===Expression===
* '''''Roc5''''' overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells. In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 .

===Evolution===
* '''''Roc5'''''s closest homolog is maize OCL1, with 85.1% amino acid identity.

You can also add sub-section(s) at will.

==Labs working on this gene==
*1.BioSciences Lyon-Gerland, ENS-Lyon, 46 Alle´e d’Italie, F-69364 Lyon Cedex 07, France
*2.Biosciencecente, Nagoya University, Chikusa, Nagoya, Japan
*3.Biotechnology Research Institute/National Key Facility for Genetic Resources and Gene Improvement, CAS, Beijing, China

==References==
<references>
<ref name="ref1">Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.</ref>
<ref name="ref2">Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507.</ref>
<ref name="ref3">Khaled AS, Vernoud V, Ingram GC, Perez P, Sarda X, Rogowsky PM. Engrailed-ZmOCL1 fusions cause a transient reduction of kernel size in maize. Plant Mol Biol 2005;58:123-39.</ref>
</references>

==Structured Information==
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Os02g0674800

2017-03-08T05:41:22Z

Xysj1981: /* Function */

The rice gene '''Os02g0674800''' is usually called '''''Roc5''''' or '''''oul1'''''. It encodes a protein belonging to the gene family of the Homeodomain Leucine Zipper Class IV, which controls the phynotype "Leaf Rolling" in rice<ref name="ref1" />..

==Annotated Information==
===Function===
The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.. However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />.

===Expression===
'''Roc5'''’s closest homolog is maize OCL1, with 85.1% amino acid identity. Roc5 overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells (Fig. 3, B, Q, R, U, and V). In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 (Fig. 6, B, P, S, and T).

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
*1.BioSciences Lyon-Gerland, ENS-Lyon, 46 Alle´e d’Italie, F-69364 Lyon Cedex 07, France
*2.Biosciencecente, Nagoya University, Chikusa, Nagoya, Japan
*3.Biotechnology Research Institute/National Key Facility for Genetic Resources and Gene Improvement, CAS, Beijing, China

==References==
<references>
<ref name="ref1">Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.</ref>
<ref name="ref2">Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507.</ref>
<ref name="ref3">Khaled AS, Vernoud V, Ingram GC, Perez P, Sarda X, Rogowsky PM. Engrailed-ZmOCL1 fusions cause a transient reduction of kernel size in maize. Plant Mol Biol 2005;58:123-39.</ref>
</references>

==Structured Information==
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Os02g0674800

2017-03-08T05:40:54Z

Xysj1981:

The rice gene '''Os02g0674800''' is usually called '''''Roc5''''' or '''''oul1'''''. It encodes a protein belonging to the gene family of the Homeodomain Leucine Zipper Class IV, which controls the phynotype "Leaf Rolling" in rice<ref name="ref1" />..

==Annotated Information==
===Function===
The '''Roc5''' T-DNA insertion knockout mutant oul1 had significantly increased bulliform cell number and size than the wild type (Fig. 1, C–F) <ref name="ref1" />.. However, the position and number of linear bulliform cell files on leaf blades did not change in oul1 (Fig. 1, A and B), indicating that '''Roc5''' plays a role in bulliform cell fate but not its patterning. Consistent with this role, '''Roc5''' is mainly expressed in the L1 layer of the meristem but not in mature leaves and other organs <ref name="ref2" />, suggesting that '''Roc5''' may be involved in the establishment of bulliform cells rather than their maintenance in the adaxial epidermis <ref name="ref1" />.. Although '''Roc5''' has no classical nuclear localization signal, transient expression in onion cells showed that '''Roc5''' is a nuclear protein (Fig. 2, C–H) <ref name="ref1" />.. '''Roc5''' has no transcription activity in yeast <ref name="ref2" /> and was a negative regulator in bulliform cell formation, suggesting that '''Roc5''' may function as a transcriptional repressor. Phylogenetic analyses grouped '''Roc5''' into a subfamily with '''Roc4, Roc6, ZmOCL1, ZmOCL3, AtANL2, and AtHDG1''' <ref name="ref2" /> <ref name="ref3" />..'''Roc5'''’s closest homolog is maize '''OCL1''', with 85.1% amino acid identity <ref name="ref1" />..[[File:Fig.1.jpg|200px|thumb|right|Fig.1 ''oul1'' has increased bulliform cell number and size. A and B, Adaxial epidermal peels abutting the small veins of the wild type (wt; A) and oul1 (B). C to F, Cross sections of wild-type (C) and oul1 (D) mature leaf blades show significantly increased oul1 bulliform cell number (E) and area (F) between vascular bundle ridges. ab, Abaxial; ad, adaxial. Red lines (C and D) show the bulliform cells. Data show means and SD values of biological replicates (n . 23) and statistical analysis by heteroscedastic t test indicating significant differences (** P , 0.01). Bars = 20 mm (A–D). G, Relative water content of the 10th leaf of 120- d-old greenhouse plants grown in the soil. oul1 had higher water content than the wild type. The data are means and SD (n . 5), with statistical analysis using the heteroscedastic t test showing significant differences (** P , 0.01).
]]
===Expression===
'''Roc5'''’s closest homolog is maize OCL1, with 85.1% amino acid identity. Roc5 overexpression led to the adaxially curved leaves and decreased number/size of bulliform cells (Fig. 3, B, Q, R, U, and V). In contrast, the Roc5 cosuppression lines had abaxially rolled leaves, just like oul1 (Fig. 6, B, P, S, and T).

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
*1.BioSciences Lyon-Gerland, ENS-Lyon, 46 Alle´e d’Italie, F-69364 Lyon Cedex 07, France
*2.Biosciencecente, Nagoya University, Chikusa, Nagoya, Japan
*3.Biotechnology Research Institute/National Key Facility for Genetic Resources and Gene Improvement, CAS, Beijing, China

==References==
<references>
<ref name="ref1">Zou LP, Sun XH, Zhang ZG, et al. Leaf rolling controlled by the homeodomain leucine zipper class IV gene Roc5 in rice. Plant physiology 2011;156:1589-602.</ref>
<ref name="ref2">Ito M, Sentoku N, Nishimura A, Hong SK, Sato Y, Matsuoka M (2002) Position dependent expression of GL2-type homeobox gene, Roc1: significance for protoderm differentiation and radial pattern formationin early rice embryogenesis. Plant J 29: 497–507.</ref>
<ref name="ref3">Khaled AS, Vernoud V, Ingram GC, Perez P, Sarda X, Rogowsky PM. Engrailed-ZmOCL1 fusions cause a transient reduction of kernel size in maize. Plant Mol Biol 2005;58:123-39.</ref>
</references>

==Structured Information==
[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]

Test

2017-03-08T05:40:11Z

Xysj1981:

{|class="wikitable" \style="width:90%;text-align:center
|-
!Number
!Gene name
!RAP ID
!DOI
!Reference TitleLDMAR
!Keywords
|-
|1
|''GA2ox3''
|[[Os01g0757200]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|2
|''GA2ox9''
|[[Os02g0630300]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|3
|''GA2ox6''
|[[Os04g0522500]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|4
|''SG1''
|[[Os09g0459200]]
|10.1104/pp.111.187567
|
*Annotated
|-
|5
|''ALS''
|[[Os02g0510200]]
|10.1007/s00299-010-0915-8
|
*Selecting genetic transformants of indica and indica-derived rice cultivars using bispyribac sodium and a mutated ALS gene
|-
|6
|''EL5''
|[[Os02g0559800]]
|10.1111/j.1365-313X.2007.03120.x
|
*SHORT GRAIN1 Decreases Organ Elongation and Brassinosteroid Response in Rice1[W][OA]
|-
|7
|''OASA2''
|[[Os03g0264400]]
|10.1104/pp.111.175778
|
*Application of Gene Targeting to Designed Mutation Breeding of High-Tryptophan Rice1[W][OA]
|-
|8
|''OsGAD2''
|[[Os04g0447800]]
|10.1093/jxb/erm120
|
*C-terminal extension of rice glutamate decarboxylase(OsGAD2) functions as an autoinhibitory domain and overexpression of a truncated mutant results in the accumulation of extremely high levels of GABA in plant cells
|-
|9
|''OsIAA3''
|[[Os12g0601400]]
|10.1111/j.1365-313X.2006.02693.x
|
*Production and characterization of auxin-insensitive rice by overexpression of a mutagenized rice IAA protein
|-
|10
|''IDEF1''
|[[Os08g0101000]]
|10.1111/j.1365-313X.2011.04772.x
|
*Annotated
|-
|11
|''OsPLDα1''
|[[Os01g0172400]]
|10.1111/j.1744-7909.2010.01021.x
|
*Annotated
|-
|12
|''AFT''
|[[Os01g0185300]]
|10.1007/s00425-009-1077-1
|
*Down-regulation of four putative arabinoxylan feruloyl transferase genes from family PF02458 reduces ester-linked ferulate content in rice cell walls
|-
|13
|''OsGAE1''
|[[Os01g0201600]]
|10.1007/s11103-006-9030-1
|
*The rice OsGAE1 is a novel gibberellin-regulated gene and involved in rice growth
|-
|14
|''OsMADS3''
|[[Os01g0201700]]
|10.1023/A:1006051911291
|
*Annotated
|-
|15
|''OsSAMS3''
|[[Os01g0293000]]
|10.1016/j.jplph.2011.05.020
|
*Knockdown of SAMS genes encoding S-adenosyl-l-methionine synthetases causes methylation alterations of DNAs and histones and leads to late flowering in rice
|-
|16
|''OsSAMS2''
|[[Os01g0323600]]
|10.1016/j.jplph.2011.05.020
|
*Knockdown of SAMS genes encoding S-adenosyl-l-methionine synthetases causes methylation alterations of DNAs and histones and leads to late flowering in rice
|-
|17
|''OsACO7''
|[[Os01g0580500]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|18
|''OsrbohA''
|[[Os01g0734466]]
|10.5511/plantbiotechnology.22.127
|
*Function of the rice gp91phox homologs OsrbohA and OsrbohE genes in ROS-dependent plant immune responses
|-
|19
|''Orysa;CycB1;1''
|[[Os01g0805600]]
|10.1007/s00425-009-1051-y
|
*Annotated
|-
|20
|''OsNAC4''
|[[Os01g0816100]]
|10.1038/emboj.2009.39
|
*The transcription factor OsNAC4 is a key positive regulator of plant hypersensitive cell death
|-
|21
|''OsHAP3A''
|[[Os01g0834400]]
|10.1046/j.1365-313X.2003.01897.x
|
*Annotated
|-
|22
|''HDT702''
|[[Os01g0909100]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|23
|''OsDCL1''
|[[Os01g0909200]]
|10.1104/pp.105.063420
|
*Loss of Function of OsDCL1 Affects MicroRNA Accumulation and Causes Developmental Defects in Rice
|-
|24
|''SDG714''
|[[Os01g0927000]]
|10.1105/tpc.106.048124
|
*SDG714, a Histone H3K9 Methyltransferase, Is Involved in Tos17 DNA Methylation and Transposition in Rice
|-
|25
|''rtS''
|[[Os01g0929600]]
|10.1007/s11103-006-9031-0
|
*Annotated
|-
|26
|''Osg1''
|[[Os01g0947700]]
|10.1007/s00425-010-1301-z
|
*A rice �-1,3-glucanase gene Osg1 is required for callose degradation in pollen development
|-
|27
|''NOA1''
|[[Os02g0104700]]
|10.1371/journal.pone.0020015
|
*Annotated
|-
|28
|''OsNOA1?RIF1''
|[[Os02g0104700]]
|10.1111/j.1469-8137.2010.03264.x
|
*Annotated
|-
|29
|''Os4CL3''
|[[Os02g0177600]]
|10.1104/pp.111.178301
|
*Functional Characterization of Evolutionarily Divergent 4-Coumarate:Coenzyme A Ligases in Rice
|-
|30
|''HDA703''
|[[Os02g0214900]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|31
|''HDA710''
|[[Os02g0215200]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|32
|''RPBF''
|[[Os02g0252400]]
|10.1111/j.1365-313X.2009.03925.x
|
*Compensation and interaction between RISBZ1 and RPBF during grain filling in rice
|-
|33
|''DCW11''
|[[Os02g0255100]]
|10.1093/pcp/pcn036
|
*DCW11, Down-Regulated Gene 11 in CW-Type Cytoplasmic Male Sterile Rice,Encoding Mitochondrial Protein Phosphatase 2C is Related to Cytoplasmic Male Sterility
|-
|34
|''OsHARP''
|[[Os02g0256200]]
|10.1007/s00726-008-0043-8
|
*Characterization of a histidine- and alanine-rich protein showing interaction with calreticulin in rice
|-
|35
|''OsGMST1''
|[[Os02g0274900]]
|10.1093/jxb/err178
|
*Annotated
|-
|36
|''OsTudor-SN''
|[[Os02g0523500]]
|10.1111/j.1365-313X.2008.03516.x
|
*The cytoplasmic-localized, cytoskeletal-associated RNA binding protein OsTudor-SN: evidence for an essential role in storage protein RNA transport and localization
|-
|37
|''RAR1''
|[[Os02g0535400]]
|10.1105/tpc.107.055517
|
*Annotated
|-
|38
|''GF14e''
|[[Os02g0580300]]
|10.1111/j.1365-313X.2011.04728.x
|
*Annotated
|-
|39
|''OsNAR2.1''
|[[Os02g0595900]]
|10.1111/j.1365-3040.2011.02335.x
|
*Rice OsNAR2.1 interacts with OsNRT2.1, OsNRT2.2 and OsNRT2.3a nitrate transporters to provide uptake over high and low concentration ranges
|-
|40
|''OsCKI1''
|[[Os02g0622100]]
|10.1046/j.1365-313X.2003.01866.x
|
*Annotated
|-
|41
|''Oscry2''
|[[Os02g0625000]]
|10.1093/pcp/pcj064
|
*Involvement of Rice Cryptochromes in De-etiolation Responses and Flowering
|-
|42
|''OsYSL15''
|[[Os02g0650300]]
|10.1074/jbc.M806042200
|
*Annotated
|-
|43
|''SGL1''
|[[Os02g0762600]]
|10.1104/pp.111.187567
|
*SHORT GRAIN1 Decreases Organ Elongation and Brassinosteroid Response in Rice
|-
|44
|''CEBiP''
|[[Os03g0133400]]
|10.1111/j.1365-313X.2010.04328.x
|
*Perception of the chitin oligosaccharides contributes to disease resistance to blast fungus Magnaporthe oryzae in rice
|-
|45
|''OsPAO''
|[[Os03g0146400]]
|10.1016/j.jplph.2011.05.026
|
*Knockdown of OsPAO and OsRCCR1 cause different plant death phenotypes in rice
|-
|46
|''OsPT2''
|[[Os03g0150800]]
|10.1111/j.1365-313X.2008.03726.x
|
*Two rice phosphate transporters, OsPht1;2 and OsPht1;6, have different functions and kinetic properties in uptake and translocation
|-
|47
|''OsSUT1''
|[[Os03g0170900]]
|10.1093/pcp/pce148
|
*Annotated
|-
|48
|''OsBP-73''
|[[Os03g0183100]]
|10.1023/A:1024854101965
|
*OsBP-73, a rice gene, encodes a novel DNA-binding protein with a SAP-like domain and its genetic interference by double-stranded RNA inhibits rice growth
|-
|49
|''OsMDP1''
|[[Os03g0186600]]
|10.1111/j.1365-313X.2006.02804.x
|
*A brassinolide-suppressed rice MADS-box transcription factor, OsMDP1, has a negative regulatory role in BR signaling
|-
|50
|''RINO1''
|[[Os03g0192700]]
|10.1093/pcp/pcp071
|
*Differential Effects of a Transgene to Confer Low Phytic Acid in Caryopses Located at Different Positions in Rice Panicles
|-
|51
|''OsMADS1''
|[[Os03g0215400]]
|10.1111/j.1365-313X.2009.04101.x
|
*Annotated
|-
|53
|''OsApx1''
|[[Os03g0285700]]
|10.1016/j.phytochem.2010.01.003
|
*Annotated
|-
|54
|''APx1''
|[[Os03g0285700]]
|10.1111/j.1365-3040.2011.02366.x
|
*Annotated
|-
|55
|''OsFAD7''
|[[Os03g0290300]]
|10.1093/pcp/pcm107
|
*Disease Resistance against Magnaporthe grisea is Enhanced in Transgenic Rice with Suppression of u-3 Fatty Acid Desaturases
|-
|57
|''RGB1''
|[[Os03g0669100]]
|10.1111/j.1365-313X.2011.04643.x
|
*Suppression of the rice heterotrimeric G protein b-subunit gene, RGB1, causes dwarfism and browning of internodes and lamina joint regions
|-
|58
|''OsPIPK1''
|[[Os03g0701800]]
|10.1023/B:PLAN.0000028796.14336.24
|
*OsPIPK1, a rice phosphatidylinositol monophosphate kinase, regulates rice heading by modifying the expression of floral induction genes
|-
|59
|''ero1''
|[[Os03g0733800]]
|10.1073/pnas.0904429106
|
*ER membrane-localized oxidoreductase Ero1 is required for disulfide bond formation in the rice endosperm
|-
|60
|''OsSPO11-1''
|[[Os03g0752200]]
|10.1007/s00412-010-0284-7
|
*OsSPO11-1 is essential for both homologous chromosome pairing and crossover formation in rice
|-
|61
|''CysR10''
|[[Os03g0766000]]
|10.1093/pcp/pcr053
|
*A Role for the Cysteine-Rich 10 kDa Prolamin in Protein Body I Formation in Rice
|-
|62
|''OsGLO1''
|[[Os03g0786100]]
|10.1093/jxb/erp056
|
*Inducible antisense suppression of glycolate oxidase reveals its strong regulation over photosynthesis in rice
|-
|63
|''OsMet1''
|[[Os03g0798300]]
|10.1111/j.1365-313X.2008.03624.x
|
*Annotation
|-
|64
|''CYP99A3''
|[[Os04g0178400]]
|10.1111/j.1365-313X.2010.04408.x
|
*Annotation
|-
|65
|''CYP99A2''
|[[Os04g0180400]]
|10.1111/j.1365-313X.2010.04408.x
|
*CYP99A3: functional identification of a diterpene oxidase from the momilactone biosynthetic gene cluster in rice
|-
|66
|''Ostil1''
|[[Os04g0460600]]
|10.1111/j.1469-8137.2007.02177.x
|
*Overexpression of a NAC-domain protein promotes shoot Blackwell Publishing Ltd branching in rice
|-
|67
|''OsPBP1''
|[[Os04g0531100]]
|10.1093/mp/ssn035
|
*A Novel C2-Domain Phospholipid-Binding Protein, OsPBP1, Is Required for Pollen Fertility in Rice
|-
|68
|''YAB3''
|[[Os04g0536300]]
|10.1104/pp.107.095737
|
*Annotation
|-
|69
|''OsACS2''
|[[Os04g0578000]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|70
|''rca''
|[[Os04g0658300]]
|10.1093/aob/mcl025
|
*Annotation
|-
|71
|''OsRMC''
|[[Os04g0659300]]
|10.1111/j.1365-3040.2007.01663.x
|
*Annotation
|-
|72
|''OsMT2b''
|[[Os05g0111300]]
|10.1104/pp.107.110304
|
*Annotation
|-
|73
|''XB3''
|[[Os05g0112000]]
|10.1105/tpc.106.046730
|
*Annotation
|-
|74
|''STAR2''
|[[Os05g0119000]]
|10.1105/tpc.108.064543
|
*Annotation
|-
|75
|''OsSAMS1''
|[[Os05g0135700]]
|10.1016/j.jplph.2011.05.020
|
*Annotation
|-
|76
|''OsACO5''
|[[Os05g0149400]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|77
|''OsBLE3''
|[[Os05g0245300]]
|10.1016/j.phytochem.2006.05.026
|
*OsBLE3, a brassinolide-enhanced gene, is involved in the growth of rice
|-
|78
|''OsMADS4''
|[[Os05g0423400]]
|10.1023/A:1006051911291
|
*Identification of class B and class C floral organ identity genes from rice plants
|-
|79
|''IDEF2''
|[[Os05g0426200]]
|10.1074/jbc.M708732200
|
*A Novel NAC Transcription Factor, IDEF2, That Recognizes the Iron Deficiency-responsive Element 2 Regulates the Genes Involved in Iron Homeostasis in Plants
|-
|81
|''OsHAP3C''
|[[Os05g0573500]]
|10.1046/j.1365-313X.2003.01897.x
|
*Annotated
|-
|82
|''OsRAD21-4''
|[[Os05g0580500]]
|10.1007/s11103-005-4922-z
|
*Annotated
|-
|83
|''OsMAPK6''
|[[Os06g0154500]]
|10.1104/pp.104.057414
|
*A Sphingolipid Elicitor-Inducible Mitogen-Activated Protein Kinase Is Regulated by the Small GTPase OsRac1 and Heterotrimeric G-Protein in Rice
|-
|84
|''RFT1''
|[[Os06g0157500]]
|10.1242/dev.040170
|
*Annotated
|-
|85
|''OsMADS5''
|[[Os06g0162800]]
|10.1111/j.1365-313X.2009.04101.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|86
|''SSIIa''
|[[Os06g0229800]]
|10.1139/g11-010
|
*Annotated
|-
|87
|''OsGSR1''
|[[Os06g0266800]]
|10.1111/j.1365-313X.2008.03707.x
|
*OsGSR1 is involved in crosstalk between gibberellins and brassinosteroids in rice
|-
|89
|''HDA702''
|[[Os06g0583400]]
|10.1016/j.bbrc.2009.07.162
|
*Annotation
|-
|90
|''OsPNH1''
|[[Os06g0597400]]
|10.1046/j.1365-313X.2002.01279.x
|
*OsPNH1 regulates leaf development and maintenance of the shoot apical meristem in rice
|-
|91
|''OsPLDα4''
|[[Os06g0604200]]
|10.1104/pp.111.183749
|
*The Chloroplast-Localized Phospholipases D a4 and a5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice
|-
|92
|''OsPLDα5''
|[[Os06g0604300]]
|10.1104/pp.111.183749
|
*The Chloroplast-Localized Phospholipases D a4 and a5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice
|-
|93
|''OsLIC''
|[[Os06g0704300]]
|10.1371/journal.pone.0003521
|
*OsLIC, a Novel CCCH-Type Zinc Finger Protein with Transcription Activation, Mediates Rice Architecture via Brassinosteroids Signaling
|-
|94
|''OsEIN2''
|[[Os07g0155600]]
|10.1104/pp.109.152702
|
*Annotated
|-
|95
|''HDA704''
|[[Os07g0164100]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|96
|''RISBZ1''
|[[Os07g0182000]]
|10.1111/j.1365-313X.2009.03925.x
|
*Annotated
|-
|97
|''NDP kinase''
|[[Os07g0492000]]
|10.1104/pp.122.2.447
|
*Annotated
|-
|98
|''OsDR8''
|[[Os07g0529600]]
|10.1007/s11103-005-4770-x
|
*Annotated
|-
|99
|''OsFOR1''
|[[Os07g0568700]]
|10.1023/B:PLAN.0000006940.89955.f1
|
*Annotated
|-
|100
|''OsBZR1''
|[[Os07g0580500]]
|10.1073/pnas.0706386104
|
*Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice
|-
|101
|''Osppc4''
|[[Os01g0208700]]
|10.1073/pnas.0913127107
|
*Phosphoenolpyruvate carboxylase intrinsically located in the chloroplast of rice plays a crucial role in ammonium assimilation
|-
|102
|''OsPDK1''
|[[Os07g0637300]]
|10.1093/pcp/pci241
|
*Gibberellin Regulates Mitochondrial Pyruvate Dehydrogenase Activity in Rice
|-
|103
|''OsBLE2''
|[[Os07g0650600]]
|10.1023/A:1025001304994
|
*A novel brassinolide-enhanced gene identified by cDNA microarray is involved in the growth of rice
|-
|104
|''aldolase''
|[[Os07g0650600]]
|10.1007/s11103-004-5920-2
|
*Characterization of fructose-bisphosphate aldolase regulated by gibberellin in roots of rice seedling
|-
|105
|''rtGA2.1''
|[[Os07g0687700]]
|10.1111/j.1365-313X.2005.02457.x
|
*Alteration of TGA factor activity in rice results in enhanced tolerance to Xanthomonas oryzae pv. oryzae
|-
|106
|''OsFAD8''
|[[Os07g0693800]]
|10.1093/pcp/pcm107
|
*Annotated
|-
|107
|''OsApx2''
|[[Os07g0694700]]
|10.1016/j.phytochem.2010.01.003
|
*Annotated
|-
|108
|''APx2''
|[[Os07g0694700]]
|10.1111/j.1365-3040.2011.02366.x
|
*Annotated
|-
|109
|''OsDEG10''
|[[Os08g0139000]]
|10.1016/j.bbrc.2009.01.131
|
*Annotated
|-
|110
|''OsDR10''
|[[Os08g0155900]]
|10.1371/journal.pone.0004603
|
*A Rice Gene of De Novo Origin Negatively Regulates Pathogen-Induced Defense Response
|-
|111
|''OsBAK1''
|[[Os08g0174700]]
|10.1111/j.1467-7652.2009.00444.x
|
*Annotated
|-
|112
|''OsGLP8''
|[[Os08g0189200]]
|10.1104/pp.108.128348
|
*A Germin-Like Protein Gene Family Functions as a Complex Quantitative Trait Locus Conferring Broad-Spectrum Disease Resistance in Rice
|-
|113
|''SSIIIa''
|[[Os08g0191433]]
|10.1139/g11-010
|
*Double repression of soluble starch synthase genes SSIIa and SSIIIa in rice (Oryza sativa L.) uncovers interactive effects on the physicochemical properties of starch
|-
|114
|''OsRAD21-3''
|[[Os08g0266700]]
|10.1111/j.1365-313X.2007.03190.x
|
*OsRAD21-3, an orthologue of yeast RAD21, is required for pollen development in Oryza sativa
|-
|115
|''OsCCC1''
|[[Os08g0323700]]
|10.1007/s11103-011-9744-6
|
*Annotated
|-
|116
|''OsrbohE''
|[[Os08g0453733]]
|10.5511/plantbiotechnology.22.127
|
*Function of the rice gp91phox homologs OsrbohA and OsrbohE genes in ROS-dependent plant immune responses
|-
|117
|''OsHI-LOX''
|[[Os08g0508800]]
|10.1111/j.1365-313X.2009.03988.x
|
*Silencing OsHI-LOX makes rice more susceptible to chewing herbivores, but enhances resistance to a phloem feeder
|-
|118
|''OsAPx-R''
|[[Os08g0522400]]
|10.1111/j.1469-8137.2011.03659.x
|
*Ascorbate peroxidase-related (APx-R) is a new hemecontaining protein functionally associated with ascorbate peroxidase but evolutionarily divergent
|-
|119
|''OsMADS7''
|[[Os08g0531700]]
|10.1111/j.1365-313X.2009.04101.x
|
*Annotated
|-
|120
|''Os8N3''
|[[Os08g0535200]]
|10.1073/pnas.0604088103
|
*Annotated
|-
|121
|''OsCERK1''
|[[Os08g0538300]]
|10.1111/j.1365-313X.2010.04324.x
|
*Two LysM receptor molecules, CEBiP and OsCERK1,cooperatively regulate chitin elicitor signaling in rice
|-
|122
|''OsSPY''
|[[Os08g0559300]]
|10.1111/j.1365-313X.2006.02875.x
|
*Annotated
|-
|123
|''OsPT6''
|[[Os08g0564000]]
|10.1111/j.1365-313X.2008.03726.x
|
*Two rice phosphate transporters, OsPht1;2 and OsPht1;6, have different functions and kinetic properties in uptake and translocation
|-
|124
|''OsMADS8''
|[[Os09g0507200]]
|10.1111/j.1365-313X.2009.04101.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|125
|''OsSGT1''
|[[Os09g0518200]]
|10.1111/j.1365-313X.2008.03697.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|126
|''OsGEN-L''
|[[Os09g0521900]]
|10.1093/pcp/pci090
|
*RNAi-mediated Silencing of OsGEN-L (OsGEN-like), a New Member of the RAD2/XPG Nuclease Family, Causes Male Sterility by Defect of Microspore Development in Rice
|-
|128
|''Ugp1''
|[[Os09g0553200]]
|10.1105/tpc.106.044123
|
*Rice UDP-Glucose Pyrophosphorylase1 Is Essential for Pollen Callose Deposition and Its Cosuppression Results in a New Type of Thermosensitive Genic Male Sterility
|-
|129
|''OsRCCR1''
|[[Os10g0389200]]
|10.1016/j.jplph.2011.05.026
|
*Knockdown of OsPAO and OsRCCR1 cause different plant death phenotypes in rice
|-
|130
|''EBL1''
|[[Os10g0390800]]
|10.1007/s10529-010-0405-7
|
*Phytochrome-regulated EBL1 contributes to ACO1 upregulation in rice
|-
|131
|''OsDCL3b''
|[[Os10g0485600]]
|10.1111/j.1365-313X.2011.04805.x
|
*Roles of DCL4 and DCL3b in rice phased small RNA biogenesis
|-
|132
|''OsPLDbeta1''
|[[Os10g0524400]]
|10.1104/pp.108.131979
|
*Suppression of a Phospholipase D Gene, OsPLDb1,Activates Defense Responses and Increases Disease Resistance in Rice
|-
|134
|''SPK''
|[[Os10g0539600]]
|10.1093/pcp/pch122
|
*A Rice Antisense SPK Transformant that Lacks the Accumulation of Seed Storage Substances Shows no Correlation Between Sucrose Concentration in Phloem Sap and Demand for Carbon Sources in the Sink Organs
|-
|135
|''OsMPK5''
|[[Os11g0684000]]
|10.1104/pp.109.152702
|
*Abscisic Acid-Induced Resistance against the Brown Spot Pathogen Cochliobolus miyabeanus in Rice Involves MAP Kinase-Mediated Repression of Ethylene Signaling
|-
|136
|''OsDMC1''
|[[Os12g0143800]]
|10.1007/s11103-007-9195-2
|
*OsDMC1 is required for homologous pairing in Oryza sativa
|-
|137
|''Ostrxm''
|[[Os12g0188700]]
|10.1104/pp.108.123547
|
*Abnormal Chloroplast Development and Growth Inhibition in Rice Thioredoxin m Knock-Down Plants
|-
|139
|''OsRBCS2''
|[[Os12g0274700]]
|10.1111/j.1365-3040.2011.02434.x
|
*Effect of individual suppression of RBCS multigene family on Rubisco contents in rice leavespce_2434 546..553
|-
|143
|''OsTDL1A''
|[[Os12g0472500]]
|10.1111/j.1365-313X.2008.03426.x
|
*Annotated
|-
|144
|''OsSpo11-4''
|[[Os12g0622500]]
|10.1371/journal.pone.0020327
|
*Annotated
|-
|145
|''OsDOS''
|[[Os01g0192000]]
|10.1104/pp.106.082941
|
*Annotated
|-
|146
|''OsNPR1''
|[[Os01g0194300]]
|10.1007/s11103-010-9695-3
|
*Annotated
|-
|147
|''OsRac1''
|[[Os01g0229400]]
|10.1073/pnas.98.2.759
|
*Essential role of the small GTPase Rac in disease resistance of rice
|-
|148
|''Rdd1''
|[[Os01g0264000]]
|10.1111/j.1365-3040.2009.01954.x
|
*Circadian clock- and phytochrome-regulated Dof-like gene,Rdd1, is associated with grain size in rice
|-
|149
|''OsLOL2''
|[[Os01g0612700]]
|10.1007/s00438-007-0232-2
|
*The rice OsLOL2 gene encodes a zinc Wnger protein involved in rice growth and disease resistance
|-
|150
|''OsYUCCA1''
|[[Os01g0645400]]
|10.1104/pp.106.091561
|
*Auxin Biosynthesis by the YUCCA Genes in Rice
|-
|151
|''PME1''
|[[Os01g0788400]]
|10.1111/j.1365-313X.2011.04486.x
|
*Methanol is an endogenous elicitor molecule for the synthesis of tryptophan and tryptophan-derived secondary metabolites upon senescence of detached rice leaves
|-
|152
|''OsABI5''
|[[Os01g0859300]]
|10.1007/s11103-008-9298-4
|
*Annotated
|-
|153
|''OsNAC6''
|[[Os01g0884300]]
|10.1111/j.1365-313X.2009.03908.x
|
*Annotated
|-
|154
|''OsIRO2''
|[[Os01g0952800]]
|10.1111/j.1365-313X.2007.03149.x
|
*Annotated
|-
|155
|''BiP1''
|[[Os02g0115900]]
|10.1111/j.1365-313X.2010.04453.x
|
*Annotated
|-
|156
|''OsYSL2''
|[[Os02g0649900]]
|10.1111/j.1365-313X.2010.04158.x
|
*Annotated
|-
|157
|''ARAG1''
|[[Os02g0657000]]
|10.1093/aob/mcp303
|
*Annotated
|-
|158
|''OsPIP1;1''
|[[Os02g0666200]]
|10.1038/cr.2007.34
|
*Annotated
|-
|159
|''OsDHODH1''
|[[Os02g0736400]]
|10.1111/j.1744-7909.2009.00853.x
|
*Annotated
|-
|160
|''OsPIN1''
|[[Os02g0743400]]
|10.1093/pcp/pci183
|
*Annotated
|-
|161
|''OsMADS22''
|[[Os02g0761000]]
|10.1111/j.1365-313X.2008.03406.x
|
*Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses
|-
|162
|''AmyI-1''
|[[Os02g0765600]]
|10.1093/pcp/pci091
|
*Annotated
|-
|163
|''OsPIP1;3''
|[[Os02g0823100]]
|10.1038/cr.2007.34
|
*Annotated
|-
|164
|''OsACDR1''
|[[Os03g0160100]]
|10.1007/s10059-009-0161-5
|
*Annotated
|-
|165
|''OsBRR1''
|[[Os03g0228800]]
|10.1007/s00425-009-0951-1
|
*A putative leucine-rich repeat receptor kinase, OsBRR1, is involved in rice blast resistance
|-
|166
|''OsMAPK5''
|[[Os03g0285800]]
|10.1105/tpc.008714
|
*Annotation
|-
|167
|''OsWRKY31''
|[[Os03g0321700]]
|10.1038/cr.2007.104
|
*Constitutive expression of pathogen-inducible OsWRKY31 enhances disease resistance and affects root growth and auxin response in transgenic rice plants
|-
|168
|''OsDIS1''
|[[Os03g0356414]]
|10.1104/pp.111.180893
|
*The SINA E3 Ligase OsDIS1 Negatively Regulates Drought Response in Rice
|-
|169
|''OsLOX1''
|[[Os03g0700700]]
|10.1007/s11103-007-9278-0
|
*A novel lipoxygenase gene from developing rice seeds confers dual position specificity and responds to wounding and insect attack
|-
|170
|''OsSrt1''
|[[Os04g0271000]]
|10.1104/pp.107.099473
|
*Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1, Induces DNA Fragmentation and Cell Death in Rice
|-
|171
|''RERJ1''
|[[Os04g0301500]]
|10.1016/j.bbrc.2004.10.126
|
*Annotated
|-
|172
|''OsGA2ox6''
|[[Os04g0522500]]
|10.1016/S1673-8527(09)60022-9
|
*Annotated
|-
|173
|''RFL''
|[[Os04g0598300]]
|10.1073/pnas.0709059105
|
*Annotated
|-
|174
|''OsrcaA2''
|[[Os04g0658300]]
|10.1006/bbrc.2001.6269
|
*Annotated
|-
|175
|''OsMTP1''
|[[Os05g0128400]]
|10.1007/s00299-011-1140-9
|
*Annotated
|-
|176
|''OsWRKY45''
|[[Os05g0322900]]
|10.1093/jxb/err144
|
*Annotated
|-
|177
|''OsEXP4''
|[[Os05g0477600]]
|10.1105/tpc.011965
|
*Regulation of Expansin Gene Expression Affects Growth and Development in Transgenic Rice Plants
|-
|178
|''SDG728''
|[[Os05g0490700]]
|10.1093/mp/ssq030
|
*Rice SUVH Histone Methyltransferase Genes Display Specific Functions in Chromatin Modification and Retrotransposon Repression
|-
|179
|''OsRan2''
|[[Os05g0574500]]
|10.1093/jxb/erp341
|
*Annotation
|-
|180
|''OsMADS55''
|[[Os06g0217300]]
|10.1111/j.1365-313X.2008.03406.x
|
*Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses
|-
|181
|''OsCIPK23''
|[[Os07g0150700]]
|10.1016/S1673-8527(08)60073-9
|
*Annotated
|-
|182
|''OsTRXh1''
|[[Os07g0186000]]
|10.1104/pp.111.182808
|
*Annotated
|-
|183
|''TDC''
|[[Os08g0140300]]
|10.1104/pp.109.138552
|
*Annotated
|-
|184
|''OsLSD1''
|[[Os08g0159500]]
|10.1094/MPMI-18-0375
|
*Overexpression of OsRAN2 in rice and Arabidopsis renders transgenic plants hypersensitive to salinity and osmotic stress
|-
|185
|''OsDERF1''
|[[Os08g0454000]]
|10.1371/journal.pone.0025216
|
*Annotated
|-
|186
|''OsGLP1''
|[[Os08g0460000]]
|10.1016/j.bbrc.2010.02.142
|
*Functional role of rice germin-like protein1 in regulation of plant height and disease resistance
|-
|187
|''OsPRP3''
|[[Os10g0148100]]
|10.1007/s11103-009-9557-z
|
*OsPRP3, a flower specific proline-rich protein of rice, determines extracellular matrix structure of floral organs and its overexpression confers cold-tolerance
|-
|188
|''OsPT8''
|[[Os10g0444700]]
|10.1104/pp.111.175240
|
*The Phosphate Transporter Gene OsPht1;8 Is Involved in Phosphate Homeostasis in Rice
|-
|189
|''OsWRKY89''
|[[Os11g0117400]]
|10.1007/s11103-007-9244-x
|
*Annotated
|-
|190
|''OsNAC5''
|[[Os11g0184900]]
|10.1007/s00425-011-1403-2
|
*Annotated
|-
|191
|''OsPCBP''
|[[Os11g0689300]]
|10.1007/s12374-011-9184-5
|
*A Calmodulin-Binding Protein from Rice is Essential to Pollen Development
|-
|192
|''OsrcaA1''
|[[Os11g0707000]]
|10.1006/bbrc.2001.6269
|
*Involvement of a Ca21-Dependent Protein Kinase Component Downstream to the Gibberellin-Binding Phosphoprotein, RuBisCO Activase, in Rice
|-
|193
|''sui1''
|[[Os01g0118300]]
|10.1007/s11103-011-9825-6
|
*Identification and characterization of SHORTENED UPPERMOST INTERNODE 1, a gene negatively regulating uppermost internode elongation in rice
|-
|194
|''Osjag''
|[[Os01g0129200]]
|10.1007/s11103-010-9703-7
|
*Molecular cloning and functional characterization of OsJAG gene based on a complete-deletion mutant in rice (Oryza sativa L.)
|-
|195
|''sl1''
|[[Os01g0129200]]
|10.1111/j.1365-313X.2009.03913.x
|
*STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice
|-
|197
|''OsABCG31''
|[[Os01g0177900]]
|10.1073/pnas.1108444108
|
*Annotated
|-
|198
|''OsGI''
|[[Os01g0182600]]
|10.1105/tpc.111.083238
|
*Annotated
|-
|199
|''d2''
|[[Os01g0197100]]
|10.1105/tpc.014712
|
*Annotated
|-
|200
|''mads3''
|[[Os01g0201700]]
|10.1105/tpc.110.074369
|
*Annotated
|-
|201
|''OsGSK1''
|[[Os01g0205700]]
|10.1007/s11103-007-9213-4
|
*Annotated
|-
|202
|''nyc1''
|[[Os01g0227100]]
|10.1105/tpc.106.042911
|
*Annotated
|-
|203
|''OSH6''
|[[Os01g0302500]]
|10.1007/s00425-007-0576-1
|
*A Ds-insertion mutant of OSH6 (Oryza sativa Homeobox 6) exhibits outgrowth of vestigial leaf-like structures, bracts,in rice
|-
|204
|''phd1''
|[[Os01g0367100]]
|10.1371/journal.pgen.1002196
|
*Annotated
|-
|205
|''dbs1''
|[[Os01g0513900]]
|10.1093/pcp/pci206
|
*The Rice Mutant dwarf bamboo shoot 1: A Leaky Mutant of the NACK-type Kinesin-like Gene Can Initiate Organ Primordia but not Organ Development
|-
|206
|''shl2''
|[[Os01g0527600]]
|10.1073/pnas.0704339104
|
|Finishend
*Annotated
|-
|207
|''osubp6''
|[[Os01g0550100]]
|10.1007/s10059-009-0138-4
|
*Structure and Expression of OsUBP6, an Ubiquitin-Specific Protease 6 Homolog in Rice (Oryza sativa L.)
|-
|208
|''log''
|[[Os01g0588900]]
|10.1038/nature05504
|
*Direct control of shoot meristem activity by a cytokinin-activating enzyme
|-
|209
|''osagpl2''
|[[Os01g0633100]]
|10.1007/s11103-007-9153-z
|
*Annotated
|-
|210
|''snl6''
|[[Os01g0639200]]
|10.1371/journal.pgen.1001123
|
*Annotated
|-
|211
|''Ostpc1''
|[[Os01g0678500]]
|10.1093/pcp/pch082
|
*Annotated
|-
|212
|''nadh-gogat1''
|[[Os01g0682001]]
|10.1007/s00726-010-0531-5
|
*Reverse genetics approach to characterize a function of NADH-glutamate synthase1 in rice plants
|-
|213
|''dgl1''
|[[Os01g0683100]]
|10.1104/pp.105.062968
|
*Analysis of the Rice Mutant dwarf and gladius leaf 1. Aberrant Katanin-Mediated Microtubule Organization Causes Up-Regulation of Gibberellin Biosynthetic Genes Independently of Gibberellin Signaling
|-
|214
|''spl28*''
|[[Os01g0703600]]
|10.1111/j.1469-8137.2009.03047.x
|
*Annotated
|-
|215
|''OsLFL''
|[[Os01g0713600]]
|10.1016/j.jplph.2007.07.010
|
*Overexpression of transcription factor OsLFL1 delays flowering time in Oryza sativa
|-
|216
|''d61''
|[[Os01g0718300]]
|10.1105/tpc.12.9.1591
|
*Annotated
|-
|217
|''d10''
|[[Os01g0746400]]
|10.1111/j.1365-313X.2007.03210.x
|
*Annotated
|-
|218
|''Bc7(t)''
|[[Os01g0750300]]
|10.1016/S1673-8527(07)60115-5
|
*Biochemical and molecular characterization of a rice glutelin allele for the GluA-1 gene
|-
|221
|''gamyb''
|[[Os01g0812000]]
|10.1105/tpc.017327
|
*Annotated
|-
|222
|''lax''
|[[Os01g0831000]]
|10.1073/pnas.1932414100
|
*Annotated
|-
|223
|''oscfbp1''
|[[Os01g0866400]]
|10.1111/j.1365-3040.2008.01890.x
|
*Annotated
|-
|224
|''Osabf1''
|[[Os01g0867300]]
|10.1007/s11103-009-9592-9
|
*Annotated
|-
|225
|''Os-pollux''
|[[Os01g0870100]]
|10.1104/pp.108.131540
|
*Antiquity and Function of CASTOR and POLLUX, the Twin Ion Channel-Encoding Genes Key to the Evolution of Root Symbioses in Plants
|-
|226
|''OsPdk1''
|[[Os01g0872800]]
|10.1093/pcp/pcq167
|
*Pdk1 Kinase Regulates Basal Disease Resistance Through the OsOxi1–OsPti1a Phosphorylation Cascade in Rice
|-
|227
|''Osspr1''
|[[Os01g0898300]]
|10.1111/j.1469-8137.2010.03513.x
|
*Annotated
|-
|228
|''eg1''
|[[Os01g0900400]]
|10.1111/j.1365-313X.2008.03710.x
|
*A putative lipase gene EXTRA GLUME1 regulates both empty-glume fate and spikelet development in rice
|-
|229
|''pla2''
|[[Os01g0907900]]
|10.1105/tpc.105.037622
|
*Annotated
|-
|230
|''lhd2''
|[[Os01g0907900]]
|10.1038/sj.cr.7310034
|
*Annotated
|-
|231
|''C3H12''
|[[Os01g0917400]]
|10.1104/pp.111.191379
|
*A CCCH-Type Zinc Finger Nucleic Acid-Binding Protein Quantitatively Confers Resistance against Rice Bacterial Blight Disease
|-
|232
|''msp1''
|[[Os01g0917500]]
|10.1105/tpc.012401
|
*The MSP1 Gene Is Necessary to Restrict the Number of Cells Entering into Male and Female Sporogenesis and to Initiate Anther Wall Formation in Rice
|-
|233
|''OsFRDL4''
|[[Os01g0919100]]
|10.1111/j.1365-313X.2011.04757.x
|
*An Al-inducible MATE gene is involved in external detoxification of Al in rice
|-
|234
|''OsSSI2''
|[[Os01g0919900]]
|10.1094/MPMI-22-7-0820
|
*Annotation
|-
|235
|''OsMADS51''
|[[Os01g0922800]]
|10.1104/pp.107.103291
|
*Annotated
|-
|236
|''se13''
|[[Os01g0949400]]
|10.1007/s00122-010-1426-2
|
*Complete loss of photoperiodic response in the rice mutant line X61 is caused by deWciency of phytochrome chromophore biosynthesis gene
|-
|237
|''LCD''
|[[Os01g0956700]]
|10.1093/jxb/err300
|
*Low cadmium (LCD), a novel gene related to cadmium tolerance and accumulation in rice
|-
|238
|''cde1(t)''
|[[Os02g0121000]]
|10.1007/s00425-007-0525-z
|
*Identification and fine mapping of a thermo-sensitive chlorophyll deficient mutant in rice (Oryza sativa L.)
|-
|239
|''nrat1''
|[[Os02g0131800]]
|10.1073/pnas.1004949107
|
*Annotated
|-
|240
|''lc2''
|[[Os02g0152500]]
|10.1038/cr.2010.109
|
*Annotated
|-
|241
|''Oscand1''
|[[Os02g0167700]]
|10.1093/mp/ssq068
|
*OsCAND1 Is Required for Crown Root Emergence in Rice
|-
|242
|''osgl1-2''
|[[Os02g0178800]]
|10.1007/s11103-009-9483-0
|
*Annotated
|-
|244
|''b-OsLCY''
|[[Os02g0190600]]
|10.1111/j.1365-313X.2008.03411.x
|
*Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|245
|''Docs1''
|[[Os02g0236100]]
|10.1111/j.1365-313X.2011.04824.x
|
*A leucine-rich repeat receptor-like kinase gene is involved in the specification of outer cell layers in rice roots
|-
|246
|''ep3''
|[[Os02g0260200]]
|10.1007/s00122-009-1151-x
|
*Annotated
|-
|247
|''lp''
|[[Os02g0260200]]
|10.1111/j.1467-7652.2011.00610.x
|
*Annotated
|-
|248
|''oscps1''
|[[Os02g0278700]]
|10.1104/pp.103.033696
|
*An Overview of Gibberellin Metabolism Enzyme Genes and Their Related Mutants in Rice
|-
|249
|''naat1''
|[[Os02g0306401]]
|10.1104/pp.107.107912
|
*Mutation in Nicotianamine Aminotransferase Stimulated the Fe(II) Acquisition System and Led to Iron Accumulation in Rice
|-
|250
|''api5''
|[[Os02g0313400]]
|10.1105/tpc.110.082636
|
*Annotated
|-
|251
|''cfl1''
|[[Os02g0516400]]
|10.1105/tpc.111.088625
|
*Annotated
|-
|252
|''osgtgamma-1''
|[[Os02g0542400]]
|10.1007/s00438-009-0507-x
|
*Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses
|-
|253
|''Oscyt-inv1''
|[[Os02g0550600]]
|10.1007/s00425-008-0718-0
|
*OsCYT-INV1 for alkaline/neutral invertase is involved in root cell development and reproductivity in rice (Oryza sativa L.)
|-
|254
|''cpt1''
|[[Os02g0568200]]
|10.1105/tpc.104.028357
|
*The Rice COLEOPTILE PHOTOTROPISM1 Gene Encoding an Ortholog of Arabidopsis NPH3 Is Required for Phototropism of Coleoptiles and Lateral Translocation of Auxin
|-
|255
|''rss1''
|[[Os02g0606700]]
|10.1038/ncomms1279
|
*Annotated
|-
|256
|''OsCOL4''
|[[Os02g0610500]]
|10.1111/j.1365-313X.2010.04226.x
|
*Annotated
|-
|257
|''du3''
|[[Os02g0612300]]
|10.5511/plantbiotechnology.25.483
|
*Du3, a mRNA cap-binding protein gene, regulates amylose content in Japonica rice seeds
|-
|258
|''bc14''
|[[Os02g0614100]]
|10.1073/pnas.1016144108
|
*Golgi nucleotide sugar transporter modulates cell wall biosynthesis and plant growth in rice
|-
|260
|''oul1''
|[[Os02g0674800]]
|10.1104/pp.111.176016
|
*Annotated
|
|-
|261
|''Roc5''
|[[Os02g0674800]]
|10.1104/pp.111.176016
|
*Annotated
|-
|262
|''mfo1''
|[[Os02g0682200]]
|10.1105/tpc.109.068742
|
*Annotated
|-
|263
|''osmads6''
|[[Os02g0682200]]
|10.1111/j.1365-313X.2010.04354.x
|
*Annotated
|-
|265
|''adl1''
|[[Os02g0709400]]
|10.1016/j.ydbio.2009.07.042
|
*Annotated
|-
|266
|''OsGS1;1''
|[[Os02g0735200]]
|10.1111/j.1365-313X.2011.04506.x
|
*Metabolomics data reveal a crucial role of cytosolic glutamine synthetase 1;1 in coordinating metabolic balance in rice
|-
|268
|''bc3''
|[[Os02g0738900]]
|10.1007/s00425-010-1145-6
|
*Annotated
|-
|269
|''dsm1''
|[[Os02g0743500]]
|10.1104/pp.109.149856
|
*Annotated
|-
|270
|''lsi1''
|[[Os02g0745100]]
|10.1038/nature04590
|
*A silicon transporter in rice
|-
|271
|''OsbZIP23''
|[[Os02g0766700]]
|10.1104/pp.108.128199
|
*Annotated
|-
|272
|''pps''
|[[Os02g0771100]]
|10.1105/tpc.111.083436
|
*The COP1 Ortholog PPS Regulates the Juvenile–Adult and Vegetative–Reproductive Phase Changes in Rice
|-
|273
|''Ossgo1''
|[[Os02g0799100]]
|10.1111/j.1365-313X.2011.04615.x
|
*Annotated
|-
|274
|''Ospho1;2''
|[[Os02g0809800]]
|10.1104/pp.109.149872
|
*Characterization of the Rice PHO1 Gene Family Reveals a Key Role for OsPHO1;2 in Phosphate Homeostasis and the Evolution of a Distinct Clade in Dicotyledons
|-
|275
|''osmyoXIB''
|[[Os02g0816900]]
|10.1016/j.ydbio.2007.01.008
|
*ORYZA SATIVA MYOSIN XI B controls pollen development by photoperiod-sensitive protein localizations
|-
|276
|''rtbp1''
|[[Os02g0817800]]
|10.1105/tpc.107.051953
|
*Suppression of RICE TELOMERE BINDING PROTEIN1 Results in Severe and Gradual Developmental Defects Accompanied by Genome Instability in Rice
|-
|277
|''lpa1''
|[[Os02g0819400]]
|10.1007/s00122-008-0818-z
|
*The rice OsLpa1 gene encodes a novel protein involved in phytic acid metabolism
|-
|278
|''dh1''
|[[Os02g0820500]]
|10.1007/s11103-007-9283-3
|
*DH1, a LOB domain-like protein required for glume formation in rice
|-
|279
|''Osa8''
|[[Os03g0100800]]
|10.1093/jxb/ern298
|
*Annotated
|-
|280
|''pair1''
|[[Os03g0106300]]
|10.1105/tpc.020701
|
*The Novel Gene HOMOLOGOUS PAIRING ABERRATION IN RICE MEIOSIS1 of Rice Encodes a Putative Coiled-Coil Protein Required for Homologous Chromosome Pairing in Meiosis
|-
|281
|''lsi2''
|[[Os03g0107300]]
|10.1038/nature05964
|
*An efflux transporter of silicon in rice
|-
|282
|''rim1''
|[[Os03g0119966]]
|10.1111/j.1365-313X.2008.03712.x
|
*Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus
|-
|283
|''osmads50''
|[[Os03g0122600]]
|10.1111/j.1365-313X.2004.02082.x
|
*Annotated
|-
|284
|''dsm2''
|[[Os03g0125100]]
|10.1104/pp.110.163741
|
*Annotated
|-
|285
|''OsCYP96B4''
|[[Os03g0140400]]
|10.1371/journal.pone.0028069
|
*Annotated
|
|-
|286
|''XS-lpa2-1''
|[[Os03g0142800]]
|10.1007/s00122-009-1018-1
|
*Annotated
|-
|287
|''arl1''
|[[Os03g0149100]]
|10.1111/j.1365-313X.2005.02434.x
|
*Annotated
|-
|288
|''crl1''
|[[Os03g0149100]]
|10.1105/tpc.105.030981
|
*Annotated
|-
|289
|''OsEDR1''
|[[Os03g0160100]]
|10.1111/j.1365-3040.2010.02219.x
|
*OsEDR1 negatively regulates rice bacterial resistance via activation of ethylene biosynthesispce
|-
|290
|''oscow1''
|[[Os03g0162000]]
|10.1007/s11103-007-9203-6
|
*NARROW LEAF 7 controls leaf shape mediated by auxin in rice
|-
|291
|''nal7''
|[[Os03g0162000]]
|10.1007/s00438-008-0328-3
|
*NARROW LEAF 7 controls leaf shape mediated by auxin in rice
|-
|292
|''dpw''
|[[Os03g0167600]]
|10.1105/tpc.111.087528
|
*Defective Pollen Wall Is Required for Anther and Microspore Development in Rice and Encodes a Fatty Acyl Carrier Protein Reductase
|-
|293
|''cyp704B2''
|[[Os03g0168600]]
|10.1105/tpc.109.070326
|Annotated
|Development
|-
|294
|''oni1''
|[[Os03g0181500]]
|10.1111/j.1365-313X.2011.04530.x
|
*Annotated
|-
|295
|''OsPDS''
|[[Os03g0184000]]
|10.1111/j.1365-313X.2008.03411.x
|
*Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|296
|''gid2''
|[[Os03g0196500]]
|10.1126/science.1081077
|
*Accumulation of Phosphorylated Repressor for Gibberellin Signaling in an F-box Mutant
|-
|297
|''d88''
|[[Os03g0203200]]
|10.1007/s11103-009-9522-x
|
*Annotated
|-
|298
|''htd2''
|[[Os03g0203200]]
|10.1007/s00425-009-0975-6
|
*Annotated
|-
|299
|''d14''
|[[Os03g0203200]]
|10.1093/pcp/pcp091
|
*Annotated
|-
|300
|''dl''
|[[Os03g0215200]]
|10.1105/tpc.018044
|Annotated
|-
|301
|''lhs1''
|[[Os03g0215400]]
|10.1105/tpc.12.6.871
|
* Annotated
|-
|302
|''OsFRDL1''
|[[Os03g0216700]]
|10.1104/pp.108.128132
|
* OsFRDL1 Is a Citrate Transporter Required for Efficient Translocation of Iron in Rice
|-
|303
|''dsm3''
|[[Os03g0230500]]
|10.1007/s11103-011-9830-9
|
* Annotated
|-
|304
|''Osapc6''
|[[Os03g0236966]]
|10.1007/s10142-009-0155-6
|
* A candidate gene OsAPC6 of anaphase-promoting complex of rice identified through T-DNA insertion
|-
|305
|''rcn1''
|[[Os03g0281900]]
|10.1111/j.1469-8137.2008.02724.x
|
* Annotated
|-
|306
|''mit''
|[[Os03g0296800]]
|10.1038/ncomms1326
|
* The rice mitochondrial iron transporter is essential for plant growth
|-
|307
|''ssd1''
|[[Os03g0302900]]
|10.2183/pjab.86.265
|
* SSD1, which encodes a plant-specific novel protein, controls plant elongation by regulating cell division in rice
|-
|308
|''phyB''
|[[Os03g0309200]]
|10.1105/tpc.105.035899
|
* Annotated
|-
|309
|''oscipk31''
|[[Os03g0319400]]
|10.1007/s10059-010-0084-1
|Annotated
|-
|310
|''v2''
|[[Os03g0320900]]
|10.1111/j.1365-313X.2007.03251.x
|
* The rice nuclear gene, VIRESCENT 2, is essential for chloroplast development and encodes a novel type of guanylate kinase targeted to plastids and mitochondria
|-
|311
|''OschlH''
|[[Os03g0323200]]
|10.1093/pcp/pcg064
|
* Characterization of a Rice Chlorophyll-Deficient Mutant Using the T-DNA Gene-Trap System
|-
|312
|''glu1''
|[[Os03g0329500]]
|10.1007/s11103-005-2972-x
|
* Annotated
|-
|313
|''cwa1/bc1''
|[[Os03g0416200]]
|10.1007/s00425-010-1171-4
|
* Isolation of a novel cell wall architecture mutant of rice with defective Arabidopsis COBL4 ortholog BC1 required for regulated deposition of secondary cell wall components
|-
|314
|''glup4''
|[[Os03g0427300]]
|10.1270/jsbbs.60.556
|
* Characterization of the rice glup4 mutant suggests a role for the small GTPase Rab5 in the biosynthesis of carbon and nitrogen storage reserves in developing endosperm
|-
|315
|''OsAGO7''
|[[Os03g0449200]]
|10.1007/s00425-006-0472-0
|
* Annotated
|-
|316
|''shl4/sho2''
|[[Os03g0449200]]
|10.1073/pnas.0704339104
|
* Annotated
|-
|317
|''chl9''
|[[Os03g0563300]]
|10.1007/s11103-006-9024-z
|
* Rice Chlorina-1 and Chlorina-9 encode ChlD and ChlI subunits of Mg-chelatase, a key enzyme for chlorophyll synthesis and chloroplast development
|-
|318
|''pez1''
|[[Os03g0571900]]
|10.1074/jbc.M111.221168
|
* A Rice phenolic efflux transporter is essential for solubilizing precipitated apoplasmic iron in the plant stele
|-
|321
|''OsIAA11''
|[[Os03g0633500]]
|10.1093/mp/ssr074
|
* A Gain-of-Function Mutation in OsIAA11 Affects Lateral Root Development in Rice
|-
|322
|''Osam1''
|[[Os03g0650400]]
|10.1038/cr.2011.7
|
* OsAM1 is required for leptotene-zygotene transition in rice
|-
|323
|''nol1''
|[[Os03g0654600]]
|10.1111/j.1365-313X.2008.03670.x
|
* Two short-chain dehydrogenase/reductases, NON-YELLOW COLORING 1 and NYC1-LIKE, are required for chlorophyll b and light-harvesting complex II degradation during senescence in rice
|-
|324
|''v1''
|[[Os03g0656900]]
|10.1111/j.1365-313X.2011.04755.x
|
* Annotated
|-
|325
|''crl4''
|[[Os03g0666100]]
|10.3117/plantroot.2.19
|
* CRL4 regulates crown root formation through auxin transport in rice
|-
|327
|''fc1/OsTB1''
|[[Os03g0706500]]
|10.1046/j.1365-313X.2003.01648.x
|
* Annotated
|-
|328
|''slr1''
|[[Os03g0707600]]
|10.1105/tpc.13.5.999
|
* Annotated
|-
|329
|''Slr1-d''
|[[Os03g0707600]]
|10.1007/s00438-008-0406-6
|
* Annotated
|-
|330
|''phyA''
|[[Os03g0719800]]
|10.1105/tpc.105.035899
|
* Distinct and Cooperative Functions of Phytochromes A, B, and C in the Control of Deetiolation and Flowering in Rice
|-
|331
|''OsMIK''
|[[Os03g52760]]
|10.1007/s00122-008-0863-7
|
* Isolation and characterization of a low phytic acid rice mutant reveals a mutation in the rice orthologue of maize MIK
|-
|332
|''phyC''
|[[Os03g0752100]]
|10.1105/tpc.105.035899
|
* Distinct and Cooperative Functions of Phytochromes A, B, and C in the Control of Deetiolation and Flowering in Rice
|-
|333
|''pap2''
|[[Os03g0753100]]
|10.1093/pcp/pcp166
|
* Annotated
|-
|334
|''osmads34''
|[[Os03g0753100]]
|10.1104/pp.110.156711
|
* Annotated
|-
|335
|''pho1''
|[[Os03g0758100]]
|10.1105/tpc.107.054007
|
* Mutation of the Plastidial a-Glucan Phosphorylase Gene in Rice Affects the Synthesis and Structure of Starch in the Endosperm
|-
|336
|''bel''
|[[Os03g0760200]]
|10.1007/s11103-006-0058-z
|
* Annotated
|-
|337
|''DST''
|[[Os03g0786400]]
|10.1101/gad.1812409
|
* Annotated
|-
|338
|''pla3/gp''
|[[Os03g0790600]]
|10.1111/j.1365-313X.2009.03841.x
|
* PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in rice
|-
|339
|''el1''
|[[Os03g0793500]]
|10.1038/emboj.2010.75
|
* Annotated
|-
|340
|''chl1''
|[[Os03g0811100]]
|10.1007/s11103-006-9024-z
|
* Annotated
|-
|341
|''OsIDS1''
|[[Os03g0818800]]
|10.1111/j.1365-313X.2011.04804.x
|
* Two AP2 family genes, SUPERNUMERARY BRACT (SNB) and OsINDETERMINATE SPIKELET 1 (OsIDS1), synergistically control inflorescence architecture and floral meristem establishment in rice
|-
|342
|''Xb15''
|[[Os03g0821300]]
|10.1371/journal.pbio.0060231
|
* Rice XB15, a Protein Phosphatase 2C, Negatively Regulates Cell Death and XA21-Mediated Innate Immunity Chang
|-
|343
|''Os-castor''
|[[Os03g0843600]]
|10.1104/pp.108.131540
|
* Antiquity and Function of CASTOR and POLLUX, the Twin Ion Channel-Encoding Genes Key to the Evolution of Root Symbioses in Plants
|-
|345
|''etr2''
|[[Os04g0169100]]
|10.1105/tpc.108.065391
|
* The Ethylene Receptor ETR2 Delays Floral Transition and Affects Starch Accumulation in Rice
|-
|346
|''OsYSL6''
|[[Os04g0390500]]
|10.1104/pp.111.186031
|* OsYSL6 Is Involved in the Detoxification of Excess Manganese in Rice1[W][OA]
|-
|347
|''lax2''
|[[Os04g0396500]]
|10.1105/tpc.111.088765
|
* LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems
|-
|348
|''ACL1''
|[[Os04g0415000]]
|10.1093/mp/ssq022
|
* Annotated
|-
|349
|''zep1''
|[[Os04g0452500]]
|10.1105/tpc.109.070789
|
* Annotated
|-
|350
|''tdd1''
|[[Os04g0463500]]
|10.1111/j.1365-313X.2009.03952.x
|
* A rice tryptophan deficient dwarf mutant, tdd1, contains a reduced level of indole acetic acid and develops abnormal flowers and organless embryos
|-
|351
|''d11''
|[[Os04g0469800]]
|10.1105/tpc.104.024950
|
* Annotated
|-
|352
|''OsGLU3''
|[[Os04g0497200]]
|10.1093/mp/ssr084
|
* OsGLU3, a putative membrane-bound endo-1,4-beta-glucanase, is required for root cell elongation and division in rice (Oryza sativa L.)
|-
|353
|''OsDCL4''
|[[Os04g0509300]]
|10.1105/tpc.107.052209
|
* Oryza sativa Dicer-like4 Reveals a Key Role for Small Interfering RNA Silencing in Plant Development
|-
|355
|''TOB1''
|[[Os04g0536300]]
|10.1105/tpc.111.094797
|
* The YABBY Gene TONGARI-BOUSHI1 Is Involved in Lateral Organ Development and Maintenance of Meristem Organization in the Rice Spikelet
|-
|356
|''Osvpe1''
|[[Os04g0537900]]
|10.1111/j.1365-313X.2009.03801.x
|
* The vacuolar processing enzyme OsVPE1 is required for efficient glutelin processing in rice
|-
|357
|''d17''
|[[Os04g0550600]]
|10.1038/nature07272
|
* Inhibition of shoot branching by new terpenoid plant hormones
|-
|359
|''OsCPK12''
|[[Os04g0560600]]
|10.1111/j.1365-313X.2011.04766.x
|
* Annotated
|-
|360
|''glr3.1''
|[[Os04g0585200]]
|10.1105/tpc.105.037713
|
* Annotated
|-
|361
|''apo2''
|[[Os04g0598300]]
|10.1111/j.1365-313X.2011.04781.x
|
* ABERRANT PANICLE ORGANIZATION 2/RFL, the rice ortholog of Arabidopsis LEAFY, suppresses the transition from inflorescence meristem to floral meristem through interaction with APO1
|-
|362
|''rlin1''
|[[Os04g0610800]]
|10.1016/j.jcg.2010.12.001
|
* RLIN1, encoding a putative coproporphyrinogen III oxidase, is involved in lesion initiation in rice
|-
|363
|''osks1''
|[[Os04g0611800]]
|10.1104/pp.103.033696
|
* An Overview of Gibberellin Metabolism Enzyme Genes and Their Related Mutants in Rice
|-
|364
|''fc1''
|[[Os04g0612700]]
|10.1007/s11103-008-9448-8
|
* FLEXIBLE CULM 1 encoding a cinnamyl-alcohol dehydrogenase controls culm mechanical strength in rice
|-
|366
|''ili1''
|[[Os04g0641700]]
|10.1105/tpc.109.070441
|
* Antagonistic HLH/bHLH Transcription Factors Mediate Brassinosteroid Regulation of Cell Elongation and Plant Development in Rice and Arabidopsis
|-
|367
|''flo2''
|[[Os04g0645100]]
|10.1105/tpc.109.070821
|
* Annotation
|-
|368
|''OsCP1''
|[[Os04g0670500]]
|10.1023/B:PLAN.0000040904.15329.29
|
* Isolation and characterization of a rice cysteine protease gene, OsCP1, using T-DNA gene-trap system
|-
|369
|''OsARF12''
|[[Os04g0671900]]
|10.1111/j.1469-8137.2011.03910.x
|
* Annotation
|-
|370
|''OsMKP1''
|[[Os05g0115800]]
|10.1093/pcp/pcm007
|
* A Calmodulin-Binding Mitogen-Activated Protein Kinase Phosphatase is Induced by Wounding and Regulates the Activities of Stress-Related Mitogen-Activated Protein Kinases in Rice
|-
|371
|''rsr1''
|[[Os05g0121600]]
|10.1104/pp.110.159517
|
* Coexpression Analysis Identifies Rice Starch Regulator1, a Rice AP2/EREBP Family Transcription Factor, as a Novel Rice Starch Biosynthesis Regulator1
|-
|372
|''siz1''
|[[Os05g0125000]]
|10.1111/j.1469-8137.2010.03538.x
|
* Annotation
|-
|373
|''srs3''
|[[Os05g0154700]]
|10.1093/pcp/pcq092
|
* Annotation
|-
|374
|''bc10''
|[[Os05g0170000]]
|10.1111/j.1365-313X.2008.03703.x
|
* BC10, a DUF266-containing and Golgi-located type II membrane protein, is required for cell-wall biosynthesis in rice (Oryza sativa L.)
|-
|375
|''mads58''
|[[Os05g0203800]]
|10.1105/tpc.111.087262
|
* ??Rice MADS6 Interacts with the Floral Homeotic Genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in Specifying Floral Organ Identities and Meristem Fate
|-
|376
|''d1''
|[[Os05g0333200]]
|10.1073/pnas.96.18.10284
|
* Annotation
|-
|377
|''ygl1''
|[[Os05g0349700]]
|10.1104/pp.107.100321
|
* Annotation
|-
|378
|''OsImpβ1''
|[[Os05g0353400]]
|10.1007/s10059-011-2321-7
|
* Rice Importin β1 Gene Affects Pollen Tube Elongation
|-
|379
|''osbc1l4''
|[[Os05g0386800]]
|10.1007/s11103-009-9537-3
|
* Molecular characterization, expression pattern, and function analysis of the OsBC1L family in rice
|-
|380
|''flo4''
|[[Os05g0405000]]
|10.1111/j.1365-313X.2005.02423.x
|
* White-core endosperm floury endosperm-4 in rice is generated by knockout mutations in the C4-type pyruvate orthophosphate dikinase gene (OsPPDKB)
|-
|382
|''gid1''
|[[Os05g0407500]]
|10.1038/nature04028
|
* Annotation
|-
|383
|''DNG701''
|[[Os05g0446000]]
|10.1073/pnas.1112704108
|
* A 5-methylcytosine DNA glycosylase/lyase demethylates the retrotransposon Tos17 and promotes its transposition in rice
|-
|384
|''bgl''
|[[Os05g0454200]]
|10.1007/s11103-011-9839-0
|
* The rice bright green leaf (bgl) locus encodes OsRopGEF10, which activates the development of small cuticular papillae on leaf surfaces
|-
|385
|''oszip5''
|[[Os05g0472700]]
|10.1007/s11103-010-9637-0
|
* OsZIP5 is a plasma membrane zinc transporter in rice
|-
|386
|''eui1''
|[[Os05g0482400]]
|10.1093/pcp/pci233
|
* Annotation
|-
|389
|''spl7''
|[[Os05g0530400]]
|10.1073/pnas.112209199
|
* Annotation
|-
|390
|''snrk1a''
|[[Os05g0530500]]
|10.1105/tpc.105.037887
|
* The SnRK1A Protein Kinase Plays a Key Role in Sugar Signaling during Germination and Seedling Growth of Rice
|-
|391
|''ltn1''
|[[Os05g0557700]]
|10.1104/pp.110.170209
|
*Annotated
|-
|392
|''nl1''
|[[Os05g0578900]]
|10.1038/cr.2009.36
|
* NECK LEAF 1, a GATA type transcription factor, modulates organogenesis by regulating the expression of multiple regulatory genes during reproductive development in rice
|-
|393
|''Osrec8''
|[[Os05g0580500]]
|10.1104/pp.111.177428
|
* Annotated
|-
|394
|''osjar1''
|[[Os05g0586200]]
|10.1111/j.1365-3040.2008.01790.x
|
* Annotated
|-
|395
|''Osexpa17''
|[[Os06g0108600]]
|10.1111/j.1365-313X.2011.04533.x
|
* Root hair-specific expansins modulate root hair elongation in rice
|-
|398
|''zn''
|[[Os06g0116400]]
|10.1111/j.1365-313X.2010.04183.x
|
* ZEBRA-NECROSIS, a thylakoid-bound protein, is critical for the photoprotection of developing chloroplasts during early leaf development
|-
|399
|''osbbi1''
|[[Os06g0125800]]
|10.1038/cr.2011.4
|
* Annotated
|-
|400
|''d62/dlt''
|[[Os06g0127800]]
|10.1007/s00425-010-1263-1
|
* Annotated
|-
|402
|''sik1''
|[[Os06g0130100]]
|10.1111/j.1365-313X.2010.04146.x
|
* Annotated
|-
|403
|''dp1''
|[[Os06g0136900]]
|10.1016/j.ydbio.2011.08.023
|
* An AT-hook gene is required for palea formation and floral organ number control in rice
|-
|404
|''d3''
|[[Os06g0154200]]
|10.1093/pcp/pci022
|
* Suppression of Tiller Bud Activity in Tillering Dwarf Mutants of Rice
|-
|405
|''OsSSI''
|[[Os06g0160700]]
|10.1104/pp.105.071845
|
* Annotated
|-
|406
|''v3''
|[[Os06g0168600]]
|10.1104/pp.109.136648
|
* Rice Virescent3 and Stripe1 Encoding the Large and Small Subunits of Ribonucleotide Reductase Are Required for Chloroplast Biogenesis during Early Leaf Development
|-
|407
|''aid1''
|[[Os06g0181300]]
|10.1104/pp.104.041459
|
* The ANTHER INDEHISCENCE1 Gene Encoding a Single MYB Domain Protein Is Involved in Anther Development in Rice
|-
|408
|''abl1''
|[[Os06g0211200]]
|10.1104/pp.111.173427
|
* Annotated
|-
|409
|''Osabf2''
|[[Os06g0211200]]
|10.1016/j.jplph.2010.05.008
|
* Annotated
|-
|410
|''lsi6''
|[[Os06g0228200]]
|10.1105/tpc.108.059311
|
* A Transporter Regulating Silicon Distribution in Rice Shoots
|-
|411
|''st1''
|[[Os06g0257450]]
|10.1104/pp.109.136648
|
* Rice Virescent3 and Stripe1 Encoding the Large and Small Subunits of Ribonucleotide Reductase Are Required for Chloroplast Biogenesis during Early Leaf Development
|-
|412
|''nyc3''
|[[Os06g0354700]]
|10.1111/j.1365-313X.2009.03919.x
|
* Defect in non-yellow coloring 3, an a/b hydrolase-fold family protein, causes a stay-green phenotype during leaf senescence in rice
|-
|413
|''d35''
|[[Os06g0569500]]
|10.1023/B:PLAN.0000038261.21060.47
|
* Annotated
|-
|414
|''OsIAA23''
|[[Os06g0597000]]
|10.1111/j.1365-313X.2011.04698.x
|
* Annotated
|-
|415
|''se5''
|[[Os06g0603000]]
|10.1046/j.1365-313X.2000.00753.x
|
* Annotated
|-
|416
|''moc1''
|[[Os06g0610350]]
|10.1038/nature01518
|
* Annotated
|-
|417
|''spp''
|[[Os06g0625400]]
|10.1093/pcp/pcq012
|
* A Rice Stromal Processing Peptidase Regulates Chloroplast and Root Development
|-
|418
|''apo1''
|[[Os06g0665400]]
|10.1111/j.1365-313X.2007.03200.x
|
* Rice ABERRANT PANICLE ORGANIZATION 1, encoding an F-box protein, regulates meristem fate
|-
|419
|''oshma9''
|[[Os06g0665800]]
|10.1104/pp.107.102236
|
* Annotated
|-
|420
|''dep3''
|[[Os06g0677000]]
|10.1007/s00122-011-1543-6
|
* Fine mapping and candidate gene analysis of dense and erect panicle 3, DEP3, which confers high grain yield in rice (Oryza sativa L.)
|-
|421
|''star1''
|[[Os06g0695800]]
|10.1105/tpc.108.064543
|
* Annotated
|-
|422
|''OsHMA2''
|[[Os06g0700700]]
|10.1093/pcp/pcr166
|
* Annotated
|-
|423
|''oshkt2;1''
|[[Os06g0701700]]
|10.1038/sj.emboj.7601732
|
* Annotated
|-
|424
|''spw1''
|[[Os06g0712700]]
|10.1242/dev.00294
|
* Annotated
|-
|425
|''fon1''
|[[Os06g0717200]]
|10.1242/dev.01441
|
* The gene FLORAL ORGAN NUMBER1 regulates floral meristem size in rice and encodes a leucine-rich repeat receptor kinase orthologous to Arabidopsis CLAVATA1
|-
|426
|''ila1''
|[[Os06g0724900]]
|10.1105/tpc.111.093419
|
* Annotated
|-
|427
|''GA2ox5''
|[[Os07g0103500]]
|10.1105/tpc.108.060913
|
* A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice
|-
|428
|''crl5''
|[[Os07g0124700]]
|10.1111/j.1365-313X.2011.04610.x
|
|* Finished
|-
|429
|''g1''
|[[Os07g0139300]]
|10.1073/pnas.0907896106
|
* The homeotic gene long sterile lemma (G1) specifies sterile lemma identity in the rice spikelet
|-
|430
|''waf1''
|[[Os07g0164000]]
|10.1104/pp.110.160234
|
* Annotated
|-
|431
|''osku70''
|[[Os07g0184900]]
|10.1104/pp.109.150391
|
* OsKu70 Is Associated with Developmental Growth and Genome Stability in Rice
|-
|432
|''OsPHF1''
|[[Os07g0187700]]
|10.1104/pp.111.181669
|
* OsPHF1 Regulates the Plasma Membrane Localization of Low- and High-Affinity Inorganic Phosphate Transporters and Determines Inorganic Phosphate Uptake and Translocation in Rice
|-
|433
|''STR2''
|[[Os07g0191600]]
|10.1111/j.1365-313X.2011.04842.x
|
* The half-size ABC transporters STR1 and STR2 are indispensable for mycorrhizal arbuscule formation in rice
|-
|434
|''OsZDS''
|[[Os07g0204900]]
|10.1111/j.1365-313X.2008.03411.x
|
* Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|435
|''sh-h''
|[[Os07g0207700]]
|10.1111/j.1365-313X.2009.04039.x
|
* Inactivation of the CTD phosphatase-like gene OsCPL1 enhances the development of the abscission layer and seed shattering in rice
|-
|436
|''OsZIP8''
|[[Os07g0232800]]
|10.1007/s10059-010-0069-0
|
* Zinc Deficiency-Inducible OsZIP8 Encodes a Plasma Membrane-Localized Zinc Transporter in Rice
|-
|437
|''snb''
|[[Os07g0235800]]
|10.1111/j.1365-313X.2006.02941.x
|
* The rice heterochronic gene SUPERNUMERARY BRACT regulates the transition from spikelet meristem to floral meristem
|-
|438
|''oscbt''
|[[Os07g0490200]]
|10.1007/s10059-009-0081-4
|
* The Calmodulin-Binding Transcription Factor OsCBT Suppresses Defense Responses to Pathogens in Rice
|-
|439
|''oswrky78''
|[[Os07g0583700]]
|10.1007/s00425-011-1423-y
|
* The WRKY transcription factor OsWRKY78 regulates stem elongation and seed development in rice
|-
|440
|''bui1''
|[[Os07g0596300]]
|10.1105/tpc.110.081802
|
* Annotated
|-
|441
|''dep2''
|[[Os07g0616000]]
|10.1038/cr.2010.69
|
* Annotated
|-
|442
|''srs1''
|[[Os07g0616000]]
|10.1266/ggs.85.327
|
* Annotated
|-
|445
|''rth1''
|[[Os07g0682800]]
|10.1270/jsbbs.59.13
|
* Annotated
|-
|446
|''wox11''
|[[Os07g0684900]]
|10.1105/tpc.108.061655
|
* The WUSCHEL-Related Homeobox Gene WOX11 Is Required to Activate Shoot-Borne Crown Root Development in Rice
|-
|447
|''OsNAS3''
|[[Os07g0689600]]
|10.1073/pnas.0910950106
|
* Iron fortification of rice seeds through activation of the nicotianamine synthase gene
|-
|448
|''ehd3''
|[[Os08g0105000]]
|10.1111/j.1365-313X.2011.04517.x
|
* Annotated
|-
|449
|''pss1''
|[[Os08g0117000]]
|10.1105/tpc.109.073692
|
* Annotated
|-
|450
|''cyp703a3''
|[[Os08g0131100]]
|10.1105/tpc.108.062935
|
* Annotated
|-
|451
|''crr6''
|[[Os08g0167500]]
|10.1111/j.1365-313X.2011.04747.x
|
* Annotated
|-
|453
|''ss3a''
|[[Os08g0191433]]
|10.1093/jxb/err125
|
* Annotated
|-
|454
|''osagps2''
|[[Os08g0345800]]
|10.1007/s11103-007-9153-z
|
* Annotated
|-
|455
|''GF14c''
|[[Os08g0430500]]
|10.1093/pcp/pcp012
|
* The 14-3-3 Protein GF14c Acts as a Negative Regulator of Flowering in Rice by Interacting with the Florigen Hd3a
|-
|456
|''coe1''
|[[Os08g0442700]]
|10.1111/j.1365-313X.2010.04250.x
|
* COE1, an LRR–RLK responsible for commissural vein pattern formation in rice
|-
|457
|''bc12''
|[[Os09g0114500]]
|10.1111/j.1365-313X.2010.04238.x
|
* Annotated
|-
|458
|''gdd1''
|[[Os09g0114500]]
|10.1105/tpc.110.081901
|
* Annotated
|-
|459
|''sll1''
|[[Os09g0395300]]
|10.1105/tpc.108.061457
|
* Annotated
|-
|460
|''rl9''
|[[Os09g0395300]]
|10.1007/s11103-008-9365-x
|
* Annotated
|-
|461
|''STR1''
|[[Os09g0401100]]
|10.1111/j.1365-313X.2011.04842.x
|
* Annotated
|-
|462
|''rep1''
|[[Os09g0410500]]
|10.1104/pp.108.128231
|
* RETARDED PALEA1 Controls Palea Development and Floral Zygomorphy in Rice
|-
|463
|''bc6''
|[[Os09g0422500]]
|10.1093/jxb/erq395
|
* Annotated
|-
|464
|''OsCesA9''
|[[Os09g0422500]]
|10.1104/pp.103.022442
|
* Annotated
|-
|465
|''osgl1-1''
|[[Os09g0426800]]
|10.1093/mp/ssr028
|
* Annotated
|-
|466
|''wsl2''
|[[Os09g0426800]]
|10.1007/s00425-011-1481-1
|
* Annotated
|-
|470
|''PTC1''
|[[Os09g0449000]]
|10.1104/pp.111.175760
|
* Annotated
|-
|471
|''aco1''
|[[Os09g0451000]]
|10.1111/j.1365-3040.2009.02106.x
|
* ACO1, a gene for aminocyclopropane-1-carboxylate oxidase: effects on internode elongation at the heading stage in rice
|-
|472
|''isa3''
|[[Os09g0469400]]
|10.1093/pcp/pcr058
|
* Rice Debranching Enzyme Isoamylase3 Facilitates Starch Metabolism and Affects Plastid Morphogenesis
|-
|473
|''gna1''
|[[Os09g0488000]]
|10.1104/pp.104.058248
|
* A Novel Short-Root Gene Encodes a Glucosamine-6-Phosphate Acetyltransferase Required for Maintaining Normal Root Cell Shape in Rice
|-
|474
|''PAIR2''
|[[Os09g0506800]]
|10.1007/s00438-003-0934-z
|
* An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis
|-
|475
|''sgr''
|[[Os09g0532000]]
|10.1105/tpc.106.044891
|
* The Senescence-Induced Staygreen Protein Regulates Chlorophyll Degradation
|-
|476
|''OsAT1/Spl18''
|[[Os10g0195600]]
|10.1007/s11103-006-9130-y
|
* Isolation and molecular characterization of a Spotted leaf 18 mutant by modified activation-tagging in rice
|-
|477
|''brd2''
|[[Os10g0397400]]
|10.1105/tpc.105.030973
|
* Annotated
|-
|478
|''pla1''
|[[Os10g0403000]]
|10.1073/pnas.2636936100
|
* Annotated
|-
|479
|''pair3''
|[[Os10g0405500]]
|10.1111/j.1365-313X.2009.03870.x
|
* Annotated
|-
|480
|''ehd2''
|[[Os10g0419200]]
|10.1104/pp.108.125542
|
* Annotated
|-
|481
|''rid1''
|[[Os10g0419200]]
|10.1073/pnas.0806019105
|
* Annotated
|-
|482
|''OsCesA7''
|[[Os10g0467800]]
|10.1104/pp.103.022442
|
* Annotated
|-
|483
|''wda1''
|[[Os10g0471100]]
|10.1105/tpc.106.042044
|
* Wax-deficient anther1 Is Involved in Cuticle and Wax Production in Rice Anther Walls and Is Required for Pollen Development
|-
|484
|''OsMPK6''
|[[Os10g0533600]]
|10.1007/s00425-007-0541-z
|
* Annotated
|-
|485
|''OsCAO1''
|[[Os10g0567200]]
|10.1007/s11103-005-2066-9
|
* Annotated
|-
|486
|''cao''
|[[Os10g0567400]]
|10.1270/jsbbs.55.361
|
* Annotated
|-
|487
|''jmj6''
|[[Os10g0577600]]
|10.1073/pnas.0805901105
|
* Annotated
|-
|488
|''OsCSLD1''
|[[Os10g0578200]]
|10.1104/pp.106.091546
|
* OsCSLD1, a Cellulose Synthase-Like D1 Gene, Is Required for Root Hair Morphogenesis in Rice
|-
|489
|''phot1a''
|[[Os11g0102200]]
|10.1007/s11103-008-9442-1
|
* Rice phot1a mutation reduces plant growth by affecting photosynthetic responses to light during early seedling growth
|-
|490
|''OsPK1''
|[[Os11g0148500]]
|10.1007/s00425-011-1471-3
|
* Annotated
|-
|491
|''PDIL1''
|[[Os11g0199200]]
|10.1093/jxb/err262
|
* The failure to express a protein disulphide isomerase-like protein results in a floury endosperm and an endoplasmic reticulum stress response in rice
|-
|492
|''rad''
|[[Os11g0210300]]
|10.1270/jsbbs.56.69
|
* Annotated
|-
|493
|''sp1''
|[[Os11g0235200]]
|10.1111/j.1365-313X.2009.03799.x
|
* Annotated
|-
|494
|''Tid1''
|[[Os11g0247300]]
|10.1266/ggs.84.209
|
* Annotated
|-
|495
|''nls1-1D''
|[[Os11g0249000]]
|10.1111/j.1365-313X.2011.04557.x
|
* Annotated
|-
|496
|''lazy1''
|[[Os11g0490600]]
|10.1038/cr.2007.38
|
* Annotated
|-
|497
|''osarf1''
|[[Os11g0523800]]
|10.1007/s11103-009-9474-1
|
* Annotated
|-
|498
|''tld1-D''
|[[Os11g0528700]]
|10.1104/pp.109.146803
|
* Altered Architecture and Enhanced Drought Tolerance in Rice via the Down-Regulation of Indole-3-Acetic Acid by TLD1/OsGH3.13 Activation
|-
|501
|''d27''
|[[Os11g0587000]]
|10.1105/tpc.109.065987
|
* Annotated
|-
|502
|''fon2''
|[[Os11g0595400]]
|10.1093/pcp/pcl025
|
* Conservation and Diversification of Meristem Maintenance Mechanism in Oryza sativa: Function of the FLORAL ORGAN NUMBER2 Gene
|-
|503
|''wdl1''
|[[Os11g0708400]]
|10.1007/s11103-010-9656-x
|
* Mutation in Wilted Dwarf and Lethal 1 (WDL1) causes abnormal cuticle formation and rapid water loss in rice
|-
|504
|''rip1''
|[[Os12g0132400]]
|10.1093/pcp/pcl013
|
* Rice Immature Pollen 1 (RIP1) is a Regulator of Late Pollen Development
|-
|505
|''art1''
|[[Os12g0170400]]
|10.1105/tpc.109.070771
|
* A Zinc Finger Transcription Factor ART1 Regulates Multiple Genes Implicated in Aluminum Tolerance in Rice
|-
|506
|''OsMADS13''
|[[Os12g0207000]]
|10.1111/j.1365-313X.2007.03272.x
|
* The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice
|-
|507
|''ogr1''
|[[Os12g0270200]]
|10.1111/j.1365-313X.2009.03909.x
|
* Rice OGR1 encodes a pentatricopeptide repeat–DYW protein and is essential for RNA editing in mitochondria
|-
|508
|''osatg10b''
|[[Os12g0506800]]
|10.1007/s10059-009-0006-2
|
* Annotated
|-
|509
|''kch1''
|[[Os12g0547500]]
|10.1093/jxb/erq164
|
* A kinesin with calponin-homology domain is involved in premitotic nuclear migration
|-
|513
|''spl11''
|[[Os12g0570000]]
|10.1105/tpc.108.058610
|
* SPIN1, a K Homology Domain Protein Negatively Regulated and Ubiquitinated by the E3 Ubiquitin Ligase SPL11, Is Involved in Flowering Time Control in Rice
|-
|514
|''mel2''
|[[Os12g0572800]]
|10.1371/journal.pgen.1001265
|
* A Novel RNA-Recognition-Motif Protein Is Required for Premeiotic G1/S-Phase Transition in Rice (Oryza sativa L.)
|-
|515
|''gpa1''
|[[Os12g0631100]]
|10.1111/j.1365-313X.2010.04370.x
|
* OsRab5a regulates endomembrane organization and storage protein trafficking in rice endosperm cells
|-
|516
|''ossut2''
|[[Os12g0641400]]
|10.1104/pp.111.176982
|
* Annotated
|-
|517
|''d18''
|[[Os01g0177400]]
|10.1073/pnas.141239398
|
* Annotated
|-
|518
|''Gn1a''
|[[Os01g0197700]]
|10.1126/science.1113373
|
* Cytokinin Oxidase Regulates Rice Grain Production
|-
|520
|''SKC1''
|[[Os01g0307500]]
|10.1038/ng1643
|
* Annotated
|-
|521
|''PSR''
|[[Os01g0357100]]
|10.1073/pnas.0504220102
|
* Isolation of a rice regeneration quantitative trait loci gene and its application to transformation systems
|-
|522
|''SaF''
|[[Os01g0578500]]
|10.1073/pnas.0810108105
|
* Annotated
|-
|523
|''SaM''
|[[Os01g0578700]]
|10.1073/pnas.0810108105
|
* Hybrid male sterility in rice controlled by interaction between divergent alleles of two adjacent genes
|-
|524
|''Rd''
|[[Os01g0633500]]
|10.1111/j.1365-313X.2006.02958.x
|
* The Rc and Rd genes are involved in proanthocyanidin synthesis in rice pericarp
|-
|525
|''Pi37''
|[[Os01g0781700]]
|10.1534/genetics.107.080648
|
* The Blast Resistance Gene Pi37 Encodes a Nucleotide Binding Site–Leucine-Rich Repeat Protein and Is a Member of a Resistance Gene Cluster on Rice Chromosome 1
|-
|526
|''qSH1''
|[[Os01g0848400]]
|10.1126/science.1126410
|
* Annotated
|-
|527
|''qNPQ1-2''
|[[Os01g0869800]]
|10.1073/pnas.1104809108
|
|Finished
|-
|528
|''sd1''
|[[Os01g0883800]]
|10.1038/416701a
|
* Annotated
|-
|529
|''GW2''
|[[Os02g0244100]]
|10.1038/ng2014
|
* Annotated
|-
|530
|''Rf2''
|[[Os02g0274000]]
|10.1111/j.1365-313X.2010.04427.x
|
* The fertility restorer gene, Rf2, for Lead Rice-type cytoplasmic male sterility of rice encodes a mitochondrial glycine-rich protein
|-
|531
|''hbd2''
|[[Os02g0622100]]
|10.1007/s00438-010-0514-y
|
* Annotated
|-
|532
|''Pib''
|[[Os02g0818450]]
|10.1046/j.1365-313X.1999.00498.x
|
* The Pib gene for rice blast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes
|-
|533
|''qLTG3?1''
|[[Os03g0103300]]
|10.1073/pnas.0805303105
|
* Annotated
|-
|534
|''dth3''
|[[Os03g0122600]]
|10.1007/s00299-011-1129-4
|
* Annotated
|-
|535
|''GS3''
|[[Os03g0407400]]
|10.1007/s00122-006-0218-1
|
* Annotated
|-
|536
|''GRP162''
|[[Os03g0641300]]
|10.1105/tpc.111.093211
|
* The Rice Pentatricopeptide Repeat Protein RF5 Restores Fertility in Hong-Lian Cytoplasmic Male-Sterile Lines via a Complex with the Glycine-Rich Protein GRP162
|-
|537
|''LOX-3''
|[[Os03g0700400]]
| 10.1007/s12374-013-0085-7
|
* Molecular genetic characterization of rice seed lipoxygenase 3 and assessment of its effects on seed longevity
|-
|538
|''Hd6''
|[[Os03g0762000]]
|10.1073/pnas.111136798
|
* Annotated
|-
|539
|''Bph14''
|[[Os03g0848700]]
|10.1073/pnas.0912139106
|
* Annotated
|-
|541
|''Pi21''
|[[Os04g0401000]]
|10.1126/science.1175550
|
* Annotated
|-
|542
|''GIF1''
|[[Os04g0413500]]
|10.1038/ng.220
|
* Annotated
|-
|543
|''Rf17''
|[[Os04g0475900]]
|10.1073/pnas.0901860106
|
* Suppressed expression of RETROGRADE-REGULATED MALE STERILITY restores pollen fertility in cytoplasmic male sterile rice plants
|-
|544
|''BET1''
|[[Os04g0477300]]
|10.1104/pp.110.171470
|
* Suppression of a NAC-Like Transcription Factor Gene Improves Boron-Toxicity Tolerance in Rice
|-
|545
|''OSB2''
|[[Os04g0557500]]
|10.1093/pcp/pce128
|
* The Purple leaf (Pl) Locus of Rice: the Plw Allele has a Complex Organization and Includes Two Genes Encoding Basic Helix-Loop-Helix Proteins Involved in Anthocyanin Biosynthesis
|-
|546
|''OSB1''
|[[Os04g0557800]]
|10.1093/pcp/pce128
|
* The Purple leaf (Pl) Locus of Rice: the Plw Allele has a Complex Organization and Includes Two Genes Encoding Basic Helix-Loop-Helix Proteins Involved in Anthocyanin Biosynthesis
|-
|547
|''Xa1''
|[[Os04g0622600]]
|10.1073/pnas.95.4.1663
|
* Annotated
|-
|548
|''sh4''
|[[Os04g0670900]]
|10.1126/science.1123604
|
* Rice Domestication by Reducing Shattering
|-
|549
|''Xa5''
|[[Os05g0107700]]
|10.1094/MPMI.2004.17.12.1348
|
* Annotated
|-
|550
|''GS5''
|[[Os05g0158500]]
|10.1038/ng.977
|
* Annotated
|-
|551
|''GW5''
|[[DQ991205]]
|10.1038/cr.2008.307
|
* Isolation and initial characterization of GW5, a major QTL associated with rice grain width and weight
|-
|552
|''qSW5''
|[[AB433345_DQ991205]]
|10.1038/ng.169
|
* Deletion in a gene associated with grain size increased yields during rice domestication
|-
|553
|''wx''
|[[Os06g0133000]]
|10.1046/j.1365-313X.1995.7040613.x
|
* Annotated
|-
|554
|''Hd3a''
|[[Os06g0157700]]
|10.1093/pcp/pcf156
|
* Annotated
|-
|555
|''DPL2''
|[[Os06g0184100]]
|10.1073/pnas.1003124107
|
* Rice pollen hybrid incompatibility caused by reciprocal gene loss of duplicated genes
|-
|556
|''S5''
|[[Os06g0213100]]
|10.1073/pnas.0804761105
|
* A triallelic system of S5 is a major regulator of the reproductive barrier and compatibility of indica–japonica hybrids in rice
|-
|557
|''ALK''
|[[Os06g0229800]]
|10.1111/j.1744-7909.2011.01065.x
|
* Annotated
|-
|558
|''Hd1''
|[[Os06g0275000]]
|10.1105/tpc.12.12.2473
|
* Annotated
|-
|559
|''Pi2''
|[[Os06g0286700]]
|10.1094/MPMI-19-1216
|
* Annotated
|-
|560
|''Pi9''
|[[Os06g0286700]]
|10.1534/genetics.105.044891
|
* Annotated
|-
|561
|''Pi25''
|[[Os06g0330100]]
|10.1016/j.jgg.2011.03.010
|
* Annotated
|-
|562
|''Pid3''
|[[Os06g0330100]]
|10.1534/genetics.109.102871
|
* Annotated
|-
|563
|''Pi-d2''
|[[Os06g0494100]]
|10.1111/j.1365-313X.2006.02739.x
|
* Annotated
|-
|564
|''Xa27''
|[[Os06g0598900]]
|10.1038/nature03630
|
* R gene expression induced by a type-III effector triggers disease resistance in rice
|-
|566
|''PROG1''
|[[Os07g0153600]]
|10.1038/ng.197
|
* Control of a key transition from prostrate to erect growth in rice domestication
|-
|567
|''Rc''
|[[Os07g0211500]]
|10.1105/tpc.105.038430
|
* Caught Red-Handed: Rc Encodes a Basic Helix-Loop-Helix Protein Conditioning Red Pericarp in Rice
|-
|569
|''OsHMA3''
|[[Os07g0232900]]
|10.1073/pnas.1005396107
|
* Annotated
|-
|571
|''Ghd7''
|[[Os07g0261200]]
|10.1038/ng.143
|
* Annotated
|-
|572
|''Sdr4''
|[[Os07g0585700]]
|10.1073/pnas.0911965107
|
* Annotated
|-
|573
|''Pi36''
|[[Os08g0150100]]
|10.1534/genetics.107.075465
|
* The in Silico Map-Based Cloning of Pi36, a Rice Coiled-Coil–Nucleotide-Binding Site–Leucine-Rich Repeat Gene That Confers Race-Specific Resistance to the Blast Fungus
|-
|574
|''DTH8''
|[[Os08g0174500]]
|10.1104/pp.110.156943
|
* Annotated
|-
|578
|''Badh2''
|[[Os08g0424500]]
|10.1105/tpc.108.058917
|
* Annotated
|-
|579
|''WFP''
|[[Os08g0509600]]
|10.1038/ng.592
|
* Annotated
|-
|580
|''IPA1''
|[[Os08g0509600]]
|10.1038/ng.591
|
* Annotated
|-
|581
|''xa13''
|[[Os08g0535200]]
|10.1101/gad.1416306
|
* Annotated
|-
|582
|''Sub1A''
|[[AAZ06207]]
|10.1038/nature04920
|
* Sub1A is an ethylene-response-factor-like gene that confers submergence tolerance to rice
|-
|584
|''DEP1''
|[[Os09g0441900]]
|10.1038/ng.352
|
* Annotated
|-
|585
|''TAC1''
|[[Os09g0529300]]
|10.1111/j.1365-313X.2007.03284.x
|
* Annotated
|-
|586
|''CPDphotolyase''
|[[Os10g0167600]]
|10.1093/pcp/pch215
|
* Annotated
|-
|588
|''Ehd1''
|[[Os10g0463400]]
|10.1101/gad.1189604
|
* Ehd1, a B-type response regulator in rice, confers short-day promotion of flowering and controls FT-like gene expression independently of Hd1
|-
|589
|''RF1A''
|[[Os10g0497300]]
|10.1105/tpc.105.038240
|
* Annotated
|-
|591
|''Rf-1''
|[[Os10g0497432]]
|10.1046/j.1365-313X.2003.01961.x
|
* Map-based cloning of a fertility restorer gene, Rf-1, in rice (Oryza sativa L.)
|-
|592
|''RF1B''
|[[Os10g0499500]]
|10.1105/tpc.105.038240
|
* Cytoplasmic Male Sterility of Rice with Boro II Cytoplasm Is Caused by a Cytotoxic Peptide and Is Restored by Two Related PPR Motif Genes via Distinct Modes of mRNA Silencing
|-
|593
|''Pia''
|[[Os11g0225100]]
|10.1111/j.1365-313X.2011.04502.x
|
* Annotated
|-
|594
|''Xa21''
|[[Os11g0559200]]
|10.1126/science.270.5243.1804
|
* Annotated
|-
|595
|''Pb1''
|[[Os11g0598500]]
|10.1111/j.1365-313X.2010.04348.x
|
* Durable panicle blast-resistance gene Pb1 encodes an atypical CC-NBS-LRR protein and was generated by acquiring a promoter through local genome duplication
|-
|596
|''Pik1''
|[[Os11g0687800]]
|10.1111/j.1469-8137.2010.03462.x
|
* The isolation and characterization of Pik, a rice blast resistance gene which emerged after rice domestication
|-
|597
|''Pik2''
|[[Os11g0687900]]
|10.1111/j.1469-8137.2010.03462.x
|
* The isolation and characterization of Pik, a rice blast resistance gene which emerged after rice domestication
|-
|599
|''Pik-p''
|[[Os11g0689100]]
|10.1007/s00122-010-1506-3
|
* The Pik-p resistance to Magnaporthe oryzae in rice is mediated by a pair of closely linked CC-NBS-LRR genes
|-
|600
|''Xa3''
|[[Os11g0692300]]
|10.1007/s00122-006-0388-x
|
* Annotated
|-
|601
|''Xa26''
|[[Os11g0692300]]
|10.1046/j.1365-313X.2003.01976.x
| Xa26, a gene conferring resistance to Xanthomonas oryzae pv. oryzae in rice, encodes an LRR receptor kinase-like protein
|
|-
|602
|''Pi-ta''
|[[Os12g0281300]]
|10.1105/tpc.12.11.2033
| A Single Amino Acid Difference Distinguishes Resistant and Susceptible Alleles of the Rice Blast Resistance Gene Pi-ta
|
|-
|606
|''OsCOIN''
|[[Os01g0104100]]
|10.1007/s00425-007-0548-5
|
|Finished
|-
|607
|''OsIRL''
|[[Os01g0106400]]
|10.1111/j.1399-3054.2009.01290.x
|
|Finished
|-
|609
|''OsDREB2A''
|[[Os01g0165000]]
|10.1007/s10529-011-0620-x
|
|Finished
|-
|610
|''OsIAA1''
|[[Os01g0178500]]
|10.1007/s11103-009-9474-1
|
|Annotated
|-
|611
|''OsCDR1''
|[[Os01g0178600]]
|10.1094/MPMI-22-12-1635
|
|Finished
|-
|613
|''NH1''
|[[Os01g0194300]]
|10.1094/MPMI-18-0511
|
|Annotated
|-
|614
|''OsRAA1''
|[[Os01g0257300]]
|10.1104/pp.104.041996
|
|Annotated
|-
|615
|''CYP734A6''
|[[Os01g0388000]]
|10.1111/j.1365-313X.2011.04567.x
|
|Finished
|-
|616
|''OsWRKY11''
|[[Os01g0626400]]
|10.1007/s00299-008-0614-x
|
|Annotated
|-
|617-1
|''SLRL1''
|[[Os01g0646300]]
|10.1111/j.1365-313X.2005.02562.x
|
|Finished
|-
|617-2
|''SLRL2''
|[[Os05g0574900]]
|10.1111/j.1365-313X.2005.02562.x
|
|Finished
|-
|618
|''RACK1A''
|[[Os01g0686800]]
|10.1105/tpc.107.054395
|
|Annotated
|-
|619
|''OsWRKY13''
|[[Os01g0750100]]
|10.1094/MPMI-20-5-0492
|
|Finished
|-
|620
|''OsKAT1''
|[[Os01g0756700]]
|10.1104/pp.107.101154
|
|Annotated
|-
|621
|''OsCIPK12''
|[[Os01g0759400]]
|10.1104/pp.107.101295
|
|Annotated
|-
|623
|''GH3-2''
|[[Os01g0764800]]
|10.1104/pp.110.163774
|
|Annotated
|-
|624
|''OsGH3.1''
|[[Os01g0785400]]
|10.1094/MPMI-22-2-0201
|
|Finished
|-
|626
|''AP37''
|[[Os01g0797600]]
|10.1104/pp.109.137554
|
|Finished
|-
|627
|''ZFP179''
|[[Os01g0839100]]
|10.1093/jxb/erq120
|
|Annotated
|-
|628
|''OsMYB3R-2''
|[[Os01g0841500]]
|10.1104/pp.108.133454
|
|Finished
|-
|630
|''SAPK4''
|[[Os01g0869900]]
|10.1186/1471-2229-8-49
|
|Finished
|-
|631
|''SNAC2''
|[[Os01g0884300]]
|10.1007/s11103-008-9309-5
|
|Finished
|-
|633
|''OsDREB1F''
|[[Os01g0968800]]
|10.1007/s11103-008-9340-6
|
|Annotated
|-
|635
|''BiP''
|[[Os02g0115900]]
|10.1093/pcp/pcp098
|
|Finished
|-
|636
|''BiP3''
|[[Os02g0115900]]
|10.1371/journal.pone.0009262
|
|Finished
|-
|637
|''OsRacB''
|[[Os02g0120800]]
|10.1016/j.plaphy.2005.12.001
|
|Finished
|-
|638
|''OsCYP2''
|[[Os02g0121300]]
|10.1186/1471-2229-11-34
|
|Finished
|-
|639
|''OsMAPK33''
|[[Os02g0148100]]
|10.1007/s12038-011-9002-8
|
|Annotated
|-
|641
|''OsWRKY71''
|[[Os02g0181300]]
|10.1016/j.jplph.2006.07.006
|
|Finished
|-
|642
|''OsAGAP''
|[[Os02g0198300]]
|10.1111/j.1365-313X.2006.02898.x
|
|Annotated
|-
|645
|''RCN2''
|[[Os02g0531600]]
|10.1046/j.1365-313X.2002.01255.x
|
|Annotated
|-
|647
|''OsTPP1''
|[[Os02g0661100]]
|10.1007/s00425-008-0729-x
|
|Annotated
|-
|648
|''MAIF1''
|[[Os02g0671100]]
|10.1093/mp/ssq066
|
|Finished
|-
|649
|''SBPase''
|[[Os02g0698000]]
|10.1007/s00299-006-0299-y
|
|Finished
|-
|650
|''OsFAD2''
|[[Os02g0716500]]
|10.1007/s11032-011-9587-5
|
|Finished
|-
|651
|''OsHAP3E''
|[[Os02g0725700]]
|10.1016/j.plantsci.2011.04.009
|
|Finished
|-
|652
|''OsSKIPa''
|[[Os02g0759800]]
|10.1073/pnas.0901940106
|
|Finished
|-
|653
|''Orysa;KRP1''
|[[Os02g0762400]]
|10.1104/pp.106.087056
|
|Finished
|-
|654
|''mtHsp70''
|[[Os02g0774300]]
|10.1016/j.febslet.2010.11.051
|
|Finished
|-
|657
|''RWC3''
|[[Os02g0823100]]
|10.1093/pcp/pch058
|
|Finished
|-
|658
|''CDPK13''
|[[Os03g0128700]]
|10.1007/s00438-007-0220-6
|
|Annotated
|-
|659
|''OsCDPK13''
|[[Os03g0128700]]
|10.1007/s11103-004-1178-y
|
|Annotated
|-
|661
|''OsTIFY11a''
|[[Os03g0180800]]
|10.1007/s11103-009-9524-8
|
|Annotated
|-
|662
|''GS1;2''
|[[Os03g0223400]]
|10.1007/s00299-008-0665-z
|
|Annotated
|-
|666
|''sHSP17.7''
|[[Os03g0267200]]
|10.1007/s00299-007-0470-0
|
|Annotated
|-
|667
|''OsSDIR1''
|[[Os03g0272300]]
|10.1007/s11103-011-9775-z
|
|Annotated
|-
|668
|''OsAPXa''
|[[Os03g0285700]]
|10.1007/s00299-010-0985-7
|
|Finished
|-
|669
|''OsCIPK03''
|[[Os03g0319400]]
|10.1104/pp.107.101295
|
|Annotated
|-
|671
|''OsIPT2''
|[[Os03g0356900]]
|10.1104/pp.106.085811
|
|Annotated
|-
|674
|''OSH1''
|[[Os03g0727000]]
|10.1105/tpc.5.9.1039
|
|Finished
|-
|675
|''OsbHLH148''
|[[Os03g0741100]]
|10.1111/j.1365-313X.2010.04477.x
|
|Annotated
|-
|676
|''OSH43''
|[[Os03g0771500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|677
|''OsIPT4''
|[[Os03g0810100]]
|10.1104/pp.106.085811
|
|Finished
|-
|678
|''SNAC1''
|[[Os03g0815100]]
|10.1073/pnas.0604882103
|
|Annotated
|-
|680
|''ZFP182''
|[[Os03g0820300]]
|10.1016/j.bbaexp.2007.02.006
|
|Annotated
|-
|685
|''OsOxi1''
|[[Os04g0488700]]
|10.1093/pcp/pcq132
|
|Annotated
|-
|686
|''OsRDCP1''
|[[Os04g0530500]]
|10.1016/j.plantsci.2011.02.008
|
|Annotated
|-
|687
|''OsDREB1E''
|[[Os04g0572400]]
|10.1007/s10529-008-9811-5
|
|Finished
|-
|688
|''OsCDPK7''
|[[Os04g0584600]]
|10.1046/j.1365-313x.2000.00787.x
|
|Annotated
|-
|689
|''OsAP2-39''
|[[Os04g0610400]]
|10.1371/journal.pone.0025216
|
|Finished
|-
|690
|''ostgap1''
|[[Os04g0637000]]
|10.1074/jbc.M109.036871
|
|Finished
|-
|691
|''GS2''
|[[Os04g0659100]]
|10.1023/A:1006408712416
|
|Finished
|-
|692
|''OsRR6''
|[[Os04g0673300]]
|10.1093/pcp/pcm022
|
|Finished
|-
|694
|''OSH71''
|[[Os05g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|695
|''OsLti6b''
|[[Os05g0138300]]
|10.1007/s00299-006-0297-0
|
|Annotated
|-
|696
|''OsPYL/RCAR5''
|[[Os05g0213500]]
|10.1093/jxb/err338
|
|Annotated
|-
|698
|''OsWRKY53''
|[[Os05g0343400]]
|10.1016/j.bbaexp.2007.04.006
|
|Finished
|-
|699
|''OsDREB2B''
|[[Os05g0346200]]
|10.1007/s10529-008-9811-5
|
|Finished
|-
|700
|''DEPG1''
|[[Os05g0365300]]
|10.1007/s11033-011-1122-6
|Over-expression in the nucleotide-binding site-leucine rich repeat gene DEPG1 increases susceptibility to bacterial leaf streak disease in transgenic rice plants
|Susceptibility to Biotic Stress
|-
|701
|''Gns1''
|[[Os05g0375400]]
|10.1023/A:1020714426540
|Characterization of transgenic rice plants over-expressing the stress-inducible beta-glucanase gene Gns1
|
|-
|702
|''OsISA2''
|[[Os05g0393700]]
|10.1104/pp.111.173435
|Functional diversity of isoamylase oligomers: the ISA1 homo-oligomer is essential for amylopectin biosynthesis in rice endosperm
|
|-
|703
|''OsTPS1''
|[[Os05g0518600]]
|10.1007/s00425-011-1458-0
|Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice
|Abiotic stress
|-
|704
|''OsLEA3-1''
|[[Os05g0542500]]
|10.1007/s00122-007-0538-9
|
|Annotated
|-
|705-1
|''OsIPT7''
|[[Os05g0551700]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-2
|''OsIPT5''
|[[Os07g0211700]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-3
|''OsIPT4''
|[[Os03g0810100]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-4
|''OsIPT2''
|[[Os03g0356900]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-5
|''OsIPT8''
|[[Os01g0688300]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-6
|''OsIPT10''
|[[Os06g0729800]]
|10.1104/pp.106.085811
|
|Finished
|-
|706
|''OsRAN2''
|[[Os05g0574500]]
|10.1111/j.1365-3040.2010.02225.x
|
|Annotated
|-
|707
|''OsHDT1''
|[[Os05g0597100]]
|10.1371/journal.pone.0021789
|
|Annotated
|-
|708
|''OsDREB1C''
|[[Os06g0127100]]
|10.1093/pcp/pci230
|
|Annotated
|-
|709
|''OsENOD93-1''
|[[Os06g0142350]]
|10.1111/j.1365-3040.2009.02032.x
|
|Annotated
|-
|710
|''OsPTF1''
|[[Os06g0193400]]
|10.1104/pp.105.063115
|
|Annotated
|-
|711
|''bu1''
|[[Os06g0226500]]
|10.1104/pp.109.140806
|
|Finished
|-
|712
|''HOX1a''
|[[Os06g0229300]]
|10.1111/j.1744-7909.2011.01075.x
|
|Finished
|-
|713
|''OsGLK1''
|[[Os06g0348800]]
|10.1093/pcp/pcp138
|
|Annotated
|-
|714-1
|''OsHDAC1''
|[[Os06g0583400]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|714-2
|''OsHDAC2''
|[[Os02g0215200]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|714-3
|''OsHDAC3''
|[[Os02g0214900]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|715
|''CYP734A4''
|[[Os06g0600400]]
|10.1111/j.1365-313X.2011.04567.x
|
|Finished
|-
|716
|''OsSPX1''
|[[Os06g0603600]]
|10.1111/j.1365-313X.2008.03734.x
|
|Finished
|-
|717
|''OsiSAP8''
|[[Os06g0612800]]
|10.1007/s11103-007-9284-2
|
|Finished
|-
|718
|''OVP1''
|[[Os06g0644200]]
|10.1016/j.plaphy.2010.09.014
|
|Finished
|-
|721
|''YK1''
|[[Os06g0651100]]
|10.1023/A:1019275218830
|
|Finished
|-
|722
|''OsPIN2''
|[[Os06g0660200]]
|10.1111/j.1467-7652.2011.00637.x
|
|Finished
|-
|723-1
|''OSH1''
|[[Os03g0727000]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-2
|''OSH15''
|[[Os07g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-3
|''OSH43''
|[[Os03g0771500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-4
|''OSH6''
|[[Os01g0302500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-5
|''OSH71''
|[[Os05g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|725
|''OsNek3''
|[[Os07g0176600]]
|10.1093/pcp/pcp026
|
|Finished
|-
|726
|''OsNRAMP1''
|[[Os07g0258400]]
|10.1093/jxb/err136
|
|Finished
|-
|727
|''OsPHR2''
|[[Os07g0438800]]
|10.1104/pp.107.111443
|
|Finished
|-
|728
|''CrtintP1''
|[[Os07g0498800]]
|10.1007/s00438-007-0220-6
|
|Finished
|-
|729
|''GH3-8''
|[[Os07g0592600]]
|10.1105/tpc.107.055657
|
|Finished
|-
|730
|''OsMADS18''
|[[Os07g0605200]]
|10.1104/pp.104.045039
|
|Finished
|-
|731
|''OsNHX1''
|[[Os07g0666900]]
|10.1093/pcp/pch014
|
|Finished
|-
|733
|''OsGAPC3''
|[[Os08g0126300]]
|10.1007/s11240-011-9950-6
|
|Finished
|-
|735
|''OsDOG''
|[[Os08g0504700]]
|10.1016/j.jplph.2010.12.013
|
|Finished
|-
|737
|''OsCPK21''
|[[Os08g0540400]]
|10.1007/s11103-010-9717-1
|
|Finished
|-
|740
|''OsCO3''
|[[Os09g0240200]]
|10.1007/s00425-008-0742-0
|
|Finished
|-
|741
|''OsWRKY76''
|[[Os09g0417600]]
|10.1007/s12284-010-9039-6
|
|Finished
|-
|743
|''OsbZIP72''
|[[Os09g0456200]]
|10.1007/s00425-008-0857-3
|
|Finished
|-
|744
|''OsEATB''
|[[Os09g0457900]]
|10.1104/pp.111.179945
|
|Finished
|-
|745
|''Oshox4''
|[[Os09g0470500]]
|10.1007/s11103-007-9270-8
|
|Finished
|-
|746
|''OsTFX1''
|[[Os09g0474000]]
|10.1073/pnas.0701742104
|
|Finished
|-
|747
|''RF2a''
|[[Os09g0516200]]
|10.1073/pnas.0810303105
|
|Finished
|-
|748
|''OsDREB1B''
|[[Os09g0522000]]
|10.1093/pcp/pci230
|
|Finished
|-
|749
|''OsDREB1A''
|[[Os09g0522200]]
|10.1093/pcp/pci230
|
|Finished
|-
|750
|''OsPIP2;7''
|[[Os09g0541000]]
|10.1093/pcp/pcn166
|
|Finished
|-
|751
|''SAUR39''
|[[Os09g0545300]]
|10.1104/pp.109.143875
|
|Finished
|-
|753-1
|''OsSPX1''
|[[Os06g0603600]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753-2
|''OsSPX2''
|[[Os02g0202200]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX3''
|[[Os10g0392600]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX4''
|[[Os03g0827500]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX5''
|[[Os03g0406100]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX6''
|[[Os07g0614700]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|754
|''OsiICK6''
|[[Os10g0471700]]
|10.1093/aob/mcr057
|
|Finished
|-
|755
|''OsMADS56''
|[[Os10g0536100]]
|10.1111/j.1365-3040.2009.02008.x
|
|Finished
|-
|756
|''MYBS3''
|[[Os10g0561400]]
|10.1104/pp.110.153015
|
|Annotated
|-
|757
|''OsMSRA4.1''
|[[Os10g0563600]]
|10.1007/s00425-009-0934-2
|
|Annotated
|-
|758
|''Rir1b''
|[[Os10g0569400]]
|10.1023/A:1006423232753
|
|Finished
|-
|759
|''WOX3''
|[[Os11g0102100]]
|10.1104/pp.107.095737
|
|Annotated
|-
|760
|''OsCIPK15''
|[[Os11g0113700]]
|10.1104/pp.107.101295
|
|Finished
|-
|761
|''OsNAC10''
|[[Os11g0126900]]
|10.1104/pp.110.154773
|
|Finished
|-
|762
|''ONAC045''
|[[Os11g0127600]]
|10.1016/j.bbrc.2008.12.163
|
|Finished
|-
|763
|''RCN1''
|[[Os11g0152500]]
|10.1046/j.1365-313X.2002.01255.x
|
|Annotated
|-
|764
|''OsAsr1''
|[[Os11g0167800]]
|10.1007/s10059-009-0055-6
|
|Annotated
|-
|765-1
|''OsPR4a''
|[[Os11g0592200]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-2
|''OsPR4b''
|[[Os11g0592100]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-3
|''OsPR4c''
|[[Os11g0592000]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-4
|''OsPR4d''
|[[Os11g0591800]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-5
|''OsPR4e''
|[[Os11g0592200]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|766
|''OsMT1a''
|[[Os11g0704500]]
|10.1007/s11103-009-9466-1
|
|Finished
|-
|767
|''OsWAK1''
|[[Os11g0690066]]
|10.1007/s11103-008-9430-5
|
|Annotated
|-
|768
|''ZFP252''
|[[Os12g0583700]]
|10.1016/j.febslet.2008.02.052
|
|Finished
|-
|769
|''OsPID''
|[[Os12g0614600]]
|10.1093/pcp/pcm024
|
|Finished
|-
|771
|''OsTLP27''
|[[Os01g0102300]]
|10.1016/j.plantsci.2012.06.006
|
|Finished
|-
|772
|''OsHsp17.0''
|[[Os01g0136200]]
|10.1016/j.jplph.2011.12.014
|
|Finished
|-
|775
|''OsMKK6''
|[[Os01g0510100]]
|10.1016/j.jplph.2011.11.012
|
|Finished
|-
|776
|''OsRDR6''
|[[Os01g0527600]]
|10.1111/j.1365-313X.2012.05001.x
|
|Finished
|-
|777
|''RAD51C''
|[[Os01g0578000]]
|10.1093/jxb/ers190
|
|Finished
|-
|779
|''CFO1''
|[[Os01g0726400]]
|10.1104/pp.112.200980
|
|Finished
|-
|780
|''OsPAP10a''
|[[Os01g0776600]]
|10.1111/j.1744-7909.2012.01143.x
|
|Finished
|-
|782
|''OsCOI1''
|[[Os01g0853400]]
|10.1371/journal.pone.0036214
|
|Finished
|-
|783
|''OsMGT1''
|[[Os01g0869200]]
|10.1104/pp.112.199778
|
|Finished
|-
|784
|''PsbS''
|[[Os01g0869800]]
|10.1111/j.1365-313X.2012.04995.x
|
|Finished
|-
|785
|''OsHPL3''
|[[Os02g0110200]]
|10.1111/j.1365-313X.2012.05027.x
|
|Finished
|-
|786
|''MADS29''
|[[Os02g0170300]]
|10.1105/tpc.111.094854
|
|Finished
|-
|787
|''MTR1''
|[[Os02g0491300]]
|10.1016/j.devcel.2012.04.011
|
|Finished
|-
|788
|''cry1a''
|[[Os02g0573200]]
|10.1093/pcp/pcs097
|
|Finished
|-
|788-2
|''cry1b''
|[[Os04g0452100]]
|10.1093/pcp/pcs097
|
|Finished
|-
|789
|''OsABC1-2''
|[[Os02g0575500]]
|10.1016/j.gene.2012.02.017
|
|Finished
|-
|791
|''OsHk6''
|[[Os02g0738400]]
|10.1093/pcp/pcs079
|
|Finished
|-
|1227
|''OsHk3''
|[[Os01g0923700]]
|10.1093/pcp/pcs079
|
|Finished
|-
|1228
|''OsHk4''
|[[Os03g0717700]]
|10.1093/pcp/pcs079
|
|Finished
|-
|792
|''D50''
|[[Os02g0477700]]
|10.1111/j.1365-3040.2012.02534.x
|
|Finished
|-
|793
|''th1''
|[[Os02g0811000]]
|10.1007/s11103-011-9868-8
|Annotated
|
|-
|794
|''osdrm2''
|[[Os03g0110800]]
|10.1111/j.1365-313X.2012.04974.x
| Targeted disruption of an orthologue of DOMAINS REARRANGED METHYLASE 2, OsDRM2, impairs the growth of rice plants by abnormal DNA methylation
|
|-
|795
|''te''
|[[Os03g0123300]]
|10.1038/ncomms1716
|
|Finished
|-
|796
|''OsMYB2''
|[[Os03g0315400]]
|10.1093/jxb/err431
|The rice Os03g0315400 was reported as OsMYB2 in 2012 [1] by researchers from China.
|
|-
|797
|''OsCam1-1''
|[[Os03g0319300]]
|10.1007/s12374-011-0154-8
| The rice Os03g0319300 was reported as OsCam1-1 in 2012 [1] by researchers from Thailand.
|
|-
|798
|''OsLEA3-2''
|[[Os03g0322900]]
|10.1371/journal.pone.0045117
| OsLEA3-2, an Abiotic Stress Induced Gene of Rice Plays a Key Role in Salt and Drought Tolerance
|
|-
|800
|''ysa''
|[[Os03g0597200]]
|10.1104/pp.112.195081
|
|Disruption of a Rice Pentatricopeptide Repeat Protein Causes a Seedling-Specific Albino Phenotype and Its Utilization to Enhance Seed Purity in Hybrid Rice Production
|-
|801
|''OsSh1''
|[[Os03g0650000]]
|10.1038/ng.2281
| Parallel domestication of the Shattering1 genes in cereals
|
|-
|802
|''OsSWAP70A''
|[[Os03g0666200]]
|10.1111/j.1365-313X.2011.04874.x
|Annotated
|
|-
|803
|''OsDDM1b''
|[[Os03g0722400]]
|10.1007/s00438-012-0717-5
| DDM1 (Decrease in DNA Methylation) genes in rice (Oryza sativa)
|
|-
|804
|''OsDDM1a''
|[[Os09g0442700]]
|10.1007/s00438-012-0717-5
| DDM1 (Decrease in DNA Methylation) genes in rice (Oryza sativa)
|
|-
|806
|''OsPIL1''
|[[Os03g0782500]]
|10.1073/pnas.1207324109
|Annotated
|
|-
|807
|''gh1''
|[[Os03g0819600]]
|10.1007/s00425-012-1598-x
| A mutation in the rice chalcone isomerase gene causes the golden hull and internode 1 phenotype
|
|-
|808
|''OsPT1''
|[[Os03g0150600]]
|10.1104/pp.112.196345
|A Constitutive Expressed Phosphate Transporter, OsPht1;1, Modulates Phosphate Uptake and Translocation in Phosphate-Replete Rice
|
|-
|810
|''OsVIT1''
|[[Os04g0463400]]
|10.1111/j.1365-313X.2012.05088.x
| Annotated
|
|-
|811
|''YSL16''
|[[Os04g0542800]]
|10.1105/tpc.112.103820
| Annotated
|
|-
|812
|''cZOGT1''
|[[Os04g0556500]]
|10.1104/pp.112.196733
| Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|-
|813
|''cZOGT2''
|[[Os04g0556600]]
|10.1104/pp.112.196733
|Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|
|-
|1026
|''cZOGT3''
|[[Os04g0565400]]
|10.1104/pp.112.196733
| Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|
|-
|814
|''xiao''
|[[Os04g0576900]]
|10.1111/j.1365-313X.2011.04877.x
|XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassino steroids and cell cycling in rice
|
|-
|815
|''MPR25''
|[[Os04g0602600]]
|10.1111/j.1365-313X.2012.05091.x
| Annotated
|
|-
|816
|''shat1''
|[[Os04g0649100]]
|10.1105/tpc.111.094383
| Genetic Control of Seed Shattering in Rice by the APETALA2 Transcription Factor SHATTERING ABORTION1
|
|-
|817
|''SLAC1''
|[[Os04g0674700]]
|10.1093/jxb/ers216
| Increased leaf photosynthesis caused by elevated stomatal conductance in a rice mutant deficient in SLAC1, a guard cell anion channel protein
|
|-
|819
|''OsMYB2P-1 1''
|[[Os05g0140100]]
|10.1104/pp.112.194217
| OsMYB2P-1, an R2R3 MYB Transcription Factor, Is Involved in the Regulation of Phosphate-Starvation Responses and Root Architecture in Rice
|
|-
|820
|''OsSYP71''
|[[Os05g0553700]]
|10.1016/j.gene.2012.05.011
| Overexpression of the Qc-SNARE gene OsSYP71 enhances tolerance to oxidative stress and resistance to rice blast in rice
|
|-
|821
|''HDT701''
|[[Os05g0597100]]
|10.1105/tpc.112.101972
| HDT701, a Histone H4 Deacetylase, Negatively Regulates Plant Innate Immunity by Modulating Histone H4 Acetylation of Defense-Related Genes in Rice
|
|-
|822
|''OsELF3-1''
|[[Os06g0142600]]
|10.1371/journal.pone.0043705
| Annotated
|
|-
|823
|''Hd17''
|[[Os06g0142600]]
|10.1093/pcp/pcs028
| Natural Variation in Hd17, a Homolog of Arabidopsis ELF3 That is Involved in Rice Photoperiodic Flowering
|-
|825
|''LYP6''
|[[Os06g0208800]]
|10.1105/tpc.112.102475
| Annotated
|
|-
|826
|''OsbZIP46''
|[[Os06g0211200]]
|10.1104/pp.111.190389
| Constitutive Activation of Transcription Factor OsbZIP46 Improves Drought Tolerance in Rice
|
|-
|830
|''RPL1''
|[[Os06g0245600]]
|10.1093/mp/ssr091
| RPL1, a Gene Involved in Epigenetic Processes Regulates Phenotypic Plasticity in Rice
|
|-
|831
|''OsHSBP2''
|[[Os06g0274000]]
|10.1093/jxb/ers245
| Functional analysis of OsHSBP1 and OsHSBP2 revealed
|-
|1027
|''OsHSBP1''
|[[Os09g0375100]]
|10.1093/jxb/ers245
| Functional analysis of OsHSBP1 and OsHSBP2 revealed
|-
|832
|''OsMIOX''
|[[Os06g0561000]]
|10.1016/j.plantsci.2012.08.003
| Annotated
|
|-
|833
|''SE5''
|[[Os06g0603000]]
|10.1007/s11103-012-9945-7
| Annotated
|
|-
|834
|''OsCOM1''
|[[Os06g0613400]]
|10.1111/j.1365-313X.2012.05025.x
| The role of OsCOM1 in homologous chromosome synapsis and recombination in rice meiosis
|
|-
|835
|''OsbZIP52/RISBZ5''
|[[Os06g0662200]]
|10.1007/s00425-011-1564-z
| Annotated
|
|-
|836
|''SRL1''
|[[Os07g0102300]]
|10.1104/pp.112.199968
| Annotated
|
|-
|837
|''MADS15''
|[[Os07g0108900]]
|10.1105/tpc.112.097105
| Annotated
|
|-
|840
|''OsSWAP70B''
|[[Os07g0138100]]
|10.1111/j.1365-313X.2011.04874.x
| SWAP70 functions as a Rac/Rop guanine nucleotide-exchange factor in rice
|
|-
|841
|''spl5''
|[[Os07g0203700]]
|10.1007/s11032-011-9677-4
| SPL5, a cell death and defense-related gene, encodes a putative splicing factor 3b subunit 3 (SF3b3) in rice
|
|-
|842
|''Nramp5''
|[[Os07g0257200]]
|10.1105/tpc.112.096925
| Annotated
|
|-
|843
|''OsCHR4''
|[[Os07g0497000]]
|10.1007/s00425-012-1667-1
| Molecular cloning and characterization of OsCHR4, a rice chromatin-remodeling factor required for early chloroplast development in adaxial mesophyll
|
|-
|844
|''chr729''
|[[Os07g0497100]]
|10.1073/pnas.1203148109
| CHD3 protein recognizes and regulates methylated histone H3 lysines 4 and 27 over a subset of targets in the rice genome
|
|-
|845
|''OSRIP18''
|[[Os07g0556800]]
|10.1007/s11248-011-9568-9
| Annotated
|
|-
|846
|''ObgC''
|[[Os07g0669200]]
|10.1111/j.1365-313X.2012.04976.x
| Functional characterization of ObgC in ribosome biogenesis during chloroplast development
|
|-
|847
|''cslf6''
|[[Os08g0160500]]
|10.1104/pp.112.195495
| Loss of Cellulose Synthase-Like F6 Function Affects Mixed-Linkage Glucan Deposition, Cell Wall Mechanical Properties, and Defense Responses in Vegetative Tissues of Rice
|
|-
|848
|''OsLIS-L1''
|[[Os08g0162100]]
|10.1007/s00425-011-1532-7
| Annotated
|
|-
|851
|''WRKY30''
|[[Os08g0499300]]
|10.1007/s00425-012-1668-0
| Annotated
|
|-
|852
|''Orysa;CDKB2;1''
|[[Os08g0512600]]
|10.1111/j.1365-313X.2011.04847.x
| CDKB2 is involved in mitosis and DNA damage response in rice
|
|-
|853
|''qGW8''
|[[Os08g0531600]]
|10.1038/ng.2327
| Annotated
|
|-
|854
|''SDG724''
|[[Os09g0307800]]
|10.1105/tpc.112.101436
| Annotated
|
|-
|856
|''OsVIT2''
|[[Os09g0396900]]
|10.1111/j.1365-313X.2012.05088.x
| Annotated
|
|-
|857
|''OsDDM1a''
|[[Os09g0442700]]
|10.1007/s00438-012-0717-5
| Annotated
|
|-
|858
|''LYP4''
|[[Os09g0452200]]
|10.1105/tpc.112.102475
| Annotated
|
|-
|859
|''BC15/OsCTL1''
|[[Os09g0494200]]
|10.1104/pp.112.195529
|Annotated
|
|-
|860
|''LGD1''
|[[Os09g0502100]]
|10.1111/j.1365-313X.2012.04989.x
|Annotated
|
|-
|861
|''BSR1''
|[[Os09g0533600]]
|10.1111/j.1467-7652.2010.00568.x
|Screening for resistance against Pseudomonas syringae in rice-FOX Arabidopsis lines identified a putative receptor-like cytoplasmic kinase gene that confers resistance to major bacterial and fungal pathogens in Arabidopsis and rice.
|Resistance
|-
|862
|''OsLDC-like 1''
|[[Os09g0547500]]
|10.1007/s10059-012-0067-5
|Increased Polyamine Biosynthesis Enhances Stress Tolerance by Preventing the Accumulation of Reactive Oxygen Species: T-DNA Mutational Analysis of Oryza sativa Lysine Decarboxylase-like Protein 1
|
|-
|863
|''OsDEES1''
|[[Os09g0561600]]
|10.1104/pp.112.203943
|Annotated
|
|-
|864
|''OsFbx352''
|[[Os10g0127900]]
|10.1093/jxb/ers206
|Annotated
|
|-
|865
|''rl14''
|[[Os10g0558900]]
|10.1111/j.1467-7652.2012.00679.x
|Annotated
|
|-
|866
|''ospk1''
|[[Os11g0148500]]
|10.1007/s11105-011-0386-2
| Downregulation of OsPK1 Contributes to Oxidative Stress and the Variations in ABA/GA Balance in Rice
|
|-
|867
|''MIL2''
|[[Os12g0152500]]
|10.1111/j.1469-8137.2012.04270.x
| MIL2 (MICROSPORELESS2) regulates early cell differentiation in the rice anther
|
|-
|868
|''PSTOL1''
|[[BAK26566]]
|10.1038/nature11346
|
|-
|869
|''p/tms12-1''
|[[smRNA615912]]
|10.1038/cr.2012.28
|
|-
|870
|''OsHsp23.7''
|[[Os12g0569700]]
|10.1016/j.jplph.2011.12.014
| Annotated
|
|-
|871
|''Amy1A''
|[[Os02g0765600]]
|10.1111/j.1467-7652.2012.00741.x
| Annotated
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|872
|''Amy2A''
|[[Os06g0713800]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|873
|''Amy3A''
|[[Os09g0457400]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|874
|''Amy3B''
|[[Os09g0457600]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1236
|''Amy3C''
|[[Os09g0457800]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1237
|''Amy3D''
|[[Os08g0473900]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1238
|''Amy3E''
|[[Os08g0473600]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|875
|''ylc1''
|[[Os09g0380200]]
|10.1007/s00425-012-1756-1
| Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lu
|
|-
|878
|''OsIAGLU''
|[[Os03g0693600]]
|10.1007/s12374-012-0238-0
| Tiller Formation in Rice is Altered by Overexpression of OsIAGLU Gene Encoding an IAA-conjugating Enzyme or Exogenous Treatment of Free IAA
|
|-
|879
|''OsOAT''
|[[Os03g0643300]]
|10.1016/j.plantsci.2012.09.002
| Annotated
|
|-
|1230
|''OsAPS1''
|[[Os09g0298200]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1231
|''OsAPS2''
|[[Os08g0345800]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1232
|''OsAGPL1''
|[[Os03g0735000]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1234
|''OsAPL3''
|[[Os05g0580000]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1235
|''OsAPL4''
|[[Os07g0243200]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|881
|''OsGH3-2''
|[[Os01g0764800]]
|10.1093/jxb/ers300
| Annotated
|
|-
|882
|''OsDMI3''
|[[Os05g0489900]]
|10.1093/mp/sss068
|
|Annotated
|-
|883
|''Psi?LDMAR''
|[[Os12g0545900]]
|10.1093/mp/sss095
| Annotated
|
|-
|884
|''OsJAZ8''
|[[Os09g0439200]]
|10.1093/pcp/pcs145
| Annotated
|
|-
|885
|''Osj10gBTF3''
|[[Os10g0483000]]
|10.1093/pcp/pcs146
| Inhibition of a Basal Transcription Factor 3-Like Gene Osj10gBTF3 in Rice Results in Significant Plant Miniaturization and Typical Pollen Abortion
|
|-
|886
|''LPA1''
|[[Os03g0237250]]
|10.1104/pp.112.208496
| Annotated
|
|-
|887
|''PT11''
|[[Os01g0657100]]
|10.1105/tpc.112.104901
| Nonredundant Regulation of Rice Arbuscular Mycorrhizal Symbiosis by Two Members of the PHOSPHATE TRANSPORTER1 Gene Family
|
|-
|888
|''PT13''
|[[ Os04g0186800]]
|10.1105/tpc.112.104901
| Nonredundant Regulation of Rice Arbuscular Mycorrhizal Symbiosis by Two Members of the PHOSPHATE TRANSPORTER1 Gene Family
|
|-
|889
|''OsMYB55''
|[[Os05g0553400]]
|10.1371/journal.pone.0052030
| Annotated
|
|-
|890
|''DDF1''
|[[Os06g0138700]]
|10.1111/j.1365-313X.2012.05126.x
|Dwarf and deformed flower 1, encoding an F‐box protein, is critical for vegetative and floral development in rice (Oryza sativa L.)
|
|-
|891
|''OsPIN3t''
|[[Os01g0643300]]
|10.1111/j.1365-313X.2012.05121.x
| Annotated
|
|-
|892
|''OsbHLH133''
|[[Os12g0508500]]
|10.1111/j.1365-3040.2012.02569.x
| Identification of OsbHLH133 as a regulator of iron distribution between roots and shoots in Oryza sativa
|
|-
|893
|''PGR5''
|[[Os08g0566600]]
|10.1093/pcp/pcs153
| PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice
|
|-
|894
|''OsNRT2.3a''
|[[Os01g0704100]]
|10.1104/pp.112.204461
| Annotated
|
|-
|895
|''bls1''
|[[Os02g0811000]]
|10.1007/s11105-012-0480-0
| BEAK LIKE SPIKELET1 is Required for Lateral Development of Lemma and Palea in Ri
|
|-
|896
|''UIP1''
|[[Os02g0818000]]
|10.1007/s11816-012-0239-y
| Transgenic overexpression of UIP1, an interactor of the 3 0 untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought
|
|-
|897
|''OrbHLH001''
|[[Os01g0928000]]
|10.1016/j.jplph.2012.08.019
| Annotated
|
|-
|898
|''CSA''
|[[Os01g0274800]]
|10.1073/pnas.1213041110
|Annotated
|
|-
|899
|''qGL3''
|[[Os03g0646900]]
|10.1073/pnas.1219776110
|Annotated
|
|-
|900
|''OsPPKL2''
|[[Os05g0144400]]
|10.1073/pnas.1219776110
| Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice
|
|-
|901
|''OsPPKL3''
|[[Os12g0617900]]
|10.1073/pnas.1219776110
| Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice
|
|-
|902
|''OsSRO1c''
|[[Os03g0230300]]
|10.1093/jxb/ers349
|
* Annotated
|-
|903
|''OsGT1''
|[[Os01g0262600]]
|10.1104/pp.112.210948
|
* Annotated
|-
|904
|''FIE1''
|[[Os08g0137250]]
|10.1105/tpc.112.102269
|
* Annotated
|-
|905
|''APIP6''
|[[Os05g0154600]]
|10.1105/tpc.112.105429
| The Magnaporthe oryzae Effector AvrPiz-t Targets the RING E3 Ubiquitin Ligase APIP6 to Suppress Pathogen Associated Molecular Pattern–Triggered Immunity in Rice
|
|-
|906
|''BRK1''
|[[Os07g0508500]]
|10.1105/tpc.112.105874
| BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis
|
|-
|907
|''OsARG''
|[[Os04g0106300]]
|10.1111/j.1365-313x.2012.05122.x
|
* Annotated
|-
|908
|''DEC''
|[[Os12g0465700]]
|10.1111/j.1365-313x.2012.05123.x
| Rice DECUSSATE controls phyllotaxy by affecting the cytokinin signaling pathway
|
|-
|909
|''OsIDD10''
|[[Os04g0566400]]
|10.1111/nph.12075
| Regulatory role of indeterminate domain 10 (IDD10) in ammonium-dependent gene expression in rice roots
|
|-
|910
|''OsARF16''
|[[Os06g0196700]]
|10.1111/pce.12001
|
* Annotated
|-
|911
|''OsMADS29''
|[[Os02g0170300]]
|10.1371/journal.pone.0051435
|
|Annotated
|-
|912
|''OsPDCD5''
|[[Os05g0547850]]
|10.1007/s11032-012-9793-9
|
|Annotated
|-
|913
|''OsCDPK1''
|[[Os03g0128700]]
|10.1007/s11103-012-0006-z
|
|Annotated
|-
|914
|''PDA1''
|[[Os06g0607700]]
|10.1007/s12374-013-0902-z
|
|Annotated
|-
|915
|''JMJ703''
|[[Os05g0196500]]
|10.1073/pnas.1217020110
|
|Annotated
|-
|916
|''OsVIL2''
|[[Os02g0152500]]
|10.1111/tpj.12057
| OsVIL2 functions with PRC2 to induce flowering by repressing OsLFL1 in rice
|
|-
|917
|''AIP1''
|[[Os01g0125800]]
|10.1111/tpj.12065
| Oryza sativa actin-interacting protein 1 is required for rice growth by promoting actin turnover
|
|-
|918
|''Xb25''
|[[Os09g0513000]]
|10.1111/tpj.12076
| The XA21 binding protein XB25 is required for maintaining XA21-mediated disease resistance
|
|-
|919
|''DTH2''
|[[Os02g0724000]]
|10.1073/pnas.1213962110
|
|Annotated
|-
|920
|''reg1''
|[[Os03g0786400]]
|10.1073/pnas.1300359110
|
|Annotated
|-
|924
|''fgl''
|[[Os10g0496900]]
|10.1111/tpj.12110
|
|Annotated
|-
|925
|''Ehd4''
|[[Os03g0112700]]
|10.1371/journal.pgen.1003281
|
|Annotated
|-
|926
|''GnTI''
|[[Os02g0833000]]
|10.1111/tpj.12087
| N-glycan maturation is crucial for cytokinin-mediated development and cellulose synthesis in Oryza sativa
|
|-
|927
|''OsFH1''
|[[Os01g0897700]]
|10.1007-s00425-013-1838-8
|
|Annotated
|-
|928
|''moc2''
|[[Os01g0866400]]
|10.5511/plantbiotechnology.12.1210a
| Rice monoculm mutation moc2, which inhibits outgrowth of the second tillers, is ascribed to lack of a fructose-1,6-bisphosphatase
|
|-
|929
|''OsHsfA7''
|[[Os01g0571300]]
|10.5483/BMBRep.2013.46.1.090
|
|Annotated
|-
|930
|''OsPIANK1''
|[[Os11g0182500]]
|10.1371/journal.pone.0059699
| Functional Analysis and Expressional Characterization of Rice Ankyrin Repeat-Containing Protein, OsPIANK1, in Basal Defense against Magnaporthe oryzae Attack
|
|-
|931
|''OsFIE2''
|[[Os08g0137100]]
|10.1371/journal.pgen.1003322
|
|Annotated
|-
|933
|''OsORC3''
|[[Os10g0402200]]
|10.1111/tpj.12126
| OsORC3 is required for lateral root development in rice
|
|-
|934
|''OsAOC''
|[[Os03g0438100]]
|10.1111/tpj.12115
| Identification of rice Allene Oxide Cyclase mutants and the function of jasmonate for defence against Magnaporthe oryzae
|
|-
|935
|''OsSNDP1''
|[[Os10g0122600]]
|10.1007-s11103-013-0033-4
| OsSNDP1, a Sec14-nodulin domain-containing protein, plays a critical role in root hair elongation in rice
|
|-
|936
|''OsRP1L1''
|[[Os05g0365300]]
|10.1007-s11105-012-0537-0
|
|Annotated
|-
|937
|''OsVPS22''
|[[Os09g0529700]]
|10.1007/s11033-012-2422-1
| Knockout of the VPS22 component of the ESCRT-II complex in rice (Oryza sativa L.) causes chalky endosperm and early seedling lethality
|
|-
|938
|''OsTZF1''
|[[Os05g0195200]]
|10.1104/pp.112.205385
|
|Annotated
|-
|939
|''OsAt10''
|[[Os06g0594700]]
|10.1104/pp.112.208694
| Overexpression of a BAHD Acyltransferase, OsAt10, Alters Rice Cell Wall Hydroxycinnamic Acid Content and Saccharification
|
|-
|940
|''Cga1''
|[[Os02g0220400]]
|10.1104/pp.113.217265
|
|Annotated
|-
|941
|''nal2''
|[[Os11g0102100]]
|10.1111/nph.12231
| A WUSCHEL-LIKE HOMEOBOX Gene Represses a YABBY Gene Expression Required for Rice Leaf Development
|
|-
|942
|''nal3''
|[[Os12g0101600]]
|10.1111/nph.12231
|
|Annotated
|-
|943
|''OsPTR9''
|[[Os06g0706400]]
|10.1111/pbi.12031
|
|Annotated
|-
|944
|''OsDHAR1''
|[[Os05g0116100]]
|10.1007/s00425-013-1862-8
| Homologous expression of cytosolic dehydroascorbate reductase increases grain yield and biomass under paddy field conditions in transgenic rice
|
|-
|945
|''ASR1''
|[[Os11g0167800]]
|10.1007/s10059-013-0036-7
|
|Annotated
|-
|946
|''ASR3''
|[[Os02g0543000]]
|10.1007/s10059-013-0036-7
| Abiotic Stress Responsive Rice ASR1 and ASR3 Exhibit Different Tissue-Dependent Sugar and Hormone-Sensitivities
|
|-
|947
|''OsDIL1''
|[[Os10g0148000]]
|10.1007/s11103-013-0057-9
|
|Annotated
|-
|948
|''SLL1''
|[[Os04g0379900]]
|10.1016/j.plantsci.2013.01.003
| SLL1, which encodes a member of the stearoyl-acyl carrier protein fatty acid desaturase family, is involve
|
|-
|949
|''Oscyp71Z2''
|[[Os07g0217600]]
|10.1016/j.plantsci.2013.02.005
| Oscyp71Z2 involves diterpenoid phytoalexin biosynthesis that contributes to bacterial blight resistance in rice
|
|-
|950
|''OsGPX3''
|[[Os02g0664000]]
|10.1016/j.plantsci.2013.03.017
|The mitochondrial glutathione peroxidase GPX3 is essential for H 2 O 2 homeostasis and root and shoot development in rice
|
|-
|951
|''OsGS1;2''
|[[Os03g0223400]]
|10.1093/pcp/pct046
|
|Annotated
|-
|952
|''MSF1''
|[[Os05g0497200]]
|10.1104/pp.113.216044
|Annotated
|
|-
|953
|''CAP1''
|[[Os02g0141300]]
|10.1104/pp.113.216523
|
|Annotated
|-
|954
|''glup6''
|[[Os03g0262900]]
|10.1104/pp.113.217869
|Annotated
|
|-
|955
|''OsGDCH''
|[[Os10g0516100]]
|10.1111/pce.12078
| Knockdown of GDCH gene reveals reactive oxygen species-induced leaf senescence in rice
|
|-
|956
|''RGA4''
|[[Os11g0225100]]
|10.1105/tpc.112.107201
|
|Annotated
|-
|957
|''RGA5''
|[[Os11g0225300]]
|10.1105/tpc.112.10720
| The Rice Resistance Protein Pair RGA4/RGA5 Recognizes the Magnaporthe oryzae Effectors AVR-Pia and AVR1-CO39 by Direct Binding
|
|-
|958
|''LOX3''
|[[Os03g0700400]]
|10.1007/s12374-013-0085-7
| Molecular Genetic Characterization of Rice Seed Lipoxygenase 3 and Assessment of Its Effects on Seed Longevity
|
|-
|959
|''Sar1a''
|[[Os01g0338000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|-
|960
|''Sar1b''
|[[Os12g0560300 ]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|961
|''Sar1c''
|[[Os01g0254000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|961
|''Sar1d''
|[[Os06g0225000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|962
|''vyl''
|[[Os03g0411500]]
|10.1104/pp.113.217604
|
|Annotated
|-
|963
|''SERF1''
|[[Os05g0420300]]
|10.1105/tpc.113.113068
| SALT-RESPONSIVE ERF1 Regulates Reactive Oxygen Species–Dependent Signaling during the Initial Response to Salt Stress in Rice
|
|-
|964
|''dep''
|[[Os05g0118700]]
|10.1186/1939-8433-5-28
|A WUSCHEL-related homeobox 3B gene, depilous (dep), confers glabrousness of rice leaves and glumes
|
|-
|965
|''LC1''
|[[Os01g0785400]]
|10.1093/mp/sss064
|
|
|-
|966
|''TUD1''
|[[Os03g0232600]]
|10.1371/journal.pgen.1003391
|Annotated
|
|-
|967
|''GL3.1''
|[[Os03g0646900]]
|10.1038/cr.2012.151
|
|Annotated
|-
|971
|''Oshox22''
|[[Os04g0541700]]
|10.1007/s11103-012-9967-1
|Annotated
|
|-
|972
|''OsLG1''
|[[Os04g0656500]]
|10.1038/ng.2567
| OsLG1 regulates a closed panicle trait in domesticated rice
|
|-
|973
|''OsMSH5''
|[[Os05g0498300]]
|10.1093/mp/sss145
|Annotated
|
|-
|974
|''ABCG15''
|[[Os06g0607700]]
|10.1093/pcp/pcs162
|Annotated
|
|-
|975
|''TGW6''
|[[Os06g0623700]]
|10.1038/ng.2612
|Loss of function of the IAA-glucose hydrolase gene TGW6 enhances rice grain weight and increases yield
|
|-
|976
|''OsFD2''
|[[Os06g0720900]]
|10.1093/pcp/pct005
| Functional Diversification of FD Transcription Factors in Rice, Components of Florigen Activation Complexes
|Annotated
|-
|127
|''OsFD1''
|[[Os09g0540800]]
|10.1038/nature10272
| Functional Diversification of FD Transcription Factors in Rice, Components of Florigen Activation Complexes
|-
|977
|''OsDGL1''
|[[Os07g0209000]]
|10.1093/pcp/pcs159
| OsDGL1, a Homolog of an Oligosaccharyltransferase Complex Subunit, is Involved in N-Glycosylation and Root Development in Rice
|
|-
|978
|''Rurm1''
|[[Os07g0466300]]
|10.1093/mp/sst042
|Loss-of-Function of a Ubiquitin-Related Modifier Promotes the Mobilization of the Active MITE mPing
|
|-
|979
|''RSS3''
|[[Os11g0446000]]
|10.1105/tpc.113.112052
|
|Annotated
|-
|980
|''OsRecQl4''
|[[Os04g0433800]]
|10.1093/pcp/pcs155
| DNA replication arrest leads to enhanced homologous recombination and cell death in meristems of rice OsRecQl4 mutants
|
|-
|981
|''OsExo1''
|[[Os01g0777300]]
|10.1093/pcp/pcs155
| Rice exonuclease-1 homologue, OsEXO1, that interacts with DNA polymerase k and RPA subunit proteins, is involved in cell proliferation
|
|-
|982
|''OsIRX10''
|[[Os01g0926700]]
|10.1093/mp/sss135
| Inactivation of OsIRX10 Leads to Decreased Xylan Content in Rice Culm Cell Walls and Improved Biomass Saccharification
|
|-
|983
|''OsCpn60α1''
|[[Os12g0277500]]
|10.1007/s10059-013-2337-2
| OsCpn60α1, Encoding the Plastid Chaperonin 60α Subunit, Is Essential for Folding of rbcL
|
|-
|985
|''Dro1''
|[[Os09g0439800]]
|10.1038/ng.2725
|Annotated
|
|-
|986
|''OsSAG12-1''
|[[Os01g0907600]]
|10.1007/s12038-013-9334-7
| Down-regulation of OsSAG12-1 results in enhanced senescence and pathogen-induced cell death in transgenic rice plants
|
|-
|987
|''BGL11(t)''
|[[Os11g0592900]]
|10.1007/s13258-013-0094-4
| Identification and characterization of BGL11(t), a novel gene regulating leaf-color mutation in rice (Oryza sativa L.)
|
|-
|990
|''OsDET1''
|[[Os01g0104600]]
|10.1016/j.plantsci.2013.06.003
| Mutation of OsDET1 increases chlorophyll content in rice
|
|-
|991
|''OsVHA-A''
|[[Os06g0662000]]
|10.1371/journal.pone.0069046
|Annotated
|
|-
|992
|''TIFY11b''
|[[Os03g0181100]]
|10.1271/bbb.120545
| Overexpression of a Rice TIFY Gene Increases Grain Size through Enhanced Accumulation of Carbohydrates in the Stem
|
|-
|994
|''GE''
|[[Os07g0603700]]
|10.1111/tpj.12223
| GIANT EMBRYO encodes CYP78A13, required for proper size balance between embryo and endosperm in rice
|
|-
|999
|''OsAP65''
|[[Os07g0592200]]
|10.1093/jxb/ert173
| OsAP65, a rice aspartic protease, is essential for male fertility and plays a role in pollen germination and pollen tube growth
|
|-
|1000
|''OsbZIP58''
|[[Os07g0182000]]
|10.1093/jxb/ert187
| OsbZIP58, a basic leucine zipper transcription factor, regulates starch biosynthesis in rice endosperm
|
|-
|1001
|''YGL138(t)''
|[[Os11g0153600]]
|10.1186/1939-8433-6-7
| YGL138(t), encoding a putative signal recognition
particle 54 kDa protein, is involved in chloroplast
development of rice
|Development
|-
|1003
|''OsGA20ox3''
|[[Os07g0169700]]
|10.1094/MPMI-05-12-0138-R
| Gibberellin 20-Oxidase Gene OsGA20ox3 Regulates
Plant Stature and Disease Development in Rice
|Stress
|-
|1004
|''Hd16''
|[[Os03g0793500]]
|10.1111/tpj.12268
|
|Annotated
|-
|1005
|''Bh4''
|[[Os04g0460200]]
|10.1104/pp.110.168500
| Genetic Control of a Transition from Black to Straw-White Seed Hull in Rice Domestication
|Development
|-
|1006
|''OsSUV3''
|[[Os03g0746500]]
|10.1111/tpj.12277
|
|Annotated
|-
|1007
|''OsMPS''
|[[Os02g0618400]]
|10.1111/tpj.12286
|
|Annotated
|-
|1008
|''OsCDT3''
|[[Os01g0178300]]
|10.1111/tpj.12296
|A plasma membrane-localized small peptide is involved in rice aluminum tolerance
|Stress
|-
|1009
|''CRC1''
|[[Os04g0479000]]
|10.1105/tpc.113.113175
| CENTRAL REGION COMPONENT1, a Novel Synaptonemal Complex Component, Is Essential for Meiotic Recombination Initiation in Rice
|Development
|-
|1010
|''ASL1''
|[[Os01g0678600]]
|10.1534/g3.113.007856
|Disruption of the Rice Plastid Ribosomal Protein S20 Leads to Chloroplast Developmental Defects and Seedling Lethality
|Development
|-
|1011
|''OsNAP''
|[[Os03g0327800]]
|10.1186/1471-2229-13-132
|
|Annotated
|-
|1012
|''GS6''
|[[Os06g0127800]]
|10.1111/jipb.12062
|
|Annotated
|-
|1013
|''OsHOS1''
|[[Os03g0737200]]
|10.1007/s11103-013-0092-6
| Isolation and characterization of rice (Oryza sativa L.) E3-ubiquitin ligase OsHOS1 gene in the modulation of cold stress response
|Stress
|-
|1014
|''SGRL''
|[[Os04g0692600]]
|10.1016/j.jplph.2013.05.016
|
|The Stay-Green Rice like (SGRL) gene regulates chlorophyll degradation in rice
|-
|1017
|''An-1''
|[[Os04g0350700]]
|10.1105/tpc.113.113589
|
|Annotated
|-
|1018
|''OslecRK''
|[[Os04g0201900]]
|10.1111/tpj.12328
|
|A rice lectin receptor-like kinase that is involved in innateimmune responses also contributes to seed germination
|-
|1020
|''OsVOZ2''
|[[Os05g0515700]]
|10.1371/journal.pone.0073346
|Xanthomonas oryzae pv. oryzae Type III Effector XopN Targets OsVOZ2 and a Putative Thiamine Synthase as a Virulence Factor in Rice
|Stress
|-
|1021
|''OsHsfB2b''
|[[Os08g0546800]]
|10.1007/s00299-013-1492-4
|
|Annotated
|-
|1022
|''OsGRX8''
|[[Os02g0512400]]
|10.1007/s00425-013-1940-y
|Modified expression of an auxin‐responsive rice CC‐type glutaredoxin gene affects multiple abiotic stress responses
| stress
|-
|1023
|''DAO''
|[[Os04g0475600]]
|10.1016/j.devcel.2013.09.005
|
|Annotated
|-
|1024
|''OsHMA5''
|[[Os04g0556000]]
|10.1104/pp.113.226225
|A Member of the Heavy Metal P-Type ATPase OsHMA5 Is Involved in Xylem Loading of Copper in Rice
|Stress
|-
|1025
|''Osoxo4''
|[[Os03g0693700]]
|10.1111/mpp.12055
|
|Rice oxalate oxidase gene driven by green tissue-specific promoter increases tolerance to sheath blight pathogen (Rhizoctonia solani) in transgenic rice
|-
|1026
|''OsSTN8''
|[[Os05g0480000]]
|10.1111/tpj.12331
|
|Loss-of-function of OsSTN8 suppresses the photosystem II core protein phosphorylation and interferes with the photosystem II repair mechanism in rice
|-
|1027
|''OsEXPA8''
|[[Os01g0248900]]
|10.1371/journal.pone.0075997
|
|Overexpression of OsEXPA8, a root-specific gene, improves rice growth and root system architecture by facilitating cell extension
|-
|1028
|''OsPRR37''
|[[Os07g0695100]]
|10.1093/mp/sst088
|
|Natural Variation in OsPRR37 Regulates Heading Date and Contributes to Rice Cultivation at a Wide Range of Latitudes
|-
|1029
|''OsMADS57''
|[[Os02g0731200]]
|10.1038/ncomms2542
|
|Annotated
|-
|1030
|''DWA1''
|[[Os04g0473900]]
|10.1073/pnas.1316412110
|
|Annotated
|-
|1031
|''gpa2''
|[[Os03g0262900]]
|10.1093/mp/sst081
|
|Annotated
|-
|1032
|''MHZ7/OsEIN2''
|[[Os07g0155600]]
|10.1093/mp/sst087
|
|Annotated
|-
|1033
|''YGL2''
|[[Os06g0603000]]
|10.1007/s00299-013-1498-y
|
|Annotated
|-
|1034
|''OsMTP8.1''
|[[Os03g0226400]]
|10.1093/jxb/ert243
|Mn tolerance in rice is mediated by MTP8.1, a member of the cation diffusion facilitator family
|
|-
|1035
|''this1''
|[[Os01g0751600]]
|10.1093/jxb/ert256
| THIS1 is a putative lipase that regulates tillering, plant height, and spikelet fertility in rice
|
|-
|1036
|''OsABCG15''
|[[Os06g0607700]]
|10.1111/jipb.12053
|
|The ATP‐binding Cassette Transporter OsABCG15 is Required for Anther Development and Pollen Fertility in Rice
|-
|1037
|''OsRRMh''
|[[Os09g0516300]]
|10.1111/jipb.12056
| OsRRMh, a Spen-like gene, plays an important role during the vegetative to reproductive transition in rice.
|
|-
|1038
|''OsCTR2''
|[[Os02g0527600]]
|10.1093/jxb/ert272
| Rice CONSTITUTIVE TRIPLE-RESPONSE2 is involved in the ethylene-receptor signalling and regulation of various aspects of rice growth and development
|
|-
|1039
|''OsbZIP71''
|[[Os09g0306400]]
|10.1007/s11103-013-0115-3
|
|Annotated
|-
|1040
|''OsHox33''
|[[Os12g0612700]]
|10.1007/s11427-013-4565-2
|Knockdown of OsHox33, a member of the class III homeodomain-leucine zipper gene family, accelerates leaf senescence in rice
|
|-
|1041
|''OsGAPDHB''
|[[Os03g0129300]]
|10.1016/j.plantsci.2013.09.010
|A proteomic study of rice cultivar TNG67 and its high aroma mutant SA0420.
|
|-
|1042
|''OsAPX7''
|[[Os04g0434800]]
|10.1016/j.plantsci.2013.10.001
| The knockdown of chloroplastic ascorbate peroxidases reveals its regulatory role in the photosynthesis and protection under photo-oxidative stress in rice
|
|-
|1043
|''OsAPX8''
|[[Os02g0553200]]
|10.1016/j.plantsci.2013.10.001
|
|Annotated
|-
|1044
|''OsRNS4''
|[[Os09g0537700]]
|10.1016/j.plantsci.2013.10.003
|
|Annotated
|-
|1045
|''D53''
|[[Os11g0104300]]
|"10.1038/nature12870, 10.1038/nature12878"
|
|Annotated
|-
|1046
|''OsHRZ1''
|[[Os01g0689451]]
|10.1038/ncomms3792
| Iron-binding haemerythrin RING ubiquitin ligases regulate plant iron responses and accumulation
|
|-
|1047
|''OsHRZ2''
|[[Os05g0551000]]
|10.1038/ncomms3792
|Iron-binding haemerythrin RING ubiquitin ligases regulate plant iron responses and accumulation
|
|-
|1048
|''PTB1''
|[[Os05g0145000]]
|10.1038/ncomms3793
| Natural variation in PTB1 regulates rice seed setting rate by controlling pollen tube growth
|
|-
|1050
|''OsBOR4''
|[[Os05g0176800]]
|10.1093/pcp/pct136
|
|Annotated
|-
|1051
|''LYL1''
|[[Os02g0744900]]
|10.1371/journal.pone.0075299
| Mutation of the Light-Induced Yellow Leaf 1 Gene, Which Encodes a Geranylgeranyl Reductase, Affects Chlorophyll Biosynthesis and Light Sensitivity in Rice
|
|-
|1052
|''OsEBS''
|[[Os05g0591400]]
|10.1111/pbi.12097
|Identification and characterization of OsEBS, a gene involved in enhanced plant biomass and spikelet number in rice
|
|-
|1053
|''SOR1''
|[[Os04g0101800]]
|10.1186/1939-8433-6-30
| Isolation of a novel mutant gene for soil-surface rooting in rice (Oryza sativa L.)
|
|-
|1054
|''OsCPK10''
|[[Os03g0788500]]
|10.1016/j.plaphy.2013.10.004
|
|Annotated
|-
|1055
|''JMJ705''
|[[Os01g0907400]]
|10.1105/tpc.113.118802
| Jumonji C Domain Protein JMJ705-Mediated Removal of Histone H3 Lysine 27 Trimethylation Is Involved in Defense-Related Gene Activation in Rice
|Stress
|-
|1056
|''OsCCaMK''
|[[Os05g0489900]]
|10.1128/AEM.03646-13.
| A rice gene for microbial symbiosis, OsCCaMK, reduces CH 4 flux in a paddy field with low nitrogen input
|Stress
|-
|1061
|''LH8''
|[[Os08g0174500]]
|10.1038/srep04263
|
|Annotated
|-
|1063
|''OsTrx1''
|[[Os09g0134500]]
|10.1104/pp.113.228049
| Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3
|
|-
|1071
|''RIXI''
|[[Os11g0701800]]
|10.1007/s10658-013-0342-0
| Functional characterization of a new pathogen induced xylanase inhibitor (RIXI) from rice
|
|-
|1072
|''TCD9''
|[[Os09g0563300]]
|10.1016/j.plantsci.2013.11.003
|Importance of the rice TCD9 encoding α subunit of chaperonin protein 60 (Cpn60α) for the chloroplast development during the early leaf stage.
|
|-
|1074
|''OsBURP16''
|[[Os10g0409400]]
|10.1111/pce.12223
| Overexpression of stress-inducible OsBURP16, the β subunit of polygalacturonase 1, decreases pectin content and cell adhesion and increases abiotic stress sensitivity in rice
|
|-
|1075
|''OsDSR2''
|[[Os01g0839200]]
|10.1007/s00299-013-1532-0
|Overexpression of a new stress-repressive gene OsDSR2 encodinga protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice
|
|-
|1076
|''ssg4''
|[[Os01g0179400]]
|10.1104/pp.113.229591
| Amyloplast-Localized SUBSTANDARD STARCH GRAIN4 Protein Influences the Size of Starch Grains in Rice Endosperm
|
|-
|1080
|''OsAMT1;1''
|[[Os04g0509600]]
|10.1093/jxb/ert458
| AMT1;1 transgenic rice plants with enhanced NH4+ permeability show superior growth and higher yield under optimal and suboptimal NH4+ conditions
|
|-
|1082
|''WLP1''
|[[Os01g0749200]]
|10.1007/s11103-013-0134-0
| The rice nuclear gene WLP1 encoding a chloroplast ribosome L13 protein is needed for chloroplast development in rice grown under low temperature conditions
|
|-
|1083
|''ADH1''
|[[Os11g0210300]]
|10.1093/aob/mct305
|
|Annotated
|-
|1084
|''OsAlba1''
|[[Os01g0173100]]
|10.1016/j.phytochem.2014.01.015
|
|Annotated
|-
|1086
|''OsDCL3a''
|[[Os01g0909200]]
|10.1073/pnas.1318131111
|
|Annotated
|-
|1087
|''SGL''
|[[Os05g0154700]]
|10.1007/s00299-013-1524-0
|
|Annotated
|-
|1088
|''OsHI-XIP''
|[[Os05g0247100]]
|10.1007/s11105-013-0661-5
| Overexpression of a Xylanase Inhibitor Gene, OsHI-XIP, Enhances Resistance in Rice to Herbivore
|
|-
|1089
|''OsZHD1''
|[[Os09g0466400]]
|10.1007/s00425-013-2009-7
|
|Annotated
|-
|1090
|''CYP96B4''
|[[Os03g0140400]]
|10.1371/journal.pone.0088068
| The rice semi-dwarf mutant sd37, caused by a mutation in CYP96B4, plays an important role in the fine-tuning of plant growth.
|
|-
|1092
|''FLO6''
|[[Os03g0686900]]
|10.1111/tpj.12444
| FLOURY ENDOSPERM6 encodes a CBM48 domain-containing protein involved in compound granule formation and starch synthesis in rice endosperm
|
|-
|1093
|''OsKS2''
|[[Os04g0612000]]
|10.1111/plb.12069
|
|Annotated
|-
|1094
|''OsDG2''
|[[Os02g0606000]]
| 10.1007/s00299-013-1549-4
| The rice OsDG2 encoding a glycine-rich protein is involved in the regulation of chloroplast development during early seedling stage
|
|-
|1095
|''Hwi2''
|[[Os01g0795400]]
|10.1038/ncomms4357
|
|A two-locus interaction causes interspecific hybrid weakness in rice
|-
|1222
|''Hwi1''
|[[Os11g0173500]]
|10.1038/ncomms4357
|
|A two-locus interaction causes interspecific hybrid weakness in rice
|-
|1096
|''OsGLO4''
|[[Os07g0152900]]
|10.1111/ppl.12104
| Suppression of glycolate oxidase causes glyoxylate accumulation that inhibits photosynthesis through deactivating Rubisco in rice
|
|-
|1097
|''DL''
|[[Os03g0215200]]
|10.1111/tpj/12411
|
|Annotated
|-
|1098
|''OsETT2''
|[[Os01g0670800]]
|10.1111/tpj/12411
| The DROOPING LEAF and OsETTIN2 genes promote awndevelopment in rice
|
|-
|1099
|''SHL2''
|[[Os01g0527600]]
|10.1111/tpj/12411
| Rice RNA-dependent RNA polymerase 6 acts in small RNA biogenesis and spikelet development.
|
|-
|1100
|''OsLIS''
|[[Os02g0121700]]
|10.1111/pce.12169
| Jasmonate induction of the monoterpene linalool confers resistance to rice bacterial blight and its biosynthesis is regulated by JAZ protein in rice
|
|-
|1101
|''OsPT9''
|[[Os06g0324800]]
|10.1111/pce.12224
|Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in rice.
|
|-
|1102
|''OsPT10''
|[[Os06g0325200]]
|10.1111/pce.12224
| Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in rice.
|
|-
|1106
|''LTG1''
|[[Os02g0622100]]
|10.1111/tpj.12487
| Annotated
|-
|1107
|''OsRPK1''
|[[Os05g0486100]]
|10.1016/j.bbagen.2014.01.003
|
|Annotated
|-
|1108
|''d89''
|[[Os05g0333200]]
|10.1007/s10681-014-1071-y
|
|Annotated
|-
|1112
|''OsEMF2b''
|[[Os09g0306800]]
|10.1007/s11105-014-0733-1
| OsEMF2b Acts as a Regulator of Flowering Transition and Floral Organ Identity by Mediating H3K27me3 Deposition at OsLFL1 and OsMADS4 in Rice
|
|-
|1117
|''OsFIE1''
|[[Os08g0137250]]
|10.1104/pp.113.232413
|
|Annotated
|-
|1118
|''OsUGE1''
|[[Os05g0595100]]
|10.1371/journal.pone.0096158
| Functional Characterization of the Rice UDP-glucose 4- epimerase 1, OsUGE1: A Potential Role in Cell Wall Carbohydrate Partitioning during Limiting Nitrogen Conditions
|
|-
|1119
|''OsATG7''
|[[Os01g0614900]]
|10.4161/auto.28279
| OsATG7 is required for autophagy-dependent lipid metabolism in rice postmeiotic anther development
|
|-
|1120
|''chalk5''
|[[Os05g0156900]]
|10.1038/ng.2923
| Chalk5 encodes a vacuolar H + -translocating pyrophosphatase influencing grain chalkiness in rice
|
|-
|1122
|''cl7(t)''
|[[Os07g0616000]]
|10.1093/jxb/eru074
|Rice DENSE AND ERECT PANICLE 2 is essential for determining panicle outgrowth and elongation
|
|-
|1123
|''OsGPX1''
|[[Os04g0556300]]
|10.1007/s10535-014-0394-9
|Chloroplastic and mitochondrial GPX genes play a critical role in rice development
|
|-
|1124
|''OsGPX4''
|[[Os06g0185900]]
|10.1007/s10535-014-0394-9
| Chloroplastic and mitochondrial GPX genes play a critical role in rice development
|
|-
|1125
|''D1352''
|[[Os03g0232600]]
|10.1007/s11032-014-0021-7
|
|Annotated
|-
|1126
|''OsAHP1''
|[[Os08g0557700]]
|10.1104/pp.113.232629
| Two Rice Authentic Histidine Phosphotransfer Proteins, OsAHP1 and OsAHP2, Mediate Cytokinin Signaling and Stress Responses in Rice
|
|-
|1127
|''OsAHP2''
|[[Os09g0567400]]
|10.1104/pp.113.232629
| Two Rice Authentic Histidine Phosphotransfer Proteins, OsAHP1 and OsAHP2, Mediate Cytokinin Signaling and Stress Responses in Rice
|
|-
|1128
|''OsWR2''
|[[Os06g0604000]]
|10.1007/s11105-013-0687-8
|
|Annotated
|-
|1129
|''Se14''
|[[Os03g0151300]]
|10.1371/journal.pone.0096064
| Se14, Encoding a JmjC Domain-Containing Protein, Plays Key Roles in Long-Day Suppression of Rice Flowering through the Demethylation of H3K4me3 of RFT1
|
|-
|1130
|''MET1b''
|[[Os07g0182900]]
|10.1007/s11103-014-0178-9
|
|Annotated
|-
|1131
|''MET1a''
|[[Os03g0798300]]
|10.1007/s11103-014-0178-9
| Homologous recombination-mediated knock-in targeting of the MET1a gene for a maintenance DNA methyltransferase reproducibly reveals dosage-dependent spatiotemporal gene expression in rice
|
|-
|1133
|''smos1''
|[[Os05g0389000]]
|10.1093/pcp/pcu023
| A Novel AP2-Type Transcription Factor, SMALL ORGAN SIZE1, Controls Organ Size Downstream of an Auxin Signaling Pathway
|
|-
|1135
|''OsCPK4''
|[[Os02g0126400]]
|10.1104/pp.113.230268
|
|Annotated
|-
|1136
|''OsPAD4''
|[[Os11g0195500]]
|10.1111/tpj.12500
| Rice OsPAD4 functions differently from Arabidopsis AtPAD4 in host-pathogen interactions
|
|-
|1137
|''OsMOGS''
|[[Os01g0921200]]
|10.1111/tpj.12497
|
|Annotated
|-
|1138
|''OsJAR1''
|[[Os05g0586200]]
|10.1111/pce.12201
|
|Annotated
|-
|1139
|''OsMADS34''
|[[Os03g0756100]]
|10.1111/nph.12657
|
|Annotated
|-
|1140
|''OsMRP5''
|[[Os03g0142800]]
|10.1007/s11248-014-9792-1
| Seed-specific silencing of OsMRP5 reduces seed phytic acid and weight in rice
|
|-
|1141
|''TMS 9-1(OsMS1)''
|[[Os09g0449000]]
|10.1007/s00122-014-2289-8
|
|Annotated
|-
|1142
|''epsps''
|[[Os06g0133900]]
|10.1111/nph.12428
|A novel 5-enolpyruvoylshikimate-3-phosphate (EPSP) synthase transgene for glyphosate resistance stimulates growth and fecundity in weedy rice (Oryza sativa) without herbicide
|
|-
|1143
|''DWT1''
|[[Os01g0667400]]
|10.1371/journal.pgen.1004154
|
|Annotated
|-
|1144
|''DP2''
|[[Os02g0531600]]
|10.1007/s13258-013-0169-2
| Morphological characteristics and gene mapping of a dense panicle (dp2) mutant in rice (Oryza sativa L.)
|
|-
|1145
|''OsRACK1A''
|[[Os01g0686800]]
|10.1371/journal.pone.0097120
|OsRACK1 Is Involved in Abscisic Acid- and H 2 O 2 - Mediated Signaling to Regulate Seed Germination in Rice (Oryza sativa, L.)
|
|-
|1223
|''OsCAF1A''
|[[Os08g0440300]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1146
|''OsCAF1B''
|[[Os04g0684900]]
|10.1007/s11103-014-0196-7
|
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|-
|1147
|''OsCAF1G''
|[[Os09g0416800]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1148
|''OsCAF1H''
|[[Os02g0796300]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1149
|''OsLOX2 (L-2)''
|[[Os03g0738600]]
|10.1007/s11248-014-9803-2
| OsLOX2, a rice type I lipoxygenase, confers opposite effects on seed germination and longevity
|
|-
|1150
|''OsNAC111''
|[[Os10g0177000]]
|10.1094/mpmi-03-14-0065-r
| OsNAC111, a Blast Disease–Responsive Transcription Factor in Rice, Positively Regulates the Expression of Defense-Related Genes
|
|-
|1152
|''OsCKX4''
|[[Os01g0940000]]
|10.1104/pp.114.238584
|
|Annotated
|-
|1155
|''DIF1''
|[[Os01g0626400]]
|10.1371/journal.pone.0102529
|
|Annotated
|-
|1164
|''CYP93G1''
|[[Os04g0101400]]
|10.1104/pp.114.239723
| Cytochrome P450 93G1 Is a Flavone Synthase II That Channels Flavanones to the Biosynthesis of Tricin O-Linked Conjugates in Rice
|
|-
|1224
|''CYP93G2''
|[[Os06g0102100]]
|10.1104/pp.114.239723
| CYP93G2 Is a Flavanone 2-Hydroxylase Required for C-Glycosylflavone Biosynthesis in Rice
|
|-
|1165
|''OsMYB4P''
|[[Os11g0558200]]
|10.1016/j.plaphy.2014.02.024
| Overexpression of OsMYB4P, an R2R3-type MYB transcriptional activator, increases phosphate acquisition in rice
|
|-
|1166
|''rip-3 (a-tubulin)''
|[[Os03g0726100]]
|10.1016/j.plaphy.2014.04.011
| Water-stress-induced inhibition of a -tubulin gene expression during growth, and its implications for reproductive success in rice
|
|-
|1167
|''OsRDR1''
|[[Os02g0736200]]
|10.1186/1471-2229-14-177
| Mutation of the RDR1 gene caused genome-wide changes in gene expression, regional variation in small RNA clusters and localized alteration in DNA methylation in rice
|
|-
|1168
|''ygl7''
|[[Os03g0811100]]
|10.1371/journal.pone.0099564
|
|Annotated
|-
|1169
|''OsDREB6''
|[[Os09g0369000]]
|10.1007/s12374-013-0480-0
| Characterization of OsDREB6 Responsive to Osmotic and Cold Stresses in Rice
|
|-
|1170
|''OsPAO7''
|[[Os09g0368500]]
|10.1093/pcp/pcu047
| Polyamine Oxidase 7 is a Terminal Catabolism-Type Enzyme in Oryza sativa and is Specifically Expressed in Anthers
|
|-
|1172
|''OsAGPL2''
|[[Os01g0633100]]
|10.1093/pcp/pcu057
| The Rice Endosperm ADP-Glucose Pyrophosphorylase Large Subunit is Essential for Optimal Catalysis and Allosteric Regulation of the Heterotetrameric Enzyme
|
|-
|1173
|''OsMYB103L''
|[[Os08g0151300]]
|10.1186/1471-2229-14-158
| OsMYB103L, an R2R3-MYB transcription factor, influences leaf rolling and mechanical strength in rice
|
|-
|1174
|''DRO1''
|[[Os09g0439800]]
|10.1038/srep05563
|
|Annotated
|-
|1175
|''FIB''
|[[Os01g0169800]]
|10.1111/tpj.12517
|
|Annotated
|-
|1176
|''OsNIP3;1''
|[[Os10g0513200]]
|10.1111/tpj.12511
| OsNIP3;1, a rice boric acid channel, regulates boron distribution and is essential for growth under boron-deficient conditions
|
|-
|1177
|''OsETOL1''
|[[Os03g0294700]]
|10.1111/tpj.12508
|
|Annotated
|-
|1178
|''OsGLY1-11.2''
|[[Os08g0191700]]
|10.1111/tpj.12521
| A unique Ni 2+ -dependent and methylglyoxal-inducible rice glyoxalase I possesses a single active site and functions in abiotic stress response
|
|-
|1179
|''OsKTN80a''
|[[Os10g0494800]]
|10.1111/jipb.12170
| Overexpression of OsKTN80a, a katanin P80 ortholog, caused the repressed cell elongation and stalled cell division mediated by microtubule apparatus defects in primary root in Oryza Sativa
|
|-
|1180
|''WRKY45''
|[[Os05g0322900]]
|10.1007/s11103-014-0221-x
|
|Annotated
|-
|1181
|''OsRZFP34''
|[[Os01g0719100]]
|10.1007/s11103-014-0217-6
|Expression of a gene encoding a rice RING zinc‐finger protein, OsRZFP34, enhances stomata opening
|Stress
|-
|1182
|''OsSPS1''
|[[Os01g0919400]]
|10.1016/j.plantsci.2014.05.018
|
|Annotated
|-
|1183
|''AM1''
|[[Os04g0682800]]
|10.1007/s00299-014-1639-y
|
|Annotated
|-
|1184
|''OsMPK3''
|[[Os02g0148100]]
|10.1007/s00299-014-1620-9
|
|Annotated
|-
|1186
|''OsMet1-2''
|[[Os07g0182900]]
|10.1073/pnas.1410761111
|
|Annotated
|-
|1189
|''sped1''
|[[Os06g0597500]]
|10.1534/genetics.114.163931
|Regulation of Inflorescence Branch Development in Rice Through a Novel Pathway Involving the Pentatricopeptide Repeat Protein sped1-D
|
|-
|1190
|''OsXXT1''
|[[Os03g0300000]]
|10.1093/jxb/eru189
| Mutation in xyloglucan 6-xylosytransferase results in abnormal root hair development in Oryza sativa
|
|-
|1191
|''Nrat1''
|[[Os02g0131800]]
|10.1093/jxb/eru201
|
|Annotated
|-
|1192
|''SLCHL4 (NAL1)''
|[[Os04g0615000]]
|10.1093/mp/ssu055
|
|Annotated
|-
|1193
|''OsNMD3''
|[[Os10g0573900]]
|10.1093/jxb/eru150
|
|Annotated
|-
|1194
|''OsRAN1''
|[[Os01g0611100]]
|10.1093/jxb/eru178
|
|Annotated
|-
|1195
|''OsABCB14''
|[[Os04g0459000]]
|10.1111/tpj.12544
| OsABCB14 functions in auxin transport and iron homeostasis in rice (Oryza sativa.L)
|
|-
|1196
|''OsRAD51D''
|[[Os09g0104200]]
|10.1111/tpj.12558
|
|Annotated
|-
|1197
|''OsYUCCA11''
|[[Os12g0189500]]
|10.1111/tpj.12553
|
|Annotated
|-
|1198
|''Roc5(rl(t))''
|[[Os02g0674800]]
|10.1007/s11434-014-0357-8
|Isolation and characterization of rl (t) , a gene that controls leaf rolling in rice
|
|-
|1200
|''OsB12D1''
|[[Os07g0604700]]
|10.3390/ijms150813461
|The Mitochondrion-Located Protein OsB12D1 Enhances Flooding Tolerance during Seed Germination and Early Seedling Growth in Rice
|Stress
|-
|1201
|''OsHO2''
|[[Os03g0395000]]
|10.1007/s00425-014-2116-0
|Annotated
|Biosynthesis
|-
|1202
|''CL4 (= dwarf11)''
|[[Os04g0469800]]
|10.1007/s11434-014-0568-z
|Annotated
|Development
|-
|1203
|''OsEXPA3''
|[[Os05g0276500]]
|10.2135/cropsci2013.11.0746
|Repression of OsEXPA3 Expression Leadsto Root System Growth Suppression in Rice
|Stress,Development
|-
|1204
|''bHLH142''
|[[Os01g0293100]]
|10.1105/tpc.114.126292
|Annotated
|Development
|-
|1205
|''SIT1''
|[[Os02g0640500]]
|10.1105/tpc.114.125187
|The Receptor-Like Kinase SIT1 Mediates Salt
Sensitivity by Activating MAPK3/6 and Regulating
Ethylene Homeostasis in Rice
|Stress
|-
|1206
|''SIT2''
|[[Os04g0531400]]
|10.1105/tpc.114.125187
| The Receptor-Like Kinase SIT1 Mediates Salt
Sensitivity by Activating MAPK3/6 and Regulating
Ethylene Homeostasis in Rice
|Stress
|-
|1207
|''CPK18''
|[[Os07g0409900]]
|10.1105/tpc.114.126441
| Direct Phosphorylation and Activation of a Mitogen-Activated
Protein Kinase by a Calcium-Dependent Protein
Kinase in Rice
|Stress
|-
|1208
|''OsHPR1''
|[[Os02g0101500]]
|10.1111/jipb.12125
| Two hydroxypyruvate reductases encoded by OsHPR1 and OsHPR2 are involved in
photorespiratory metabolism in rice
|Metabolism
|-
|1222
|''OsHPR2''
|[[Os01g0228600]]
|10.1111/jipb.12125
| Two hydroxypyruvate reductases encoded by OsHPR1 and OsHPR2 are involved in
photorespiratory metabolism in rice
|Metabolism
|-
|1209
|''OsCAD2''
|[[Os02g0187800]]
|10.1038/srep06567
|Annotated
|
|-
|1210
|''OsSLI1''
|[[Os02g0649300]]
|10.1155/2014/809353
|OsSLI1, a Homeodomain Containing Transcription Activator, Involves Abscisic Acid Related Stress Response in Rice (Oryza sativa L.)
|Stress,Development
|-
|1211
|''OsMKK1 (MAPKK)''
|[[Os06g0147800]]
|10.1016/j.plantsci.2014.08.007
|The mitogen-activated protein kinase cascade MKK1-MPK4 mediates salt signaling in rice
|Stress
|-
|1212
|''SPK1(SYG1)''
|[[Os06g0603600]]
|10.1073/pnas.1404680111
|Annotated
|Finished
|-
|1213
|''SPK2(SYG2)''
|[[Os02g0202200]]
|10.1073/pnas.1404680111
| Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner
|
|-
|1215
|''OsAAP6''
|[[Os01g0878700]]
|10.1038/ncomms5847
| OsAAP6 functions as an important regulator of grain protein content and nutritional quality in rice
|
|-
|1216
|''OsSOT1(STV11)''
|[[Os11g0505300]]
|10.1038/ncomms5768
| STV11 encodes a sulphotransferase and confers durable resistance to rice stripe virus
|
|-
|1217
|''tms5''
|[[Os02g0214300]]
|10.1038/srep06567
|
|Annotated
|-
|1218
|''CYP703A3''
|[[Os08g0131100]]
|10.1111/jipb.12212
|Rice CYP703A3, a cytochrome P450 hydroxylase, is essential for development of anther cuticle and pollen exine
|Development
|-
|1219
|''OsGUN4''
|[[Os11g0267000]]
|10.1007/s00122-014-2393-9
|A down-regulated epi-allele of the genomes uncoupled 4 gene generates a xantha marker trait in rice.
|Color
|-
|1220
|''OsBADH1''
|[[Os04g0464200]]
|OsBADH1 is possibly involved in acetaldehyde oxidation in rice plant peroxisomes
|OsBADH1 is possibly involved in acetaldehyde oxidation in rice plant peroxisomes
|Stress
|-
|243
|''gh2''
|[[Os02g0187800]]
|10.1104/pp.105.073007
|Increased lodging resistance in long-culm, low-lignin gh2 rice for improved feed and bioenergy production
|Stress
|-
|1221
|''OsABCC1''
|[[Os04g0620000]]
|10.1073/pnas.1414968111
|A rice ABC transporter, OsABCC1, reduces arsenic accumulation in the grain
|Stress
|-
|demo
|demo
|[[Os04g0459000]]
|demo
|demo
|demo
|}

Os01g0841500

2017-03-08T05:38:28Z

Xysj1981: /* References */

The rice '''''Os01g0841500''''' was reported as '''''OsMYB3R-2''''' in 2009 <ref name="ref1" /> by researchers from China.

==Annotated Information==
[[File:Os01g08415002.jpg|right|thumb|527px|'''Figure 2.''' ''Phenotype analysis of the T2 generation of OsMYB3R-2 transgenic rice.<ref name="ref1" />.'']]

===Gene Symbol===
*'''''Os01g0841500''''' '''''<=>''''' '''''OsMYB3R-2, OsMYB3R2, MYB3R2'''''

===Function===
* MYB transcription factors play central roles in plant responses to abiotic stresses.
* '''''OsMYB3R-2''''' functions in both stress and developmental processes in rice (Oryza sativa).
* '''''OsMYB3R-2''''' functions in both stress and developmental processes in rice (Oryza sativa).
* '''''OsMYB3R-2''''' specifically bound to a mitosis-specific activator cis-element, (T/C)C(T/C)AACGG(T/C)(T/C)A, a conserved sequence that was found in promoters of cyclin genes such as '''''OsCycB1;1''''' and '''''OsKNOLLE2'''''.

===Phenotypic analysis===
* Over-expression of '''''OsMYB3R-2(Os01g0841500) ''''' may significantly improve cold tolerance by mediating the alteration in cell cycle and ectopic expression of stress genes in rice.
* overexpression of OsMYB3R-2 in rice led to higher transcript levels of several G2/M phase-specific genes, including '''''OsCycB1;1, OsCycB2;1, OsCycB2;2, and OsCDC20.1''''' than those in '''''OsMYB3R-2''''' antisense lines or wild-type plants in response to cold treatment.
* Flow cytometry analysis revealed an increased cell mitotic index in overexpressed transgenic lines of '''''OsMYB3R-2''''' after cold treatment.
* Furthermore, resistance to cold stress in the transgenic plants overexpressing OsCycB1;1 was also enhanced. The level of cellular free proline was increased in the overexpressed rice lines of '''''OsMYB3R-2''''' and '''''OsCycB1;1''''' transgenic plants compared with wild-type plants under the cold treatment.
* These results suggest that '''''OsMYB3R-2''''' targets '''''OsCycB1;1''''' and regulates the progress of the cell cycle during chilling stress.
* '''''OsCPT1''''', which may be involved in the dehydration-responsive element-binding factor 1A pathway, showed the same transcription pattern in response to cold as did OsCycB1;1 in transgenic rice.

===Expression===
* Cold treatment greatly induced the expression of '''''OsMYB3R-2''''', which encodes an active transcription factor.

==Labs working on this gene==
* Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
* Graduate University of Chinese Academy of Sciences, Beijing 100049, China
* College of Life Sciences, Shandong Agricultural University, Tai’an 271018, China
* National Center for Plant Gene Research, Beijing 100093, China

==References==
<references>
* <ref name="ref1">
Ma Q, Dai X, Xu Y, Guo J, Liu Y, Chen N, Xiao J, Zhang D, Xu Z, Zhang X, Chong
K. Enhanced tolerance to chilling stress in OsMYB3R-2 transgenic rice is mediated
by alteration in cell cycle and ectopic expression of stress genes. Plant
Physiol. 2009 May;150(1):244-56. doi: 10.1104/pp.108.133454. PubMed PMID:
19279197; PubMed Central PMCID: PMC2675741.
</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

Os01g0841500

2017-03-08T05:38:20Z

Xysj1981: /* Phenotypic analysis */

Test

2017-03-08T05:37:57Z

Xysj1981:

{|class="wikitable" \style="width:90%;text-align:center
|-
!Number
!Gene name
!RAP ID
!DOI
!Reference TitleLDMAR
!Keywords
|-
|1
|''GA2ox3''
|[[Os01g0757200]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|2
|''GA2ox9''
|[[Os02g0630300]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|3
|''GA2ox6''
|[[Os04g0522500]]
|10.1105/tpc.108.060913
|
*A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice W
|-
|4
|''SG1''
|[[Os09g0459200]]
|10.1104/pp.111.187567
|
*Annotated
|-
|5
|''ALS''
|[[Os02g0510200]]
|10.1007/s00299-010-0915-8
|
*Selecting genetic transformants of indica and indica-derived rice cultivars using bispyribac sodium and a mutated ALS gene
|-
|6
|''EL5''
|[[Os02g0559800]]
|10.1111/j.1365-313X.2007.03120.x
|
*SHORT GRAIN1 Decreases Organ Elongation and Brassinosteroid Response in Rice1[W][OA]
|-
|7
|''OASA2''
|[[Os03g0264400]]
|10.1104/pp.111.175778
|
*Application of Gene Targeting to Designed Mutation Breeding of High-Tryptophan Rice1[W][OA]
|-
|8
|''OsGAD2''
|[[Os04g0447800]]
|10.1093/jxb/erm120
|
*C-terminal extension of rice glutamate decarboxylase(OsGAD2) functions as an autoinhibitory domain and overexpression of a truncated mutant results in the accumulation of extremely high levels of GABA in plant cells
|-
|9
|''OsIAA3''
|[[Os12g0601400]]
|10.1111/j.1365-313X.2006.02693.x
|
*Production and characterization of auxin-insensitive rice by overexpression of a mutagenized rice IAA protein
|-
|10
|''IDEF1''
|[[Os08g0101000]]
|10.1111/j.1365-313X.2011.04772.x
|
*Annotated
|-
|11
|''OsPLDα1''
|[[Os01g0172400]]
|10.1111/j.1744-7909.2010.01021.x
|
*Annotated
|-
|12
|''AFT''
|[[Os01g0185300]]
|10.1007/s00425-009-1077-1
|
*Down-regulation of four putative arabinoxylan feruloyl transferase genes from family PF02458 reduces ester-linked ferulate content in rice cell walls
|-
|13
|''OsGAE1''
|[[Os01g0201600]]
|10.1007/s11103-006-9030-1
|
*The rice OsGAE1 is a novel gibberellin-regulated gene and involved in rice growth
|-
|14
|''OsMADS3''
|[[Os01g0201700]]
|10.1023/A:1006051911291
|
*Annotated
|-
|15
|''OsSAMS3''
|[[Os01g0293000]]
|10.1016/j.jplph.2011.05.020
|
*Knockdown of SAMS genes encoding S-adenosyl-l-methionine synthetases causes methylation alterations of DNAs and histones and leads to late flowering in rice
|-
|16
|''OsSAMS2''
|[[Os01g0323600]]
|10.1016/j.jplph.2011.05.020
|
*Knockdown of SAMS genes encoding S-adenosyl-l-methionine synthetases causes methylation alterations of DNAs and histones and leads to late flowering in rice
|-
|17
|''OsACO7''
|[[Os01g0580500]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|18
|''OsrbohA''
|[[Os01g0734466]]
|10.5511/plantbiotechnology.22.127
|
*Function of the rice gp91phox homologs OsrbohA and OsrbohE genes in ROS-dependent plant immune responses
|-
|19
|''Orysa;CycB1;1''
|[[Os01g0805600]]
|10.1007/s00425-009-1051-y
|
*Annotated
|-
|20
|''OsNAC4''
|[[Os01g0816100]]
|10.1038/emboj.2009.39
|
*The transcription factor OsNAC4 is a key positive regulator of plant hypersensitive cell death
|-
|21
|''OsHAP3A''
|[[Os01g0834400]]
|10.1046/j.1365-313X.2003.01897.x
|
*Annotated
|-
|22
|''HDT702''
|[[Os01g0909100]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|23
|''OsDCL1''
|[[Os01g0909200]]
|10.1104/pp.105.063420
|
*Loss of Function of OsDCL1 Affects MicroRNA Accumulation and Causes Developmental Defects in Rice
|-
|24
|''SDG714''
|[[Os01g0927000]]
|10.1105/tpc.106.048124
|
*SDG714, a Histone H3K9 Methyltransferase, Is Involved in Tos17 DNA Methylation and Transposition in Rice
|-
|25
|''rtS''
|[[Os01g0929600]]
|10.1007/s11103-006-9031-0
|
*Annotated
|-
|26
|''Osg1''
|[[Os01g0947700]]
|10.1007/s00425-010-1301-z
|
*A rice �-1,3-glucanase gene Osg1 is required for callose degradation in pollen development
|-
|27
|''NOA1''
|[[Os02g0104700]]
|10.1371/journal.pone.0020015
|
*Annotated
|-
|28
|''OsNOA1?RIF1''
|[[Os02g0104700]]
|10.1111/j.1469-8137.2010.03264.x
|
*Annotated
|-
|29
|''Os4CL3''
|[[Os02g0177600]]
|10.1104/pp.111.178301
|
*Functional Characterization of Evolutionarily Divergent 4-Coumarate:Coenzyme A Ligases in Rice
|-
|30
|''HDA703''
|[[Os02g0214900]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|31
|''HDA710''
|[[Os02g0215200]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|32
|''RPBF''
|[[Os02g0252400]]
|10.1111/j.1365-313X.2009.03925.x
|
*Compensation and interaction between RISBZ1 and RPBF during grain filling in rice
|-
|33
|''DCW11''
|[[Os02g0255100]]
|10.1093/pcp/pcn036
|
*DCW11, Down-Regulated Gene 11 in CW-Type Cytoplasmic Male Sterile Rice,Encoding Mitochondrial Protein Phosphatase 2C is Related to Cytoplasmic Male Sterility
|-
|34
|''OsHARP''
|[[Os02g0256200]]
|10.1007/s00726-008-0043-8
|
*Characterization of a histidine- and alanine-rich protein showing interaction with calreticulin in rice
|-
|35
|''OsGMST1''
|[[Os02g0274900]]
|10.1093/jxb/err178
|
*Annotated
|-
|36
|''OsTudor-SN''
|[[Os02g0523500]]
|10.1111/j.1365-313X.2008.03516.x
|
*The cytoplasmic-localized, cytoskeletal-associated RNA binding protein OsTudor-SN: evidence for an essential role in storage protein RNA transport and localization
|-
|37
|''RAR1''
|[[Os02g0535400]]
|10.1105/tpc.107.055517
|
*Annotated
|-
|38
|''GF14e''
|[[Os02g0580300]]
|10.1111/j.1365-313X.2011.04728.x
|
*Annotated
|-
|39
|''OsNAR2.1''
|[[Os02g0595900]]
|10.1111/j.1365-3040.2011.02335.x
|
*Rice OsNAR2.1 interacts with OsNRT2.1, OsNRT2.2 and OsNRT2.3a nitrate transporters to provide uptake over high and low concentration ranges
|-
|40
|''OsCKI1''
|[[Os02g0622100]]
|10.1046/j.1365-313X.2003.01866.x
|
*Annotated
|-
|41
|''Oscry2''
|[[Os02g0625000]]
|10.1093/pcp/pcj064
|
*Involvement of Rice Cryptochromes in De-etiolation Responses and Flowering
|-
|42
|''OsYSL15''
|[[Os02g0650300]]
|10.1074/jbc.M806042200
|
*Annotated
|-
|43
|''SGL1''
|[[Os02g0762600]]
|10.1104/pp.111.187567
|
*SHORT GRAIN1 Decreases Organ Elongation and Brassinosteroid Response in Rice
|-
|44
|''CEBiP''
|[[Os03g0133400]]
|10.1111/j.1365-313X.2010.04328.x
|
*Perception of the chitin oligosaccharides contributes to disease resistance to blast fungus Magnaporthe oryzae in rice
|-
|45
|''OsPAO''
|[[Os03g0146400]]
|10.1016/j.jplph.2011.05.026
|
*Knockdown of OsPAO and OsRCCR1 cause different plant death phenotypes in rice
|-
|46
|''OsPT2''
|[[Os03g0150800]]
|10.1111/j.1365-313X.2008.03726.x
|
*Two rice phosphate transporters, OsPht1;2 and OsPht1;6, have different functions and kinetic properties in uptake and translocation
|-
|47
|''OsSUT1''
|[[Os03g0170900]]
|10.1093/pcp/pce148
|
*Annotated
|-
|48
|''OsBP-73''
|[[Os03g0183100]]
|10.1023/A:1024854101965
|
*OsBP-73, a rice gene, encodes a novel DNA-binding protein with a SAP-like domain and its genetic interference by double-stranded RNA inhibits rice growth
|-
|49
|''OsMDP1''
|[[Os03g0186600]]
|10.1111/j.1365-313X.2006.02804.x
|
*A brassinolide-suppressed rice MADS-box transcription factor, OsMDP1, has a negative regulatory role in BR signaling
|-
|50
|''RINO1''
|[[Os03g0192700]]
|10.1093/pcp/pcp071
|
*Differential Effects of a Transgene to Confer Low Phytic Acid in Caryopses Located at Different Positions in Rice Panicles
|-
|51
|''OsMADS1''
|[[Os03g0215400]]
|10.1111/j.1365-313X.2009.04101.x
|
*Annotated
|-
|53
|''OsApx1''
|[[Os03g0285700]]
|10.1016/j.phytochem.2010.01.003
|
*Annotated
|-
|54
|''APx1''
|[[Os03g0285700]]
|10.1111/j.1365-3040.2011.02366.x
|
*Annotated
|-
|55
|''OsFAD7''
|[[Os03g0290300]]
|10.1093/pcp/pcm107
|
*Disease Resistance against Magnaporthe grisea is Enhanced in Transgenic Rice with Suppression of u-3 Fatty Acid Desaturases
|-
|57
|''RGB1''
|[[Os03g0669100]]
|10.1111/j.1365-313X.2011.04643.x
|
*Suppression of the rice heterotrimeric G protein b-subunit gene, RGB1, causes dwarfism and browning of internodes and lamina joint regions
|-
|58
|''OsPIPK1''
|[[Os03g0701800]]
|10.1023/B:PLAN.0000028796.14336.24
|
*OsPIPK1, a rice phosphatidylinositol monophosphate kinase, regulates rice heading by modifying the expression of floral induction genes
|-
|59
|''ero1''
|[[Os03g0733800]]
|10.1073/pnas.0904429106
|
*ER membrane-localized oxidoreductase Ero1 is required for disulfide bond formation in the rice endosperm
|-
|60
|''OsSPO11-1''
|[[Os03g0752200]]
|10.1007/s00412-010-0284-7
|
*OsSPO11-1 is essential for both homologous chromosome pairing and crossover formation in rice
|-
|61
|''CysR10''
|[[Os03g0766000]]
|10.1093/pcp/pcr053
|
*A Role for the Cysteine-Rich 10 kDa Prolamin in Protein Body I Formation in Rice
|-
|62
|''OsGLO1''
|[[Os03g0786100]]
|10.1093/jxb/erp056
|
*Inducible antisense suppression of glycolate oxidase reveals its strong regulation over photosynthesis in rice
|-
|63
|''OsMet1''
|[[Os03g0798300]]
|10.1111/j.1365-313X.2008.03624.x
|
*Annotation
|-
|64
|''CYP99A3''
|[[Os04g0178400]]
|10.1111/j.1365-313X.2010.04408.x
|
*Annotation
|-
|65
|''CYP99A2''
|[[Os04g0180400]]
|10.1111/j.1365-313X.2010.04408.x
|
*CYP99A3: functional identification of a diterpene oxidase from the momilactone biosynthetic gene cluster in rice
|-
|66
|''Ostil1''
|[[Os04g0460600]]
|10.1111/j.1469-8137.2007.02177.x
|
*Overexpression of a NAC-domain protein promotes shoot Blackwell Publishing Ltd branching in rice
|-
|67
|''OsPBP1''
|[[Os04g0531100]]
|10.1093/mp/ssn035
|
*A Novel C2-Domain Phospholipid-Binding Protein, OsPBP1, Is Required for Pollen Fertility in Rice
|-
|68
|''YAB3''
|[[Os04g0536300]]
|10.1104/pp.107.095737
|
*Annotation
|-
|69
|''OsACS2''
|[[Os04g0578000]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|70
|''rca''
|[[Os04g0658300]]
|10.1093/aob/mcl025
|
*Annotation
|-
|71
|''OsRMC''
|[[Os04g0659300]]
|10.1111/j.1365-3040.2007.01663.x
|
*Annotation
|-
|72
|''OsMT2b''
|[[Os05g0111300]]
|10.1104/pp.107.110304
|
*Annotation
|-
|73
|''XB3''
|[[Os05g0112000]]
|10.1105/tpc.106.046730
|
*Annotation
|-
|74
|''STAR2''
|[[Os05g0119000]]
|10.1105/tpc.108.064543
|
*Annotation
|-
|75
|''OsSAMS1''
|[[Os05g0135700]]
|10.1016/j.jplph.2011.05.020
|
*Annotation
|-
|76
|''OsACO5''
|[[Os05g0149400]]
|10.1104/pp.110.162412
|
*Cyanide, a Coproduct of Plant Hormone Ethylene Biosynthesis, Contributes to the Resistance of Rice to Blast Fungus
|-
|77
|''OsBLE3''
|[[Os05g0245300]]
|10.1016/j.phytochem.2006.05.026
|
*OsBLE3, a brassinolide-enhanced gene, is involved in the growth of rice
|-
|78
|''OsMADS4''
|[[Os05g0423400]]
|10.1023/A:1006051911291
|
*Identification of class B and class C floral organ identity genes from rice plants
|-
|79
|''IDEF2''
|[[Os05g0426200]]
|10.1074/jbc.M708732200
|
*A Novel NAC Transcription Factor, IDEF2, That Recognizes the Iron Deficiency-responsive Element 2 Regulates the Genes Involved in Iron Homeostasis in Plants
|-
|81
|''OsHAP3C''
|[[Os05g0573500]]
|10.1046/j.1365-313X.2003.01897.x
|
*Annotated
|-
|82
|''OsRAD21-4''
|[[Os05g0580500]]
|10.1007/s11103-005-4922-z
|
*Annotated
|-
|83
|''OsMAPK6''
|[[Os06g0154500]]
|10.1104/pp.104.057414
|
*A Sphingolipid Elicitor-Inducible Mitogen-Activated Protein Kinase Is Regulated by the Small GTPase OsRac1 and Heterotrimeric G-Protein in Rice
|-
|84
|''RFT1''
|[[Os06g0157500]]
|10.1242/dev.040170
|
*Annotated
|-
|85
|''OsMADS5''
|[[Os06g0162800]]
|10.1111/j.1365-313X.2009.04101.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|86
|''SSIIa''
|[[Os06g0229800]]
|10.1139/g11-010
|
*Annotated
|-
|87
|''OsGSR1''
|[[Os06g0266800]]
|10.1111/j.1365-313X.2008.03707.x
|
*OsGSR1 is involved in crosstalk between gibberellins and brassinosteroids in rice
|-
|89
|''HDA702''
|[[Os06g0583400]]
|10.1016/j.bbrc.2009.07.162
|
*Annotation
|-
|90
|''OsPNH1''
|[[Os06g0597400]]
|10.1046/j.1365-313X.2002.01279.x
|
*OsPNH1 regulates leaf development and maintenance of the shoot apical meristem in rice
|-
|91
|''OsPLDα4''
|[[Os06g0604200]]
|10.1104/pp.111.183749
|
*The Chloroplast-Localized Phospholipases D a4 and a5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice
|-
|92
|''OsPLDα5''
|[[Os06g0604300]]
|10.1104/pp.111.183749
|
*The Chloroplast-Localized Phospholipases D a4 and a5 Regulate Herbivore-Induced Direct and Indirect Defenses in Rice
|-
|93
|''OsLIC''
|[[Os06g0704300]]
|10.1371/journal.pone.0003521
|
*OsLIC, a Novel CCCH-Type Zinc Finger Protein with Transcription Activation, Mediates Rice Architecture via Brassinosteroids Signaling
|-
|94
|''OsEIN2''
|[[Os07g0155600]]
|10.1104/pp.109.152702
|
*Annotated
|-
|95
|''HDA704''
|[[Os07g0164100]]
|10.1016/j.bbrc.2009.07.162
|
*Rice histone deacetylase genes display specific expression patterns and developmental functions
|-
|96
|''RISBZ1''
|[[Os07g0182000]]
|10.1111/j.1365-313X.2009.03925.x
|
*Annotated
|-
|97
|''NDP kinase''
|[[Os07g0492000]]
|10.1104/pp.122.2.447
|
*Annotated
|-
|98
|''OsDR8''
|[[Os07g0529600]]
|10.1007/s11103-005-4770-x
|
*Annotated
|-
|99
|''OsFOR1''
|[[Os07g0568700]]
|10.1023/B:PLAN.0000006940.89955.f1
|
*Annotated
|-
|100
|''OsBZR1''
|[[Os07g0580500]]
|10.1073/pnas.0706386104
|
*Functions of OsBZR1 and 14-3-3 proteins in brassinosteroid signaling in rice
|-
|101
|''Osppc4''
|[[Os01g0208700]]
|10.1073/pnas.0913127107
|
*Phosphoenolpyruvate carboxylase intrinsically located in the chloroplast of rice plays a crucial role in ammonium assimilation
|-
|102
|''OsPDK1''
|[[Os07g0637300]]
|10.1093/pcp/pci241
|
*Gibberellin Regulates Mitochondrial Pyruvate Dehydrogenase Activity in Rice
|-
|103
|''OsBLE2''
|[[Os07g0650600]]
|10.1023/A:1025001304994
|
*A novel brassinolide-enhanced gene identified by cDNA microarray is involved in the growth of rice
|-
|104
|''aldolase''
|[[Os07g0650600]]
|10.1007/s11103-004-5920-2
|
*Characterization of fructose-bisphosphate aldolase regulated by gibberellin in roots of rice seedling
|-
|105
|''rtGA2.1''
|[[Os07g0687700]]
|10.1111/j.1365-313X.2005.02457.x
|
*Alteration of TGA factor activity in rice results in enhanced tolerance to Xanthomonas oryzae pv. oryzae
|-
|106
|''OsFAD8''
|[[Os07g0693800]]
|10.1093/pcp/pcm107
|
*Annotated
|-
|107
|''OsApx2''
|[[Os07g0694700]]
|10.1016/j.phytochem.2010.01.003
|
*Annotated
|-
|108
|''APx2''
|[[Os07g0694700]]
|10.1111/j.1365-3040.2011.02366.x
|
*Annotated
|-
|109
|''OsDEG10''
|[[Os08g0139000]]
|10.1016/j.bbrc.2009.01.131
|
*Annotated
|-
|110
|''OsDR10''
|[[Os08g0155900]]
|10.1371/journal.pone.0004603
|
*A Rice Gene of De Novo Origin Negatively Regulates Pathogen-Induced Defense Response
|-
|111
|''OsBAK1''
|[[Os08g0174700]]
|10.1111/j.1467-7652.2009.00444.x
|
*Annotated
|-
|112
|''OsGLP8''
|[[Os08g0189200]]
|10.1104/pp.108.128348
|
*A Germin-Like Protein Gene Family Functions as a Complex Quantitative Trait Locus Conferring Broad-Spectrum Disease Resistance in Rice
|-
|113
|''SSIIIa''
|[[Os08g0191433]]
|10.1139/g11-010
|
*Double repression of soluble starch synthase genes SSIIa and SSIIIa in rice (Oryza sativa L.) uncovers interactive effects on the physicochemical properties of starch
|-
|114
|''OsRAD21-3''
|[[Os08g0266700]]
|10.1111/j.1365-313X.2007.03190.x
|
*OsRAD21-3, an orthologue of yeast RAD21, is required for pollen development in Oryza sativa
|-
|115
|''OsCCC1''
|[[Os08g0323700]]
|10.1007/s11103-011-9744-6
|
*Annotated
|-
|116
|''OsrbohE''
|[[Os08g0453733]]
|10.5511/plantbiotechnology.22.127
|
*Function of the rice gp91phox homologs OsrbohA and OsrbohE genes in ROS-dependent plant immune responses
|-
|117
|''OsHI-LOX''
|[[Os08g0508800]]
|10.1111/j.1365-313X.2009.03988.x
|
*Silencing OsHI-LOX makes rice more susceptible to chewing herbivores, but enhances resistance to a phloem feeder
|-
|118
|''OsAPx-R''
|[[Os08g0522400]]
|10.1111/j.1469-8137.2011.03659.x
|
*Ascorbate peroxidase-related (APx-R) is a new hemecontaining protein functionally associated with ascorbate peroxidase but evolutionarily divergent
|-
|119
|''OsMADS7''
|[[Os08g0531700]]
|10.1111/j.1365-313X.2009.04101.x
|
*Annotated
|-
|120
|''Os8N3''
|[[Os08g0535200]]
|10.1073/pnas.0604088103
|
*Annotated
|-
|121
|''OsCERK1''
|[[Os08g0538300]]
|10.1111/j.1365-313X.2010.04324.x
|
*Two LysM receptor molecules, CEBiP and OsCERK1,cooperatively regulate chitin elicitor signaling in rice
|-
|122
|''OsSPY''
|[[Os08g0559300]]
|10.1111/j.1365-313X.2006.02875.x
|
*Annotated
|-
|123
|''OsPT6''
|[[Os08g0564000]]
|10.1111/j.1365-313X.2008.03726.x
|
*Two rice phosphate transporters, OsPht1;2 and OsPht1;6, have different functions and kinetic properties in uptake and translocation
|-
|124
|''OsMADS8''
|[[Os09g0507200]]
|10.1111/j.1365-313X.2009.04101.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|125
|''OsSGT1''
|[[Os09g0518200]]
|10.1111/j.1365-313X.2008.03697.x
|
*Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa)
|-
|126
|''OsGEN-L''
|[[Os09g0521900]]
|10.1093/pcp/pci090
|
*RNAi-mediated Silencing of OsGEN-L (OsGEN-like), a New Member of the RAD2/XPG Nuclease Family, Causes Male Sterility by Defect of Microspore Development in Rice
|-
|128
|''Ugp1''
|[[Os09g0553200]]
|10.1105/tpc.106.044123
|
*Rice UDP-Glucose Pyrophosphorylase1 Is Essential for Pollen Callose Deposition and Its Cosuppression Results in a New Type of Thermosensitive Genic Male Sterility
|-
|129
|''OsRCCR1''
|[[Os10g0389200]]
|10.1016/j.jplph.2011.05.026
|
*Knockdown of OsPAO and OsRCCR1 cause different plant death phenotypes in rice
|-
|130
|''EBL1''
|[[Os10g0390800]]
|10.1007/s10529-010-0405-7
|
*Phytochrome-regulated EBL1 contributes to ACO1 upregulation in rice
|-
|131
|''OsDCL3b''
|[[Os10g0485600]]
|10.1111/j.1365-313X.2011.04805.x
|
*Roles of DCL4 and DCL3b in rice phased small RNA biogenesis
|-
|132
|''OsPLDbeta1''
|[[Os10g0524400]]
|10.1104/pp.108.131979
|
*Suppression of a Phospholipase D Gene, OsPLDb1,Activates Defense Responses and Increases Disease Resistance in Rice
|-
|134
|''SPK''
|[[Os10g0539600]]
|10.1093/pcp/pch122
|
*A Rice Antisense SPK Transformant that Lacks the Accumulation of Seed Storage Substances Shows no Correlation Between Sucrose Concentration in Phloem Sap and Demand for Carbon Sources in the Sink Organs
|-
|135
|''OsMPK5''
|[[Os11g0684000]]
|10.1104/pp.109.152702
|
*Abscisic Acid-Induced Resistance against the Brown Spot Pathogen Cochliobolus miyabeanus in Rice Involves MAP Kinase-Mediated Repression of Ethylene Signaling
|-
|136
|''OsDMC1''
|[[Os12g0143800]]
|10.1007/s11103-007-9195-2
|
*OsDMC1 is required for homologous pairing in Oryza sativa
|-
|137
|''Ostrxm''
|[[Os12g0188700]]
|10.1104/pp.108.123547
|
*Abnormal Chloroplast Development and Growth Inhibition in Rice Thioredoxin m Knock-Down Plants
|-
|139
|''OsRBCS2''
|[[Os12g0274700]]
|10.1111/j.1365-3040.2011.02434.x
|
*Effect of individual suppression of RBCS multigene family on Rubisco contents in rice leavespce_2434 546..553
|-
|143
|''OsTDL1A''
|[[Os12g0472500]]
|10.1111/j.1365-313X.2008.03426.x
|
*Annotated
|-
|144
|''OsSpo11-4''
|[[Os12g0622500]]
|10.1371/journal.pone.0020327
|
*Annotated
|-
|145
|''OsDOS''
|[[Os01g0192000]]
|10.1104/pp.106.082941
|
*Annotated
|-
|146
|''OsNPR1''
|[[Os01g0194300]]
|10.1007/s11103-010-9695-3
|
*Annotated
|-
|147
|''OsRac1''
|[[Os01g0229400]]
|10.1073/pnas.98.2.759
|
*Essential role of the small GTPase Rac in disease resistance of rice
|-
|148
|''Rdd1''
|[[Os01g0264000]]
|10.1111/j.1365-3040.2009.01954.x
|
*Circadian clock- and phytochrome-regulated Dof-like gene,Rdd1, is associated with grain size in rice
|-
|149
|''OsLOL2''
|[[Os01g0612700]]
|10.1007/s00438-007-0232-2
|
*The rice OsLOL2 gene encodes a zinc Wnger protein involved in rice growth and disease resistance
|-
|150
|''OsYUCCA1''
|[[Os01g0645400]]
|10.1104/pp.106.091561
|
*Auxin Biosynthesis by the YUCCA Genes in Rice
|-
|151
|''PME1''
|[[Os01g0788400]]
|10.1111/j.1365-313X.2011.04486.x
|
*Methanol is an endogenous elicitor molecule for the synthesis of tryptophan and tryptophan-derived secondary metabolites upon senescence of detached rice leaves
|-
|152
|''OsABI5''
|[[Os01g0859300]]
|10.1007/s11103-008-9298-4
|
*Annotated
|-
|153
|''OsNAC6''
|[[Os01g0884300]]
|10.1111/j.1365-313X.2009.03908.x
|
*Annotated
|-
|154
|''OsIRO2''
|[[Os01g0952800]]
|10.1111/j.1365-313X.2007.03149.x
|
*Annotated
|-
|155
|''BiP1''
|[[Os02g0115900]]
|10.1111/j.1365-313X.2010.04453.x
|
*Annotated
|-
|156
|''OsYSL2''
|[[Os02g0649900]]
|10.1111/j.1365-313X.2010.04158.x
|
*Annotated
|-
|157
|''ARAG1''
|[[Os02g0657000]]
|10.1093/aob/mcp303
|
*Annotated
|-
|158
|''OsPIP1;1''
|[[Os02g0666200]]
|10.1038/cr.2007.34
|
*Annotated
|-
|159
|''OsDHODH1''
|[[Os02g0736400]]
|10.1111/j.1744-7909.2009.00853.x
|
*Annotated
|-
|160
|''OsPIN1''
|[[Os02g0743400]]
|10.1093/pcp/pci183
|
*Annotated
|-
|161
|''OsMADS22''
|[[Os02g0761000]]
|10.1111/j.1365-313X.2008.03406.x
|
*Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses
|-
|162
|''AmyI-1''
|[[Os02g0765600]]
|10.1093/pcp/pci091
|
*Annotated
|-
|163
|''OsPIP1;3''
|[[Os02g0823100]]
|10.1038/cr.2007.34
|
*Annotated
|-
|164
|''OsACDR1''
|[[Os03g0160100]]
|10.1007/s10059-009-0161-5
|
*Annotated
|-
|165
|''OsBRR1''
|[[Os03g0228800]]
|10.1007/s00425-009-0951-1
|
*A putative leucine-rich repeat receptor kinase, OsBRR1, is involved in rice blast resistance
|-
|166
|''OsMAPK5''
|[[Os03g0285800]]
|10.1105/tpc.008714
|
*Annotation
|-
|167
|''OsWRKY31''
|[[Os03g0321700]]
|10.1038/cr.2007.104
|
*Constitutive expression of pathogen-inducible OsWRKY31 enhances disease resistance and affects root growth and auxin response in transgenic rice plants
|-
|168
|''OsDIS1''
|[[Os03g0356414]]
|10.1104/pp.111.180893
|
*The SINA E3 Ligase OsDIS1 Negatively Regulates Drought Response in Rice
|-
|169
|''OsLOX1''
|[[Os03g0700700]]
|10.1007/s11103-007-9278-0
|
*A novel lipoxygenase gene from developing rice seeds confers dual position specificity and responds to wounding and insect attack
|-
|170
|''OsSrt1''
|[[Os04g0271000]]
|10.1104/pp.107.099473
|
*Down-Regulation of a SILENT INFORMATION REGULATOR2-Related Histone Deacetylase Gene, OsSRT1, Induces DNA Fragmentation and Cell Death in Rice
|-
|171
|''RERJ1''
|[[Os04g0301500]]
|10.1016/j.bbrc.2004.10.126
|
*Annotated
|-
|172
|''OsGA2ox6''
|[[Os04g0522500]]
|10.1016/S1673-8527(09)60022-9
|
*Annotated
|-
|173
|''RFL''
|[[Os04g0598300]]
|10.1073/pnas.0709059105
|
*Annotated
|-
|174
|''OsrcaA2''
|[[Os04g0658300]]
|10.1006/bbrc.2001.6269
|
*Annotated
|-
|175
|''OsMTP1''
|[[Os05g0128400]]
|10.1007/s00299-011-1140-9
|
*Annotated
|-
|176
|''OsWRKY45''
|[[Os05g0322900]]
|10.1093/jxb/err144
|
*Annotated
|-
|177
|''OsEXP4''
|[[Os05g0477600]]
|10.1105/tpc.011965
|
*Regulation of Expansin Gene Expression Affects Growth and Development in Transgenic Rice Plants
|-
|178
|''SDG728''
|[[Os05g0490700]]
|10.1093/mp/ssq030
|
*Rice SUVH Histone Methyltransferase Genes Display Specific Functions in Chromatin Modification and Retrotransposon Repression
|-
|179
|''OsRan2''
|[[Os05g0574500]]
|10.1093/jxb/erp341
|
*Annotation
|-
|180
|''OsMADS55''
|[[Os06g0217300]]
|10.1111/j.1365-313X.2008.03406.x
|
*Rice SVP-group MADS-box proteins, OsMADS22 and OsMADS55, are negative regulators of brassinosteroid responses
|-
|181
|''OsCIPK23''
|[[Os07g0150700]]
|10.1016/S1673-8527(08)60073-9
|
*Annotated
|-
|182
|''OsTRXh1''
|[[Os07g0186000]]
|10.1104/pp.111.182808
|
*Annotated
|-
|183
|''TDC''
|[[Os08g0140300]]
|10.1104/pp.109.138552
|
*Annotated
|-
|184
|''OsLSD1''
|[[Os08g0159500]]
|10.1094/MPMI-18-0375
|
*Overexpression of OsRAN2 in rice and Arabidopsis renders transgenic plants hypersensitive to salinity and osmotic stress
|-
|185
|''OsDERF1''
|[[Os08g0454000]]
|10.1371/journal.pone.0025216
|
*Annotated
|-
|186
|''OsGLP1''
|[[Os08g0460000]]
|10.1016/j.bbrc.2010.02.142
|
*Functional role of rice germin-like protein1 in regulation of plant height and disease resistance
|-
|187
|''OsPRP3''
|[[Os10g0148100]]
|10.1007/s11103-009-9557-z
|
*OsPRP3, a flower specific proline-rich protein of rice, determines extracellular matrix structure of floral organs and its overexpression confers cold-tolerance
|-
|188
|''OsPT8''
|[[Os10g0444700]]
|10.1104/pp.111.175240
|
*The Phosphate Transporter Gene OsPht1;8 Is Involved in Phosphate Homeostasis in Rice
|-
|189
|''OsWRKY89''
|[[Os11g0117400]]
|10.1007/s11103-007-9244-x
|
*Annotated
|-
|190
|''OsNAC5''
|[[Os11g0184900]]
|10.1007/s00425-011-1403-2
|
*Annotated
|-
|191
|''OsPCBP''
|[[Os11g0689300]]
|10.1007/s12374-011-9184-5
|
*A Calmodulin-Binding Protein from Rice is Essential to Pollen Development
|-
|192
|''OsrcaA1''
|[[Os11g0707000]]
|10.1006/bbrc.2001.6269
|
*Involvement of a Ca21-Dependent Protein Kinase Component Downstream to the Gibberellin-Binding Phosphoprotein, RuBisCO Activase, in Rice
|-
|193
|''sui1''
|[[Os01g0118300]]
|10.1007/s11103-011-9825-6
|
*Identification and characterization of SHORTENED UPPERMOST INTERNODE 1, a gene negatively regulating uppermost internode elongation in rice
|-
|194
|''Osjag''
|[[Os01g0129200]]
|10.1007/s11103-010-9703-7
|
*Molecular cloning and functional characterization of OsJAG gene based on a complete-deletion mutant in rice (Oryza sativa L.)
|-
|195
|''sl1''
|[[Os01g0129200]]
|10.1111/j.1365-313X.2009.03913.x
|
*STAMENLESS 1, encoding a single C2H2 zinc finger protein, regulates floral organ identity in rice
|-
|197
|''OsABCG31''
|[[Os01g0177900]]
|10.1073/pnas.1108444108
|
*Annotated
|-
|198
|''OsGI''
|[[Os01g0182600]]
|10.1105/tpc.111.083238
|
*Annotated
|-
|199
|''d2''
|[[Os01g0197100]]
|10.1105/tpc.014712
|
*Annotated
|-
|200
|''mads3''
|[[Os01g0201700]]
|10.1105/tpc.110.074369
|
*Annotated
|-
|201
|''OsGSK1''
|[[Os01g0205700]]
|10.1007/s11103-007-9213-4
|
*Annotated
|-
|202
|''nyc1''
|[[Os01g0227100]]
|10.1105/tpc.106.042911
|
*Annotated
|-
|203
|''OSH6''
|[[Os01g0302500]]
|10.1007/s00425-007-0576-1
|
*A Ds-insertion mutant of OSH6 (Oryza sativa Homeobox 6) exhibits outgrowth of vestigial leaf-like structures, bracts,in rice
|-
|204
|''phd1''
|[[Os01g0367100]]
|10.1371/journal.pgen.1002196
|
*Annotated
|-
|205
|''dbs1''
|[[Os01g0513900]]
|10.1093/pcp/pci206
|
*The Rice Mutant dwarf bamboo shoot 1: A Leaky Mutant of the NACK-type Kinesin-like Gene Can Initiate Organ Primordia but not Organ Development
|-
|206
|''shl2''
|[[Os01g0527600]]
|10.1073/pnas.0704339104
|
|Finishend
*Annotated
|-
|207
|''osubp6''
|[[Os01g0550100]]
|10.1007/s10059-009-0138-4
|
*Structure and Expression of OsUBP6, an Ubiquitin-Specific Protease 6 Homolog in Rice (Oryza sativa L.)
|-
|208
|''log''
|[[Os01g0588900]]
|10.1038/nature05504
|
*Direct control of shoot meristem activity by a cytokinin-activating enzyme
|-
|209
|''osagpl2''
|[[Os01g0633100]]
|10.1007/s11103-007-9153-z
|
*Annotated
|-
|210
|''snl6''
|[[Os01g0639200]]
|10.1371/journal.pgen.1001123
|
*Annotated
|-
|211
|''Ostpc1''
|[[Os01g0678500]]
|10.1093/pcp/pch082
|
*Annotated
|-
|212
|''nadh-gogat1''
|[[Os01g0682001]]
|10.1007/s00726-010-0531-5
|
*Reverse genetics approach to characterize a function of NADH-glutamate synthase1 in rice plants
|-
|213
|''dgl1''
|[[Os01g0683100]]
|10.1104/pp.105.062968
|
*Analysis of the Rice Mutant dwarf and gladius leaf 1. Aberrant Katanin-Mediated Microtubule Organization Causes Up-Regulation of Gibberellin Biosynthetic Genes Independently of Gibberellin Signaling
|-
|214
|''spl28*''
|[[Os01g0703600]]
|10.1111/j.1469-8137.2009.03047.x
|
*Annotated
|-
|215
|''OsLFL''
|[[Os01g0713600]]
|10.1016/j.jplph.2007.07.010
|
*Overexpression of transcription factor OsLFL1 delays flowering time in Oryza sativa
|-
|216
|''d61''
|[[Os01g0718300]]
|10.1105/tpc.12.9.1591
|
*Annotated
|-
|217
|''d10''
|[[Os01g0746400]]
|10.1111/j.1365-313X.2007.03210.x
|
*Annotated
|-
|218
|''Bc7(t)''
|[[Os01g0750300]]
|10.1016/S1673-8527(07)60115-5
|
*Biochemical and molecular characterization of a rice glutelin allele for the GluA-1 gene
|-
|221
|''gamyb''
|[[Os01g0812000]]
|10.1105/tpc.017327
|
*Annotated
|-
|222
|''lax''
|[[Os01g0831000]]
|10.1073/pnas.1932414100
|
*Annotated
|-
|223
|''oscfbp1''
|[[Os01g0866400]]
|10.1111/j.1365-3040.2008.01890.x
|
*Annotated
|-
|224
|''Osabf1''
|[[Os01g0867300]]
|10.1007/s11103-009-9592-9
|
*Annotated
|-
|225
|''Os-pollux''
|[[Os01g0870100]]
|10.1104/pp.108.131540
|
*Antiquity and Function of CASTOR and POLLUX, the Twin Ion Channel-Encoding Genes Key to the Evolution of Root Symbioses in Plants
|-
|226
|''OsPdk1''
|[[Os01g0872800]]
|10.1093/pcp/pcq167
|
*Pdk1 Kinase Regulates Basal Disease Resistance Through the OsOxi1–OsPti1a Phosphorylation Cascade in Rice
|-
|227
|''Osspr1''
|[[Os01g0898300]]
|10.1111/j.1469-8137.2010.03513.x
|
*Annotated
|-
|228
|''eg1''
|[[Os01g0900400]]
|10.1111/j.1365-313X.2008.03710.x
|
*A putative lipase gene EXTRA GLUME1 regulates both empty-glume fate and spikelet development in rice
|-
|229
|''pla2''
|[[Os01g0907900]]
|10.1105/tpc.105.037622
|
*Annotated
|-
|230
|''lhd2''
|[[Os01g0907900]]
|10.1038/sj.cr.7310034
|
*Annotated
|-
|231
|''C3H12''
|[[Os01g0917400]]
|10.1104/pp.111.191379
|
*A CCCH-Type Zinc Finger Nucleic Acid-Binding Protein Quantitatively Confers Resistance against Rice Bacterial Blight Disease
|-
|232
|''msp1''
|[[Os01g0917500]]
|10.1105/tpc.012401
|
*The MSP1 Gene Is Necessary to Restrict the Number of Cells Entering into Male and Female Sporogenesis and to Initiate Anther Wall Formation in Rice
|-
|233
|''OsFRDL4''
|[[Os01g0919100]]
|10.1111/j.1365-313X.2011.04757.x
|
*An Al-inducible MATE gene is involved in external detoxification of Al in rice
|-
|234
|''OsSSI2''
|[[Os01g0919900]]
|10.1094/MPMI-22-7-0820
|
*Annotation
|-
|235
|''OsMADS51''
|[[Os01g0922800]]
|10.1104/pp.107.103291
|
*Annotated
|-
|236
|''se13''
|[[Os01g0949400]]
|10.1007/s00122-010-1426-2
|
*Complete loss of photoperiodic response in the rice mutant line X61 is caused by deWciency of phytochrome chromophore biosynthesis gene
|-
|237
|''LCD''
|[[Os01g0956700]]
|10.1093/jxb/err300
|
*Low cadmium (LCD), a novel gene related to cadmium tolerance and accumulation in rice
|-
|238
|''cde1(t)''
|[[Os02g0121000]]
|10.1007/s00425-007-0525-z
|
*Identification and fine mapping of a thermo-sensitive chlorophyll deficient mutant in rice (Oryza sativa L.)
|-
|239
|''nrat1''
|[[Os02g0131800]]
|10.1073/pnas.1004949107
|
*Annotated
|-
|240
|''lc2''
|[[Os02g0152500]]
|10.1038/cr.2010.109
|
*Annotated
|-
|241
|''Oscand1''
|[[Os02g0167700]]
|10.1093/mp/ssq068
|
*OsCAND1 Is Required for Crown Root Emergence in Rice
|-
|242
|''osgl1-2''
|[[Os02g0178800]]
|10.1007/s11103-009-9483-0
|
*Annotated
|-
|244
|''b-OsLCY''
|[[Os02g0190600]]
|10.1111/j.1365-313X.2008.03411.x
|
*Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|245
|''Docs1''
|[[Os02g0236100]]
|10.1111/j.1365-313X.2011.04824.x
|
*A leucine-rich repeat receptor-like kinase gene is involved in the specification of outer cell layers in rice roots
|-
|246
|''ep3''
|[[Os02g0260200]]
|10.1007/s00122-009-1151-x
|
*Annotated
|-
|247
|''lp''
|[[Os02g0260200]]
|10.1111/j.1467-7652.2011.00610.x
|
*Annotated
|-
|248
|''oscps1''
|[[Os02g0278700]]
|10.1104/pp.103.033696
|
*An Overview of Gibberellin Metabolism Enzyme Genes and Their Related Mutants in Rice
|-
|249
|''naat1''
|[[Os02g0306401]]
|10.1104/pp.107.107912
|
*Mutation in Nicotianamine Aminotransferase Stimulated the Fe(II) Acquisition System and Led to Iron Accumulation in Rice
|-
|250
|''api5''
|[[Os02g0313400]]
|10.1105/tpc.110.082636
|
*Annotated
|-
|251
|''cfl1''
|[[Os02g0516400]]
|10.1105/tpc.111.088625
|
*Annotated
|-
|252
|''osgtgamma-1''
|[[Os02g0542400]]
|10.1007/s00438-009-0507-x
|
*Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses
|-
|253
|''Oscyt-inv1''
|[[Os02g0550600]]
|10.1007/s00425-008-0718-0
|
*OsCYT-INV1 for alkaline/neutral invertase is involved in root cell development and reproductivity in rice (Oryza sativa L.)
|-
|254
|''cpt1''
|[[Os02g0568200]]
|10.1105/tpc.104.028357
|
*The Rice COLEOPTILE PHOTOTROPISM1 Gene Encoding an Ortholog of Arabidopsis NPH3 Is Required for Phototropism of Coleoptiles and Lateral Translocation of Auxin
|-
|255
|''rss1''
|[[Os02g0606700]]
|10.1038/ncomms1279
|
*Annotated
|-
|256
|''OsCOL4''
|[[Os02g0610500]]
|10.1111/j.1365-313X.2010.04226.x
|
*Annotated
|-
|257
|''du3''
|[[Os02g0612300]]
|10.5511/plantbiotechnology.25.483
|
*Du3, a mRNA cap-binding protein gene, regulates amylose content in Japonica rice seeds
|-
|258
|''bc14''
|[[Os02g0614100]]
|10.1073/pnas.1016144108
|
*Golgi nucleotide sugar transporter modulates cell wall biosynthesis and plant growth in rice
|-
|260
|''oul1''
|[[Os02g0674800]]
|10.1104/pp.111.176016
|
*Annotated
|
|-
|261
|''Roc5''
|[[Os02g0674800]]
|10.1104/pp.111.176016
|
*Annotated
|-
|262
|''mfo1''
|[[Os02g0682200]]
|10.1105/tpc.109.068742
|
*Annotated
|-
|263
|''osmads6''
|[[Os02g0682200]]
|10.1111/j.1365-313X.2010.04354.x
|
*Annotated
|-
|265
|''adl1''
|[[Os02g0709400]]
|10.1016/j.ydbio.2009.07.042
|
*Annotated
|-
|266
|''OsGS1;1''
|[[Os02g0735200]]
|10.1111/j.1365-313X.2011.04506.x
|
*Metabolomics data reveal a crucial role of cytosolic glutamine synthetase 1;1 in coordinating metabolic balance in rice
|-
|268
|''bc3''
|[[Os02g0738900]]
|10.1007/s00425-010-1145-6
|
*Annotated
|-
|269
|''dsm1''
|[[Os02g0743500]]
|10.1104/pp.109.149856
|
*Annotated
|-
|270
|''lsi1''
|[[Os02g0745100]]
|10.1038/nature04590
|
*A silicon transporter in rice
|-
|271
|''OsbZIP23''
|[[Os02g0766700]]
|10.1104/pp.108.128199
|
*Annotated
|-
|272
|''pps''
|[[Os02g0771100]]
|10.1105/tpc.111.083436
|
*The COP1 Ortholog PPS Regulates the Juvenile–Adult and Vegetative–Reproductive Phase Changes in Rice
|-
|273
|''Ossgo1''
|[[Os02g0799100]]
|10.1111/j.1365-313X.2011.04615.x
|
*Annotated
|-
|274
|''Ospho1;2''
|[[Os02g0809800]]
|10.1104/pp.109.149872
|
*Characterization of the Rice PHO1 Gene Family Reveals a Key Role for OsPHO1;2 in Phosphate Homeostasis and the Evolution of a Distinct Clade in Dicotyledons
|-
|275
|''osmyoXIB''
|[[Os02g0816900]]
|10.1016/j.ydbio.2007.01.008
|
*ORYZA SATIVA MYOSIN XI B controls pollen development by photoperiod-sensitive protein localizations
|-
|276
|''rtbp1''
|[[Os02g0817800]]
|10.1105/tpc.107.051953
|
*Suppression of RICE TELOMERE BINDING PROTEIN1 Results in Severe and Gradual Developmental Defects Accompanied by Genome Instability in Rice
|-
|277
|''lpa1''
|[[Os02g0819400]]
|10.1007/s00122-008-0818-z
|
*The rice OsLpa1 gene encodes a novel protein involved in phytic acid metabolism
|-
|278
|''dh1''
|[[Os02g0820500]]
|10.1007/s11103-007-9283-3
|
*DH1, a LOB domain-like protein required for glume formation in rice
|-
|279
|''Osa8''
|[[Os03g0100800]]
|10.1093/jxb/ern298
|
*Annotated
|-
|280
|''pair1''
|[[Os03g0106300]]
|10.1105/tpc.020701
|
*The Novel Gene HOMOLOGOUS PAIRING ABERRATION IN RICE MEIOSIS1 of Rice Encodes a Putative Coiled-Coil Protein Required for Homologous Chromosome Pairing in Meiosis
|-
|281
|''lsi2''
|[[Os03g0107300]]
|10.1038/nature05964
|
*An efflux transporter of silicon in rice
|-
|282
|''rim1''
|[[Os03g0119966]]
|10.1111/j.1365-313X.2008.03712.x
|
*Disruption of a novel gene for a NAC-domain protein in rice confers resistance to Rice dwarf virus
|-
|283
|''osmads50''
|[[Os03g0122600]]
|10.1111/j.1365-313X.2004.02082.x
|
*Annotated
|-
|284
|''dsm2''
|[[Os03g0125100]]
|10.1104/pp.110.163741
|
*Annotated
|-
|285
|''OsCYP96B4''
|[[Os03g0140400]]
|10.1371/journal.pone.0028069
|
*Annotated
|
|-
|286
|''XS-lpa2-1''
|[[Os03g0142800]]
|10.1007/s00122-009-1018-1
|
*Annotated
|-
|287
|''arl1''
|[[Os03g0149100]]
|10.1111/j.1365-313X.2005.02434.x
|
*Annotated
|-
|288
|''crl1''
|[[Os03g0149100]]
|10.1105/tpc.105.030981
|
*Annotated
|-
|289
|''OsEDR1''
|[[Os03g0160100]]
|10.1111/j.1365-3040.2010.02219.x
|
*OsEDR1 negatively regulates rice bacterial resistance via activation of ethylene biosynthesispce
|-
|290
|''oscow1''
|[[Os03g0162000]]
|10.1007/s11103-007-9203-6
|
*NARROW LEAF 7 controls leaf shape mediated by auxin in rice
|-
|291
|''nal7''
|[[Os03g0162000]]
|10.1007/s00438-008-0328-3
|
*NARROW LEAF 7 controls leaf shape mediated by auxin in rice
|-
|292
|''dpw''
|[[Os03g0167600]]
|10.1105/tpc.111.087528
|
*Defective Pollen Wall Is Required for Anther and Microspore Development in Rice and Encodes a Fatty Acyl Carrier Protein Reductase
|-
|293
|''cyp704B2''
|[[Os03g0168600]]
|10.1105/tpc.109.070326
|Annotated
|Development
|-
|294
|''oni1''
|[[Os03g0181500]]
|10.1111/j.1365-313X.2011.04530.x
|
*Annotated
|-
|295
|''OsPDS''
|[[Os03g0184000]]
|10.1111/j.1365-313X.2008.03411.x
|
*Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|296
|''gid2''
|[[Os03g0196500]]
|10.1126/science.1081077
|
*Accumulation of Phosphorylated Repressor for Gibberellin Signaling in an F-box Mutant
|-
|297
|''d88''
|[[Os03g0203200]]
|10.1007/s11103-009-9522-x
|
*Annotated
|-
|298
|''htd2''
|[[Os03g0203200]]
|10.1007/s00425-009-0975-6
|
*Annotated
|-
|299
|''d14''
|[[Os03g0203200]]
|10.1093/pcp/pcp091
|
*Annotated
|-
|300
|''dl''
|[[Os03g0215200]]
|10.1105/tpc.018044
|Annotated
|-
|301
|''lhs1''
|[[Os03g0215400]]
|10.1105/tpc.12.6.871
|
* Annotated
|-
|302
|''OsFRDL1''
|[[Os03g0216700]]
|10.1104/pp.108.128132
|
* OsFRDL1 Is a Citrate Transporter Required for Efficient Translocation of Iron in Rice
|-
|303
|''dsm3''
|[[Os03g0230500]]
|10.1007/s11103-011-9830-9
|
* Annotated
|-
|304
|''Osapc6''
|[[Os03g0236966]]
|10.1007/s10142-009-0155-6
|
* A candidate gene OsAPC6 of anaphase-promoting complex of rice identified through T-DNA insertion
|-
|305
|''rcn1''
|[[Os03g0281900]]
|10.1111/j.1469-8137.2008.02724.x
|
* Annotated
|-
|306
|''mit''
|[[Os03g0296800]]
|10.1038/ncomms1326
|
* The rice mitochondrial iron transporter is essential for plant growth
|-
|307
|''ssd1''
|[[Os03g0302900]]
|10.2183/pjab.86.265
|
* SSD1, which encodes a plant-specific novel protein, controls plant elongation by regulating cell division in rice
|-
|308
|''phyB''
|[[Os03g0309200]]
|10.1105/tpc.105.035899
|
* Annotated
|-
|309
|''oscipk31''
|[[Os03g0319400]]
|10.1007/s10059-010-0084-1
|Annotated
|-
|310
|''v2''
|[[Os03g0320900]]
|10.1111/j.1365-313X.2007.03251.x
|
* The rice nuclear gene, VIRESCENT 2, is essential for chloroplast development and encodes a novel type of guanylate kinase targeted to plastids and mitochondria
|-
|311
|''OschlH''
|[[Os03g0323200]]
|10.1093/pcp/pcg064
|
* Characterization of a Rice Chlorophyll-Deficient Mutant Using the T-DNA Gene-Trap System
|-
|312
|''glu1''
|[[Os03g0329500]]
|10.1007/s11103-005-2972-x
|
* Annotated
|-
|313
|''cwa1/bc1''
|[[Os03g0416200]]
|10.1007/s00425-010-1171-4
|
* Isolation of a novel cell wall architecture mutant of rice with defective Arabidopsis COBL4 ortholog BC1 required for regulated deposition of secondary cell wall components
|-
|314
|''glup4''
|[[Os03g0427300]]
|10.1270/jsbbs.60.556
|
* Characterization of the rice glup4 mutant suggests a role for the small GTPase Rab5 in the biosynthesis of carbon and nitrogen storage reserves in developing endosperm
|-
|315
|''OsAGO7''
|[[Os03g0449200]]
|10.1007/s00425-006-0472-0
|
* Annotated
|-
|316
|''shl4/sho2''
|[[Os03g0449200]]
|10.1073/pnas.0704339104
|
* Annotated
|-
|317
|''chl9''
|[[Os03g0563300]]
|10.1007/s11103-006-9024-z
|
* Rice Chlorina-1 and Chlorina-9 encode ChlD and ChlI subunits of Mg-chelatase, a key enzyme for chlorophyll synthesis and chloroplast development
|-
|318
|''pez1''
|[[Os03g0571900]]
|10.1074/jbc.M111.221168
|
* A Rice phenolic efflux transporter is essential for solubilizing precipitated apoplasmic iron in the plant stele
|-
|321
|''OsIAA11''
|[[Os03g0633500]]
|10.1093/mp/ssr074
|
* A Gain-of-Function Mutation in OsIAA11 Affects Lateral Root Development in Rice
|-
|322
|''Osam1''
|[[Os03g0650400]]
|10.1038/cr.2011.7
|
* OsAM1 is required for leptotene-zygotene transition in rice
|-
|323
|''nol1''
|[[Os03g0654600]]
|10.1111/j.1365-313X.2008.03670.x
|
* Two short-chain dehydrogenase/reductases, NON-YELLOW COLORING 1 and NYC1-LIKE, are required for chlorophyll b and light-harvesting complex II degradation during senescence in rice
|-
|324
|''v1''
|[[Os03g0656900]]
|10.1111/j.1365-313X.2011.04755.x
|
* Annotated
|-
|325
|''crl4''
|[[Os03g0666100]]
|10.3117/plantroot.2.19
|
* CRL4 regulates crown root formation through auxin transport in rice
|-
|327
|''fc1/OsTB1''
|[[Os03g0706500]]
|10.1046/j.1365-313X.2003.01648.x
|
* Annotated
|-
|328
|''slr1''
|[[Os03g0707600]]
|10.1105/tpc.13.5.999
|
* Annotated
|-
|329
|''Slr1-d''
|[[Os03g0707600]]
|10.1007/s00438-008-0406-6
|
* Annotated
|-
|330
|''phyA''
|[[Os03g0719800]]
|10.1105/tpc.105.035899
|
* Distinct and Cooperative Functions of Phytochromes A, B, and C in the Control of Deetiolation and Flowering in Rice
|-
|331
|''OsMIK''
|[[Os03g52760]]
|10.1007/s00122-008-0863-7
|
* Isolation and characterization of a low phytic acid rice mutant reveals a mutation in the rice orthologue of maize MIK
|-
|332
|''phyC''
|[[Os03g0752100]]
|10.1105/tpc.105.035899
|
* Distinct and Cooperative Functions of Phytochromes A, B, and C in the Control of Deetiolation and Flowering in Rice
|-
|333
|''pap2''
|[[Os03g0753100]]
|10.1093/pcp/pcp166
|
* Annotated
|-
|334
|''osmads34''
|[[Os03g0753100]]
|10.1104/pp.110.156711
|
* Annotated
|-
|335
|''pho1''
|[[Os03g0758100]]
|10.1105/tpc.107.054007
|
* Mutation of the Plastidial a-Glucan Phosphorylase Gene in Rice Affects the Synthesis and Structure of Starch in the Endosperm
|-
|336
|''bel''
|[[Os03g0760200]]
|10.1007/s11103-006-0058-z
|
* Annotated
|-
|337
|''DST''
|[[Os03g0786400]]
|10.1101/gad.1812409
|
* Annotated
|-
|338
|''pla3/gp''
|[[Os03g0790600]]
|10.1111/j.1365-313X.2009.03841.x
|
* PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in rice
|-
|339
|''el1''
|[[Os03g0793500]]
|10.1038/emboj.2010.75
|
* Annotated
|-
|340
|''chl1''
|[[Os03g0811100]]
|10.1007/s11103-006-9024-z
|
* Annotated
|-
|341
|''OsIDS1''
|[[Os03g0818800]]
|10.1111/j.1365-313X.2011.04804.x
|
* Two AP2 family genes, SUPERNUMERARY BRACT (SNB) and OsINDETERMINATE SPIKELET 1 (OsIDS1), synergistically control inflorescence architecture and floral meristem establishment in rice
|-
|342
|''Xb15''
|[[Os03g0821300]]
|10.1371/journal.pbio.0060231
|
* Rice XB15, a Protein Phosphatase 2C, Negatively Regulates Cell Death and XA21-Mediated Innate Immunity Chang
|-
|343
|''Os-castor''
|[[Os03g0843600]]
|10.1104/pp.108.131540
|
* Antiquity and Function of CASTOR and POLLUX, the Twin Ion Channel-Encoding Genes Key to the Evolution of Root Symbioses in Plants
|-
|345
|''etr2''
|[[Os04g0169100]]
|10.1105/tpc.108.065391
|
* The Ethylene Receptor ETR2 Delays Floral Transition and Affects Starch Accumulation in Rice
|-
|346
|''OsYSL6''
|[[Os04g0390500]]
|10.1104/pp.111.186031
|* OsYSL6 Is Involved in the Detoxification of Excess Manganese in Rice1[W][OA]
|-
|347
|''lax2''
|[[Os04g0396500]]
|10.1105/tpc.111.088765
|
* LAX PANICLE2 of rice encodes a novel nuclear protein and regulates the formation of axillary meristems
|-
|348
|''ACL1''
|[[Os04g0415000]]
|10.1093/mp/ssq022
|
* Annotated
|-
|349
|''zep1''
|[[Os04g0452500]]
|10.1105/tpc.109.070789
|
* Annotated
|-
|350
|''tdd1''
|[[Os04g0463500]]
|10.1111/j.1365-313X.2009.03952.x
|
* A rice tryptophan deficient dwarf mutant, tdd1, contains a reduced level of indole acetic acid and develops abnormal flowers and organless embryos
|-
|351
|''d11''
|[[Os04g0469800]]
|10.1105/tpc.104.024950
|
* Annotated
|-
|352
|''OsGLU3''
|[[Os04g0497200]]
|10.1093/mp/ssr084
|
* OsGLU3, a putative membrane-bound endo-1,4-beta-glucanase, is required for root cell elongation and division in rice (Oryza sativa L.)
|-
|353
|''OsDCL4''
|[[Os04g0509300]]
|10.1105/tpc.107.052209
|
* Oryza sativa Dicer-like4 Reveals a Key Role for Small Interfering RNA Silencing in Plant Development
|-
|355
|''TOB1''
|[[Os04g0536300]]
|10.1105/tpc.111.094797
|
* The YABBY Gene TONGARI-BOUSHI1 Is Involved in Lateral Organ Development and Maintenance of Meristem Organization in the Rice Spikelet
|-
|356
|''Osvpe1''
|[[Os04g0537900]]
|10.1111/j.1365-313X.2009.03801.x
|
* The vacuolar processing enzyme OsVPE1 is required for efficient glutelin processing in rice
|-
|357
|''d17''
|[[Os04g0550600]]
|10.1038/nature07272
|
* Inhibition of shoot branching by new terpenoid plant hormones
|-
|359
|''OsCPK12''
|[[Os04g0560600]]
|10.1111/j.1365-313X.2011.04766.x
|
* Annotated
|-
|360
|''glr3.1''
|[[Os04g0585200]]
|10.1105/tpc.105.037713
|
* Annotated
|-
|361
|''apo2''
|[[Os04g0598300]]
|10.1111/j.1365-313X.2011.04781.x
|
* ABERRANT PANICLE ORGANIZATION 2/RFL, the rice ortholog of Arabidopsis LEAFY, suppresses the transition from inflorescence meristem to floral meristem through interaction with APO1
|-
|362
|''rlin1''
|[[Os04g0610800]]
|10.1016/j.jcg.2010.12.001
|
* RLIN1, encoding a putative coproporphyrinogen III oxidase, is involved in lesion initiation in rice
|-
|363
|''osks1''
|[[Os04g0611800]]
|10.1104/pp.103.033696
|
* An Overview of Gibberellin Metabolism Enzyme Genes and Their Related Mutants in Rice
|-
|364
|''fc1''
|[[Os04g0612700]]
|10.1007/s11103-008-9448-8
|
* FLEXIBLE CULM 1 encoding a cinnamyl-alcohol dehydrogenase controls culm mechanical strength in rice
|-
|366
|''ili1''
|[[Os04g0641700]]
|10.1105/tpc.109.070441
|
* Antagonistic HLH/bHLH Transcription Factors Mediate Brassinosteroid Regulation of Cell Elongation and Plant Development in Rice and Arabidopsis
|-
|367
|''flo2''
|[[Os04g0645100]]
|10.1105/tpc.109.070821
|
* Annotation
|-
|368
|''OsCP1''
|[[Os04g0670500]]
|10.1023/B:PLAN.0000040904.15329.29
|
* Isolation and characterization of a rice cysteine protease gene, OsCP1, using T-DNA gene-trap system
|-
|369
|''OsARF12''
|[[Os04g0671900]]
|10.1111/j.1469-8137.2011.03910.x
|
* Annotation
|-
|370
|''OsMKP1''
|[[Os05g0115800]]
|10.1093/pcp/pcm007
|
* A Calmodulin-Binding Mitogen-Activated Protein Kinase Phosphatase is Induced by Wounding and Regulates the Activities of Stress-Related Mitogen-Activated Protein Kinases in Rice
|-
|371
|''rsr1''
|[[Os05g0121600]]
|10.1104/pp.110.159517
|
* Coexpression Analysis Identifies Rice Starch Regulator1, a Rice AP2/EREBP Family Transcription Factor, as a Novel Rice Starch Biosynthesis Regulator1
|-
|372
|''siz1''
|[[Os05g0125000]]
|10.1111/j.1469-8137.2010.03538.x
|
* Annotation
|-
|373
|''srs3''
|[[Os05g0154700]]
|10.1093/pcp/pcq092
|
* Annotation
|-
|374
|''bc10''
|[[Os05g0170000]]
|10.1111/j.1365-313X.2008.03703.x
|
* BC10, a DUF266-containing and Golgi-located type II membrane protein, is required for cell-wall biosynthesis in rice (Oryza sativa L.)
|-
|375
|''mads58''
|[[Os05g0203800]]
|10.1105/tpc.111.087262
|
* ??Rice MADS6 Interacts with the Floral Homeotic Genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in Specifying Floral Organ Identities and Meristem Fate
|-
|376
|''d1''
|[[Os05g0333200]]
|10.1073/pnas.96.18.10284
|
* Annotation
|-
|377
|''ygl1''
|[[Os05g0349700]]
|10.1104/pp.107.100321
|
* Annotation
|-
|378
|''OsImpβ1''
|[[Os05g0353400]]
|10.1007/s10059-011-2321-7
|
* Rice Importin β1 Gene Affects Pollen Tube Elongation
|-
|379
|''osbc1l4''
|[[Os05g0386800]]
|10.1007/s11103-009-9537-3
|
* Molecular characterization, expression pattern, and function analysis of the OsBC1L family in rice
|-
|380
|''flo4''
|[[Os05g0405000]]
|10.1111/j.1365-313X.2005.02423.x
|
* White-core endosperm floury endosperm-4 in rice is generated by knockout mutations in the C4-type pyruvate orthophosphate dikinase gene (OsPPDKB)
|-
|382
|''gid1''
|[[Os05g0407500]]
|10.1038/nature04028
|
* Annotation
|-
|383
|''DNG701''
|[[Os05g0446000]]
|10.1073/pnas.1112704108
|
* A 5-methylcytosine DNA glycosylase/lyase demethylates the retrotransposon Tos17 and promotes its transposition in rice
|-
|384
|''bgl''
|[[Os05g0454200]]
|10.1007/s11103-011-9839-0
|
* The rice bright green leaf (bgl) locus encodes OsRopGEF10, which activates the development of small cuticular papillae on leaf surfaces
|-
|385
|''oszip5''
|[[Os05g0472700]]
|10.1007/s11103-010-9637-0
|
* OsZIP5 is a plasma membrane zinc transporter in rice
|-
|386
|''eui1''
|[[Os05g0482400]]
|10.1093/pcp/pci233
|
* Annotation
|-
|389
|''spl7''
|[[Os05g0530400]]
|10.1073/pnas.112209199
|
* Annotation
|-
|390
|''snrk1a''
|[[Os05g0530500]]
|10.1105/tpc.105.037887
|
* The SnRK1A Protein Kinase Plays a Key Role in Sugar Signaling during Germination and Seedling Growth of Rice
|-
|391
|''ltn1''
|[[Os05g0557700]]
|10.1104/pp.110.170209
|
*Annotated
|-
|392
|''nl1''
|[[Os05g0578900]]
|10.1038/cr.2009.36
|
* NECK LEAF 1, a GATA type transcription factor, modulates organogenesis by regulating the expression of multiple regulatory genes during reproductive development in rice
|-
|393
|''Osrec8''
|[[Os05g0580500]]
|10.1104/pp.111.177428
|
* Annotated
|-
|394
|''osjar1''
|[[Os05g0586200]]
|10.1111/j.1365-3040.2008.01790.x
|
* Annotated
|-
|395
|''Osexpa17''
|[[Os06g0108600]]
|10.1111/j.1365-313X.2011.04533.x
|
* Root hair-specific expansins modulate root hair elongation in rice
|-
|398
|''zn''
|[[Os06g0116400]]
|10.1111/j.1365-313X.2010.04183.x
|
* ZEBRA-NECROSIS, a thylakoid-bound protein, is critical for the photoprotection of developing chloroplasts during early leaf development
|-
|399
|''osbbi1''
|[[Os06g0125800]]
|10.1038/cr.2011.4
|
* Annotated
|-
|400
|''d62/dlt''
|[[Os06g0127800]]
|10.1007/s00425-010-1263-1
|
* Annotated
|-
|402
|''sik1''
|[[Os06g0130100]]
|10.1111/j.1365-313X.2010.04146.x
|
* Annotated
|-
|403
|''dp1''
|[[Os06g0136900]]
|10.1016/j.ydbio.2011.08.023
|
* An AT-hook gene is required for palea formation and floral organ number control in rice
|-
|404
|''d3''
|[[Os06g0154200]]
|10.1093/pcp/pci022
|
* Suppression of Tiller Bud Activity in Tillering Dwarf Mutants of Rice
|-
|405
|''OsSSI''
|[[Os06g0160700]]
|10.1104/pp.105.071845
|
* Annotated
|-
|406
|''v3''
|[[Os06g0168600]]
|10.1104/pp.109.136648
|
* Rice Virescent3 and Stripe1 Encoding the Large and Small Subunits of Ribonucleotide Reductase Are Required for Chloroplast Biogenesis during Early Leaf Development
|-
|407
|''aid1''
|[[Os06g0181300]]
|10.1104/pp.104.041459
|
* The ANTHER INDEHISCENCE1 Gene Encoding a Single MYB Domain Protein Is Involved in Anther Development in Rice
|-
|408
|''abl1''
|[[Os06g0211200]]
|10.1104/pp.111.173427
|
* Annotated
|-
|409
|''Osabf2''
|[[Os06g0211200]]
|10.1016/j.jplph.2010.05.008
|
* Annotated
|-
|410
|''lsi6''
|[[Os06g0228200]]
|10.1105/tpc.108.059311
|
* A Transporter Regulating Silicon Distribution in Rice Shoots
|-
|411
|''st1''
|[[Os06g0257450]]
|10.1104/pp.109.136648
|
* Rice Virescent3 and Stripe1 Encoding the Large and Small Subunits of Ribonucleotide Reductase Are Required for Chloroplast Biogenesis during Early Leaf Development
|-
|412
|''nyc3''
|[[Os06g0354700]]
|10.1111/j.1365-313X.2009.03919.x
|
* Defect in non-yellow coloring 3, an a/b hydrolase-fold family protein, causes a stay-green phenotype during leaf senescence in rice
|-
|413
|''d35''
|[[Os06g0569500]]
|10.1023/B:PLAN.0000038261.21060.47
|
* Annotated
|-
|414
|''OsIAA23''
|[[Os06g0597000]]
|10.1111/j.1365-313X.2011.04698.x
|
* Annotated
|-
|415
|''se5''
|[[Os06g0603000]]
|10.1046/j.1365-313X.2000.00753.x
|
* Annotated
|-
|416
|''moc1''
|[[Os06g0610350]]
|10.1038/nature01518
|
* Annotated
|-
|417
|''spp''
|[[Os06g0625400]]
|10.1093/pcp/pcq012
|
* A Rice Stromal Processing Peptidase Regulates Chloroplast and Root Development
|-
|418
|''apo1''
|[[Os06g0665400]]
|10.1111/j.1365-313X.2007.03200.x
|
* Rice ABERRANT PANICLE ORGANIZATION 1, encoding an F-box protein, regulates meristem fate
|-
|419
|''oshma9''
|[[Os06g0665800]]
|10.1104/pp.107.102236
|
* Annotated
|-
|420
|''dep3''
|[[Os06g0677000]]
|10.1007/s00122-011-1543-6
|
* Fine mapping and candidate gene analysis of dense and erect panicle 3, DEP3, which confers high grain yield in rice (Oryza sativa L.)
|-
|421
|''star1''
|[[Os06g0695800]]
|10.1105/tpc.108.064543
|
* Annotated
|-
|422
|''OsHMA2''
|[[Os06g0700700]]
|10.1093/pcp/pcr166
|
* Annotated
|-
|423
|''oshkt2;1''
|[[Os06g0701700]]
|10.1038/sj.emboj.7601732
|
* Annotated
|-
|424
|''spw1''
|[[Os06g0712700]]
|10.1242/dev.00294
|
* Annotated
|-
|425
|''fon1''
|[[Os06g0717200]]
|10.1242/dev.01441
|
* The gene FLORAL ORGAN NUMBER1 regulates floral meristem size in rice and encodes a leucine-rich repeat receptor kinase orthologous to Arabidopsis CLAVATA1
|-
|426
|''ila1''
|[[Os06g0724900]]
|10.1105/tpc.111.093419
|
* Annotated
|-
|427
|''GA2ox5''
|[[Os07g0103500]]
|10.1105/tpc.108.060913
|
* A Novel Class of Gibberellin 2-Oxidases Control Semidwarfism, Tillering, and Root Development in Rice
|-
|428
|''crl5''
|[[Os07g0124700]]
|10.1111/j.1365-313X.2011.04610.x
|
|* Finished
|-
|429
|''g1''
|[[Os07g0139300]]
|10.1073/pnas.0907896106
|
* The homeotic gene long sterile lemma (G1) specifies sterile lemma identity in the rice spikelet
|-
|430
|''waf1''
|[[Os07g0164000]]
|10.1104/pp.110.160234
|
* Annotated
|-
|431
|''osku70''
|[[Os07g0184900]]
|10.1104/pp.109.150391
|
* OsKu70 Is Associated with Developmental Growth and Genome Stability in Rice
|-
|432
|''OsPHF1''
|[[Os07g0187700]]
|10.1104/pp.111.181669
|
* OsPHF1 Regulates the Plasma Membrane Localization of Low- and High-Affinity Inorganic Phosphate Transporters and Determines Inorganic Phosphate Uptake and Translocation in Rice
|-
|433
|''STR2''
|[[Os07g0191600]]
|10.1111/j.1365-313X.2011.04842.x
|
* The half-size ABC transporters STR1 and STR2 are indispensable for mycorrhizal arbuscule formation in rice
|-
|434
|''OsZDS''
|[[Os07g0204900]]
|10.1111/j.1365-313X.2008.03411.x
|
* Mutations of genes in synthesis of the carotenoid precursors of ABA lead to pre-harvest sprouting and photo-oxidation in rice
|-
|435
|''sh-h''
|[[Os07g0207700]]
|10.1111/j.1365-313X.2009.04039.x
|
* Inactivation of the CTD phosphatase-like gene OsCPL1 enhances the development of the abscission layer and seed shattering in rice
|-
|436
|''OsZIP8''
|[[Os07g0232800]]
|10.1007/s10059-010-0069-0
|
* Zinc Deficiency-Inducible OsZIP8 Encodes a Plasma Membrane-Localized Zinc Transporter in Rice
|-
|437
|''snb''
|[[Os07g0235800]]
|10.1111/j.1365-313X.2006.02941.x
|
* The rice heterochronic gene SUPERNUMERARY BRACT regulates the transition from spikelet meristem to floral meristem
|-
|438
|''oscbt''
|[[Os07g0490200]]
|10.1007/s10059-009-0081-4
|
* The Calmodulin-Binding Transcription Factor OsCBT Suppresses Defense Responses to Pathogens in Rice
|-
|439
|''oswrky78''
|[[Os07g0583700]]
|10.1007/s00425-011-1423-y
|
* The WRKY transcription factor OsWRKY78 regulates stem elongation and seed development in rice
|-
|440
|''bui1''
|[[Os07g0596300]]
|10.1105/tpc.110.081802
|
* Annotated
|-
|441
|''dep2''
|[[Os07g0616000]]
|10.1038/cr.2010.69
|
* Annotated
|-
|442
|''srs1''
|[[Os07g0616000]]
|10.1266/ggs.85.327
|
* Annotated
|-
|445
|''rth1''
|[[Os07g0682800]]
|10.1270/jsbbs.59.13
|
* Annotated
|-
|446
|''wox11''
|[[Os07g0684900]]
|10.1105/tpc.108.061655
|
* The WUSCHEL-Related Homeobox Gene WOX11 Is Required to Activate Shoot-Borne Crown Root Development in Rice
|-
|447
|''OsNAS3''
|[[Os07g0689600]]
|10.1073/pnas.0910950106
|
* Iron fortification of rice seeds through activation of the nicotianamine synthase gene
|-
|448
|''ehd3''
|[[Os08g0105000]]
|10.1111/j.1365-313X.2011.04517.x
|
* Annotated
|-
|449
|''pss1''
|[[Os08g0117000]]
|10.1105/tpc.109.073692
|
* Annotated
|-
|450
|''cyp703a3''
|[[Os08g0131100]]
|10.1105/tpc.108.062935
|
* Annotated
|-
|451
|''crr6''
|[[Os08g0167500]]
|10.1111/j.1365-313X.2011.04747.x
|
* Annotated
|-
|453
|''ss3a''
|[[Os08g0191433]]
|10.1093/jxb/err125
|
* Annotated
|-
|454
|''osagps2''
|[[Os08g0345800]]
|10.1007/s11103-007-9153-z
|
* Annotated
|-
|455
|''GF14c''
|[[Os08g0430500]]
|10.1093/pcp/pcp012
|
* The 14-3-3 Protein GF14c Acts as a Negative Regulator of Flowering in Rice by Interacting with the Florigen Hd3a
|-
|456
|''coe1''
|[[Os08g0442700]]
|10.1111/j.1365-313X.2010.04250.x
|
* COE1, an LRR–RLK responsible for commissural vein pattern formation in rice
|-
|457
|''bc12''
|[[Os09g0114500]]
|10.1111/j.1365-313X.2010.04238.x
|
* Annotated
|-
|458
|''gdd1''
|[[Os09g0114500]]
|10.1105/tpc.110.081901
|
* Annotated
|-
|459
|''sll1''
|[[Os09g0395300]]
|10.1105/tpc.108.061457
|
* Annotated
|-
|460
|''rl9''
|[[Os09g0395300]]
|10.1007/s11103-008-9365-x
|
* Annotated
|-
|461
|''STR1''
|[[Os09g0401100]]
|10.1111/j.1365-313X.2011.04842.x
|
* Annotated
|-
|462
|''rep1''
|[[Os09g0410500]]
|10.1104/pp.108.128231
|
* RETARDED PALEA1 Controls Palea Development and Floral Zygomorphy in Rice
|-
|463
|''bc6''
|[[Os09g0422500]]
|10.1093/jxb/erq395
|
* Annotated
|-
|464
|''OsCesA9''
|[[Os09g0422500]]
|10.1104/pp.103.022442
|
* Annotated
|-
|465
|''osgl1-1''
|[[Os09g0426800]]
|10.1093/mp/ssr028
|
* Annotated
|-
|466
|''wsl2''
|[[Os09g0426800]]
|10.1007/s00425-011-1481-1
|
* Annotated
|-
|470
|''PTC1''
|[[Os09g0449000]]
|10.1104/pp.111.175760
|
* Annotated
|-
|471
|''aco1''
|[[Os09g0451000]]
|10.1111/j.1365-3040.2009.02106.x
|
* ACO1, a gene for aminocyclopropane-1-carboxylate oxidase: effects on internode elongation at the heading stage in rice
|-
|472
|''isa3''
|[[Os09g0469400]]
|10.1093/pcp/pcr058
|
* Rice Debranching Enzyme Isoamylase3 Facilitates Starch Metabolism and Affects Plastid Morphogenesis
|-
|473
|''gna1''
|[[Os09g0488000]]
|10.1104/pp.104.058248
|
* A Novel Short-Root Gene Encodes a Glucosamine-6-Phosphate Acetyltransferase Required for Maintaining Normal Root Cell Shape in Rice
|-
|474
|''PAIR2''
|[[Os09g0506800]]
|10.1007/s00438-003-0934-z
|
* An insertional mutation in the rice PAIR2 gene, the ortholog of Arabidopsis ASY1, results in a defect in homologous chromosome pairing during meiosis
|-
|475
|''sgr''
|[[Os09g0532000]]
|10.1105/tpc.106.044891
|
* The Senescence-Induced Staygreen Protein Regulates Chlorophyll Degradation
|-
|476
|''OsAT1/Spl18''
|[[Os10g0195600]]
|10.1007/s11103-006-9130-y
|
* Isolation and molecular characterization of a Spotted leaf 18 mutant by modified activation-tagging in rice
|-
|477
|''brd2''
|[[Os10g0397400]]
|10.1105/tpc.105.030973
|
* Annotated
|-
|478
|''pla1''
|[[Os10g0403000]]
|10.1073/pnas.2636936100
|
* Annotated
|-
|479
|''pair3''
|[[Os10g0405500]]
|10.1111/j.1365-313X.2009.03870.x
|
* Annotated
|-
|480
|''ehd2''
|[[Os10g0419200]]
|10.1104/pp.108.125542
|
* Annotated
|-
|481
|''rid1''
|[[Os10g0419200]]
|10.1073/pnas.0806019105
|
* Annotated
|-
|482
|''OsCesA7''
|[[Os10g0467800]]
|10.1104/pp.103.022442
|
* Annotated
|-
|483
|''wda1''
|[[Os10g0471100]]
|10.1105/tpc.106.042044
|
* Wax-deficient anther1 Is Involved in Cuticle and Wax Production in Rice Anther Walls and Is Required for Pollen Development
|-
|484
|''OsMPK6''
|[[Os10g0533600]]
|10.1007/s00425-007-0541-z
|
* Annotated
|-
|485
|''OsCAO1''
|[[Os10g0567200]]
|10.1007/s11103-005-2066-9
|
* Annotated
|-
|486
|''cao''
|[[Os10g0567400]]
|10.1270/jsbbs.55.361
|
* Annotated
|-
|487
|''jmj6''
|[[Os10g0577600]]
|10.1073/pnas.0805901105
|
* Annotated
|-
|488
|''OsCSLD1''
|[[Os10g0578200]]
|10.1104/pp.106.091546
|
* OsCSLD1, a Cellulose Synthase-Like D1 Gene, Is Required for Root Hair Morphogenesis in Rice
|-
|489
|''phot1a''
|[[Os11g0102200]]
|10.1007/s11103-008-9442-1
|
* Rice phot1a mutation reduces plant growth by affecting photosynthetic responses to light during early seedling growth
|-
|490
|''OsPK1''
|[[Os11g0148500]]
|10.1007/s00425-011-1471-3
|
* Annotated
|-
|491
|''PDIL1''
|[[Os11g0199200]]
|10.1093/jxb/err262
|
* The failure to express a protein disulphide isomerase-like protein results in a floury endosperm and an endoplasmic reticulum stress response in rice
|-
|492
|''rad''
|[[Os11g0210300]]
|10.1270/jsbbs.56.69
|
* Annotated
|-
|493
|''sp1''
|[[Os11g0235200]]
|10.1111/j.1365-313X.2009.03799.x
|
* Annotated
|-
|494
|''Tid1''
|[[Os11g0247300]]
|10.1266/ggs.84.209
|
* Annotated
|-
|495
|''nls1-1D''
|[[Os11g0249000]]
|10.1111/j.1365-313X.2011.04557.x
|
* Annotated
|-
|496
|''lazy1''
|[[Os11g0490600]]
|10.1038/cr.2007.38
|
* Annotated
|-
|497
|''osarf1''
|[[Os11g0523800]]
|10.1007/s11103-009-9474-1
|
* Annotated
|-
|498
|''tld1-D''
|[[Os11g0528700]]
|10.1104/pp.109.146803
|
* Altered Architecture and Enhanced Drought Tolerance in Rice via the Down-Regulation of Indole-3-Acetic Acid by TLD1/OsGH3.13 Activation
|-
|501
|''d27''
|[[Os11g0587000]]
|10.1105/tpc.109.065987
|
* Annotated
|-
|502
|''fon2''
|[[Os11g0595400]]
|10.1093/pcp/pcl025
|
* Conservation and Diversification of Meristem Maintenance Mechanism in Oryza sativa: Function of the FLORAL ORGAN NUMBER2 Gene
|-
|503
|''wdl1''
|[[Os11g0708400]]
|10.1007/s11103-010-9656-x
|
* Mutation in Wilted Dwarf and Lethal 1 (WDL1) causes abnormal cuticle formation and rapid water loss in rice
|-
|504
|''rip1''
|[[Os12g0132400]]
|10.1093/pcp/pcl013
|
* Rice Immature Pollen 1 (RIP1) is a Regulator of Late Pollen Development
|-
|505
|''art1''
|[[Os12g0170400]]
|10.1105/tpc.109.070771
|
* A Zinc Finger Transcription Factor ART1 Regulates Multiple Genes Implicated in Aluminum Tolerance in Rice
|-
|506
|''OsMADS13''
|[[Os12g0207000]]
|10.1111/j.1365-313X.2007.03272.x
|
* The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice
|-
|507
|''ogr1''
|[[Os12g0270200]]
|10.1111/j.1365-313X.2009.03909.x
|
* Rice OGR1 encodes a pentatricopeptide repeat–DYW protein and is essential for RNA editing in mitochondria
|-
|508
|''osatg10b''
|[[Os12g0506800]]
|10.1007/s10059-009-0006-2
|
* Annotated
|-
|509
|''kch1''
|[[Os12g0547500]]
|10.1093/jxb/erq164
|
* A kinesin with calponin-homology domain is involved in premitotic nuclear migration
|-
|513
|''spl11''
|[[Os12g0570000]]
|10.1105/tpc.108.058610
|
* SPIN1, a K Homology Domain Protein Negatively Regulated and Ubiquitinated by the E3 Ubiquitin Ligase SPL11, Is Involved in Flowering Time Control in Rice
|-
|514
|''mel2''
|[[Os12g0572800]]
|10.1371/journal.pgen.1001265
|
* A Novel RNA-Recognition-Motif Protein Is Required for Premeiotic G1/S-Phase Transition in Rice (Oryza sativa L.)
|-
|515
|''gpa1''
|[[Os12g0631100]]
|10.1111/j.1365-313X.2010.04370.x
|
* OsRab5a regulates endomembrane organization and storage protein trafficking in rice endosperm cells
|-
|516
|''ossut2''
|[[Os12g0641400]]
|10.1104/pp.111.176982
|
* Annotated
|-
|517
|''d18''
|[[Os01g0177400]]
|10.1073/pnas.141239398
|
* Annotated
|-
|518
|''Gn1a''
|[[Os01g0197700]]
|10.1126/science.1113373
|
* Cytokinin Oxidase Regulates Rice Grain Production
|-
|520
|''SKC1''
|[[Os01g0307500]]
|10.1038/ng1643
|
* Annotated
|-
|521
|''PSR''
|[[Os01g0357100]]
|10.1073/pnas.0504220102
|
* Isolation of a rice regeneration quantitative trait loci gene and its application to transformation systems
|-
|522
|''SaF''
|[[Os01g0578500]]
|10.1073/pnas.0810108105
|
* Annotated
|-
|523
|''SaM''
|[[Os01g0578700]]
|10.1073/pnas.0810108105
|
* Hybrid male sterility in rice controlled by interaction between divergent alleles of two adjacent genes
|-
|524
|''Rd''
|[[Os01g0633500]]
|10.1111/j.1365-313X.2006.02958.x
|
* The Rc and Rd genes are involved in proanthocyanidin synthesis in rice pericarp
|-
|525
|''Pi37''
|[[Os01g0781700]]
|10.1534/genetics.107.080648
|
* The Blast Resistance Gene Pi37 Encodes a Nucleotide Binding Site–Leucine-Rich Repeat Protein and Is a Member of a Resistance Gene Cluster on Rice Chromosome 1
|-
|526
|''qSH1''
|[[Os01g0848400]]
|10.1126/science.1126410
|
* Annotated
|-
|527
|''qNPQ1-2''
|[[Os01g0869800]]
|10.1073/pnas.1104809108
|
|Finished
|-
|528
|''sd1''
|[[Os01g0883800]]
|10.1038/416701a
|
* Annotated
|-
|529
|''GW2''
|[[Os02g0244100]]
|10.1038/ng2014
|
* Annotated
|-
|530
|''Rf2''
|[[Os02g0274000]]
|10.1111/j.1365-313X.2010.04427.x
|
* The fertility restorer gene, Rf2, for Lead Rice-type cytoplasmic male sterility of rice encodes a mitochondrial glycine-rich protein
|-
|531
|''hbd2''
|[[Os02g0622100]]
|10.1007/s00438-010-0514-y
|
* Annotated
|-
|532
|''Pib''
|[[Os02g0818450]]
|10.1046/j.1365-313X.1999.00498.x
|
* The Pib gene for rice blast resistance belongs to the nucleotide binding and leucine-rich repeat class of plant disease resistance genes
|-
|533
|''qLTG3?1''
|[[Os03g0103300]]
|10.1073/pnas.0805303105
|
* Annotated
|-
|534
|''dth3''
|[[Os03g0122600]]
|10.1007/s00299-011-1129-4
|
* Annotated
|-
|535
|''GS3''
|[[Os03g0407400]]
|10.1007/s00122-006-0218-1
|
* Annotated
|-
|536
|''GRP162''
|[[Os03g0641300]]
|10.1105/tpc.111.093211
|
* The Rice Pentatricopeptide Repeat Protein RF5 Restores Fertility in Hong-Lian Cytoplasmic Male-Sterile Lines via a Complex with the Glycine-Rich Protein GRP162
|-
|537
|''LOX-3''
|[[Os03g0700400]]
| 10.1007/s12374-013-0085-7
|
* Molecular genetic characterization of rice seed lipoxygenase 3 and assessment of its effects on seed longevity
|-
|538
|''Hd6''
|[[Os03g0762000]]
|10.1073/pnas.111136798
|
* Annotated
|-
|539
|''Bph14''
|[[Os03g0848700]]
|10.1073/pnas.0912139106
|
* Annotated
|-
|541
|''Pi21''
|[[Os04g0401000]]
|10.1126/science.1175550
|
* Annotated
|-
|542
|''GIF1''
|[[Os04g0413500]]
|10.1038/ng.220
|
* Annotated
|-
|543
|''Rf17''
|[[Os04g0475900]]
|10.1073/pnas.0901860106
|
* Suppressed expression of RETROGRADE-REGULATED MALE STERILITY restores pollen fertility in cytoplasmic male sterile rice plants
|-
|544
|''BET1''
|[[Os04g0477300]]
|10.1104/pp.110.171470
|
* Suppression of a NAC-Like Transcription Factor Gene Improves Boron-Toxicity Tolerance in Rice
|-
|545
|''OSB2''
|[[Os04g0557500]]
|10.1093/pcp/pce128
|
* The Purple leaf (Pl) Locus of Rice: the Plw Allele has a Complex Organization and Includes Two Genes Encoding Basic Helix-Loop-Helix Proteins Involved in Anthocyanin Biosynthesis
|-
|546
|''OSB1''
|[[Os04g0557800]]
|10.1093/pcp/pce128
|
* The Purple leaf (Pl) Locus of Rice: the Plw Allele has a Complex Organization and Includes Two Genes Encoding Basic Helix-Loop-Helix Proteins Involved in Anthocyanin Biosynthesis
|-
|547
|''Xa1''
|[[Os04g0622600]]
|10.1073/pnas.95.4.1663
|
* Annotated
|-
|548
|''sh4''
|[[Os04g0670900]]
|10.1126/science.1123604
|
* Rice Domestication by Reducing Shattering
|-
|549
|''Xa5''
|[[Os05g0107700]]
|10.1094/MPMI.2004.17.12.1348
|
* Annotated
|-
|550
|''GS5''
|[[Os05g0158500]]
|10.1038/ng.977
|
* Annotated
|-
|551
|''GW5''
|[[DQ991205]]
|10.1038/cr.2008.307
|
* Isolation and initial characterization of GW5, a major QTL associated with rice grain width and weight
|-
|552
|''qSW5''
|[[AB433345_DQ991205]]
|10.1038/ng.169
|
* Deletion in a gene associated with grain size increased yields during rice domestication
|-
|553
|''wx''
|[[Os06g0133000]]
|10.1046/j.1365-313X.1995.7040613.x
|
* Annotated
|-
|554
|''Hd3a''
|[[Os06g0157700]]
|10.1093/pcp/pcf156
|
* Annotated
|-
|555
|''DPL2''
|[[Os06g0184100]]
|10.1073/pnas.1003124107
|
* Rice pollen hybrid incompatibility caused by reciprocal gene loss of duplicated genes
|-
|556
|''S5''
|[[Os06g0213100]]
|10.1073/pnas.0804761105
|
* A triallelic system of S5 is a major regulator of the reproductive barrier and compatibility of indica–japonica hybrids in rice
|-
|557
|''ALK''
|[[Os06g0229800]]
|10.1111/j.1744-7909.2011.01065.x
|
* Annotated
|-
|558
|''Hd1''
|[[Os06g0275000]]
|10.1105/tpc.12.12.2473
|
* Annotated
|-
|559
|''Pi2''
|[[Os06g0286700]]
|10.1094/MPMI-19-1216
|
* Annotated
|-
|560
|''Pi9''
|[[Os06g0286700]]
|10.1534/genetics.105.044891
|
* Annotated
|-
|561
|''Pi25''
|[[Os06g0330100]]
|10.1016/j.jgg.2011.03.010
|
* Annotated
|-
|562
|''Pid3''
|[[Os06g0330100]]
|10.1534/genetics.109.102871
|
* Annotated
|-
|563
|''Pi-d2''
|[[Os06g0494100]]
|10.1111/j.1365-313X.2006.02739.x
|
* Annotated
|-
|564
|''Xa27''
|[[Os06g0598900]]
|10.1038/nature03630
|
* R gene expression induced by a type-III effector triggers disease resistance in rice
|-
|566
|''PROG1''
|[[Os07g0153600]]
|10.1038/ng.197
|
* Control of a key transition from prostrate to erect growth in rice domestication
|-
|567
|''Rc''
|[[Os07g0211500]]
|10.1105/tpc.105.038430
|
* Caught Red-Handed: Rc Encodes a Basic Helix-Loop-Helix Protein Conditioning Red Pericarp in Rice
|-
|569
|''OsHMA3''
|[[Os07g0232900]]
|10.1073/pnas.1005396107
|
* Annotated
|-
|571
|''Ghd7''
|[[Os07g0261200]]
|10.1038/ng.143
|
* Annotated
|-
|572
|''Sdr4''
|[[Os07g0585700]]
|10.1073/pnas.0911965107
|
* Annotated
|-
|573
|''Pi36''
|[[Os08g0150100]]
|10.1534/genetics.107.075465
|
* The in Silico Map-Based Cloning of Pi36, a Rice Coiled-Coil–Nucleotide-Binding Site–Leucine-Rich Repeat Gene That Confers Race-Specific Resistance to the Blast Fungus
|-
|574
|''DTH8''
|[[Os08g0174500]]
|10.1104/pp.110.156943
|
* Annotated
|-
|578
|''Badh2''
|[[Os08g0424500]]
|10.1105/tpc.108.058917
|
* Annotated
|-
|579
|''WFP''
|[[Os08g0509600]]
|10.1038/ng.592
|
* Annotated
|-
|580
|''IPA1''
|[[Os08g0509600]]
|10.1038/ng.591
|
* Annotated
|-
|581
|''xa13''
|[[Os08g0535200]]
|10.1101/gad.1416306
|
* Annotated
|-
|582
|''Sub1A''
|[[AAZ06207]]
|10.1038/nature04920
|
* Sub1A is an ethylene-response-factor-like gene that confers submergence tolerance to rice
|-
|584
|''DEP1''
|[[Os09g0441900]]
|10.1038/ng.352
|
* Annotated
|-
|585
|''TAC1''
|[[Os09g0529300]]
|10.1111/j.1365-313X.2007.03284.x
|
* Annotated
|-
|586
|''CPDphotolyase''
|[[Os10g0167600]]
|10.1093/pcp/pch215
|
* Annotated
|-
|588
|''Ehd1''
|[[Os10g0463400]]
|10.1101/gad.1189604
|
* Ehd1, a B-type response regulator in rice, confers short-day promotion of flowering and controls FT-like gene expression independently of Hd1
|-
|589
|''RF1A''
|[[Os10g0497300]]
|10.1105/tpc.105.038240
|
* Annotated
|-
|591
|''Rf-1''
|[[Os10g0497432]]
|10.1046/j.1365-313X.2003.01961.x
|
* Map-based cloning of a fertility restorer gene, Rf-1, in rice (Oryza sativa L.)
|-
|592
|''RF1B''
|[[Os10g0499500]]
|10.1105/tpc.105.038240
|
* Cytoplasmic Male Sterility of Rice with Boro II Cytoplasm Is Caused by a Cytotoxic Peptide and Is Restored by Two Related PPR Motif Genes via Distinct Modes of mRNA Silencing
|-
|593
|''Pia''
|[[Os11g0225100]]
|10.1111/j.1365-313X.2011.04502.x
|
* Annotated
|-
|594
|''Xa21''
|[[Os11g0559200]]
|10.1126/science.270.5243.1804
|
* Annotated
|-
|595
|''Pb1''
|[[Os11g0598500]]
|10.1111/j.1365-313X.2010.04348.x
|
* Durable panicle blast-resistance gene Pb1 encodes an atypical CC-NBS-LRR protein and was generated by acquiring a promoter through local genome duplication
|-
|596
|''Pik1''
|[[Os11g0687800]]
|10.1111/j.1469-8137.2010.03462.x
|
* The isolation and characterization of Pik, a rice blast resistance gene which emerged after rice domestication
|-
|597
|''Pik2''
|[[Os11g0687900]]
|10.1111/j.1469-8137.2010.03462.x
|
* The isolation and characterization of Pik, a rice blast resistance gene which emerged after rice domestication
|-
|599
|''Pik-p''
|[[Os11g0689100]]
|10.1007/s00122-010-1506-3
|
* The Pik-p resistance to Magnaporthe oryzae in rice is mediated by a pair of closely linked CC-NBS-LRR genes
|-
|600
|''Xa3''
|[[Os11g0692300]]
|10.1007/s00122-006-0388-x
|
* Annotated
|-
|601
|''Xa26''
|[[Os11g0692300]]
|10.1046/j.1365-313X.2003.01976.x
| Xa26, a gene conferring resistance to Xanthomonas oryzae pv. oryzae in rice, encodes an LRR receptor kinase-like protein
|
|-
|602
|''Pi-ta''
|[[Os12g0281300]]
|10.1105/tpc.12.11.2033
| A Single Amino Acid Difference Distinguishes Resistant and Susceptible Alleles of the Rice Blast Resistance Gene Pi-ta
|
|-
|606
|''OsCOIN''
|[[Os01g0104100]]
|10.1007/s00425-007-0548-5
|
|Finished
|-
|607
|''OsIRL''
|[[Os01g0106400]]
|10.1111/j.1399-3054.2009.01290.x
|
|Finished
|-
|609
|''OsDREB2A''
|[[Os01g0165000]]
|10.1007/s10529-011-0620-x
|
|Finished
|-
|610
|''OsIAA1''
|[[Os01g0178500]]
|10.1007/s11103-009-9474-1
|
|Annotated
|-
|611
|''OsCDR1''
|[[Os01g0178600]]
|10.1094/MPMI-22-12-1635
|
|Finished
|-
|613
|''NH1''
|[[Os01g0194300]]
|10.1094/MPMI-18-0511
|
|Annotated
|-
|614
|''OsRAA1''
|[[Os01g0257300]]
|10.1104/pp.104.041996
|
|Annotated
|-
|615
|''CYP734A6''
|[[Os01g0388000]]
|10.1111/j.1365-313X.2011.04567.x
|
|Finished
|-
|616
|''OsWRKY11''
|[[Os01g0626400]]
|10.1007/s00299-008-0614-x
|
|Annotated
|-
|617-1
|''SLRL1''
|[[Os01g0646300]]
|10.1111/j.1365-313X.2005.02562.x
|
|Finished
|-
|617-2
|''SLRL2''
|[[Os05g0574900]]
|10.1111/j.1365-313X.2005.02562.x
|
|Finished
|-
|618
|''RACK1A''
|[[Os01g0686800]]
|10.1105/tpc.107.054395
|
|Annotated
|-
|619
|''OsWRKY13''
|[[Os01g0750100]]
|10.1094/MPMI-20-5-0492
|
|Finished
|-
|620
|''OsKAT1''
|[[Os01g0756700]]
|10.1104/pp.107.101154
|
|Annotated
|-
|621
|''OsCIPK12''
|[[Os01g0759400]]
|10.1104/pp.107.101295
|
|Annotated
|-
|623
|''GH3-2''
|[[Os01g0764800]]
|10.1104/pp.110.163774
|
|Annotated
|-
|624
|''OsGH3.1''
|[[Os01g0785400]]
|10.1094/MPMI-22-2-0201
|
|Finished
|-
|626
|''AP37''
|[[Os01g0797600]]
|10.1104/pp.109.137554
|
|Finished
|-
|627
|''ZFP179''
|[[Os01g0839100]]
|10.1093/jxb/erq120
|
|Annotated
|-
|628
|''OsMYB3R-2''
|[[Os01g0841500]]
|10.1104/pp.108.133454
|
|Finished
|-
|630
|''SAPK4''
|[[Os01g0869900]]
|10.1186/1471-2229-8-49
|
|Finished
|-
|631
|''SNAC2''
|[[Os01g0884300]]
|10.1007/s11103-008-9309-5
|
|Finished
|-
|633
|''OsDREB1F''
|[[Os01g0968800]]
|10.1007/s11103-008-9340-6
|
|Annotated
|-
|635
|''BiP''
|[[Os02g0115900]]
|10.1093/pcp/pcp098
|
|Finished
|-
|636
|''BiP3''
|[[Os02g0115900]]
|10.1371/journal.pone.0009262
|
|Finished
|-
|637
|''OsRacB''
|[[Os02g0120800]]
|10.1016/j.plaphy.2005.12.001
|
|Finished
|-
|638
|''OsCYP2''
|[[Os02g0121300]]
|10.1186/1471-2229-11-34
|
|Finished
|-
|639
|''OsMAPK33''
|[[Os02g0148100]]
|10.1007/s12038-011-9002-8
|
|Annotated
|-
|641
|''OsWRKY71''
|[[Os02g0181300]]
|10.1016/j.jplph.2006.07.006
|
|Finished
|-
|642
|''OsAGAP''
|[[Os02g0198300]]
|10.1111/j.1365-313X.2006.02898.x
|
|Annotated
|-
|645
|''RCN2''
|[[Os02g0531600]]
|10.1046/j.1365-313X.2002.01255.x
|
|Annotated
|-
|647
|''OsTPP1''
|[[Os02g0661100]]
|10.1007/s00425-008-0729-x
|
|Annotated
|-
|648
|''MAIF1''
|[[Os02g0671100]]
|10.1093/mp/ssq066
|
|Finished
|-
|649
|''SBPase''
|[[Os02g0698000]]
|10.1007/s00299-006-0299-y
|
|Finished
|-
|650
|''OsFAD2''
|[[Os02g0716500]]
|10.1007/s11032-011-9587-5
|
|Finished
|-
|651
|''OsHAP3E''
|[[Os02g0725700]]
|10.1016/j.plantsci.2011.04.009
|
|Finished
|-
|652
|''OsSKIPa''
|[[Os02g0759800]]
|10.1073/pnas.0901940106
|
|Finished
|-
|653
|''Orysa;KRP1''
|[[Os02g0762400]]
|10.1104/pp.106.087056
|
|Finished
|-
|654
|''mtHsp70''
|[[Os02g0774300]]
|10.1016/j.febslet.2010.11.051
|
|Finished
|-
|657
|''RWC3''
|[[Os02g0823100]]
|10.1093/pcp/pch058
|
|Finished
|-
|658
|''CDPK13''
|[[Os03g0128700]]
|10.1007/s00438-007-0220-6
|
|Annotated
|-
|659
|''OsCDPK13''
|[[Os03g0128700]]
|10.1007/s11103-004-1178-y
|
|Annotated
|-
|661
|''OsTIFY11a''
|[[Os03g0180800]]
|10.1007/s11103-009-9524-8
|
|Annotated
|-
|662
|''GS1;2''
|[[Os03g0223400]]
|10.1007/s00299-008-0665-z
|
|Annotated
|-
|666
|''sHSP17.7''
|[[Os03g0267200]]
|10.1007/s00299-007-0470-0
|
|Annotated
|-
|667
|''OsSDIR1''
|[[Os03g0272300]]
|10.1007/s11103-011-9775-z
|
|Annotated
|-
|668
|''OsAPXa''
|[[Os03g0285700]]
|10.1007/s00299-010-0985-7
|
|Finished
|-
|669
|''OsCIPK03''
|[[Os03g0319400]]
|10.1104/pp.107.101295
|
|Annotated
|-
|671
|''OsIPT2''
|[[Os03g0356900]]
|10.1104/pp.106.085811
|
|Annotated
|-
|674
|''OSH1''
|[[Os03g0727000]]
|10.1105/tpc.5.9.1039
|
|Finished
|-
|675
|''OsbHLH148''
|[[Os03g0741100]]
|10.1111/j.1365-313X.2010.04477.x
|
|Annotated
|-
|676
|''OSH43''
|[[Os03g0771500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|677
|''OsIPT4''
|[[Os03g0810100]]
|10.1104/pp.106.085811
|
|Finished
|-
|678
|''SNAC1''
|[[Os03g0815100]]
|10.1073/pnas.0604882103
|
|Annotated
|-
|680
|''ZFP182''
|[[Os03g0820300]]
|10.1016/j.bbaexp.2007.02.006
|
|Annotated
|-
|685
|''OsOxi1''
|[[Os04g0488700]]
|10.1093/pcp/pcq132
|
|Annotated
|-
|686
|''OsRDCP1''
|[[Os04g0530500]]
|10.1016/j.plantsci.2011.02.008
|
|Annotated
|-
|687
|''OsDREB1E''
|[[Os04g0572400]]
|10.1007/s10529-008-9811-5
|
|Finished
|-
|688
|''OsCDPK7''
|[[Os04g0584600]]
|10.1046/j.1365-313x.2000.00787.x
|
|Annotated
|-
|689
|''OsAP2-39''
|[[Os04g0610400]]
|10.1371/journal.pone.0025216
|
|Finished
|-
|690
|''ostgap1''
|[[Os04g0637000]]
|10.1074/jbc.M109.036871
|
|Finished
|-
|691
|''GS2''
|[[Os04g0659100]]
|10.1023/A:1006408712416
|
|Finished
|-
|692
|''OsRR6''
|[[Os04g0673300]]
|10.1093/pcp/pcm022
|
|Finished
|-
|694
|''OSH71''
|[[Os05g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|695
|''OsLti6b''
|[[Os05g0138300]]
|10.1007/s00299-006-0297-0
|
|Annotated
|-
|696
|''OsPYL/RCAR5''
|[[Os05g0213500]]
|10.1093/jxb/err338
|
|Annotated
|-
|698
|''OsWRKY53''
|[[Os05g0343400]]
|10.1016/j.bbaexp.2007.04.006
|
|Finished
|-
|699
|''OsDREB2B''
|[[Os05g0346200]]
|10.1007/s10529-008-9811-5
|
|Finished
|-
|700
|''DEPG1''
|[[Os05g0365300]]
|10.1007/s11033-011-1122-6
|Over-expression in the nucleotide-binding site-leucine rich repeat gene DEPG1 increases susceptibility to bacterial leaf streak disease in transgenic rice plants
|Susceptibility to Biotic Stress
|-
|701
|''Gns1''
|[[Os05g0375400]]
|10.1023/A:1020714426540
|Characterization of transgenic rice plants over-expressing the stress-inducible beta-glucanase gene Gns1
|
|-
|702
|''OsISA2''
|[[Os05g0393700]]
|10.1104/pp.111.173435
|Functional diversity of isoamylase oligomers: the ISA1 homo-oligomer is essential for amylopectin biosynthesis in rice endosperm
|
|-
|703
|''OsTPS1''
|[[Os05g0518600]]
|10.1007/s00425-011-1458-0
|Overexpression of the trehalose-6-phosphate synthase gene OsTPS1 enhances abiotic stress tolerance in rice
|Abiotic stress
|-
|704
|''OsLEA3-1''
|[[Os05g0542500]]
|10.1007/s00122-007-0538-9
|
|Annotated
|-
|705-1
|''OsIPT7''
|[[Os05g0551700]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-2
|''OsIPT5''
|[[Os07g0211700]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-3
|''OsIPT4''
|[[Os03g0810100]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-4
|''OsIPT2''
|[[Os03g0356900]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-5
|''OsIPT8''
|[[Os01g0688300]]
|10.1104/pp.106.085811
|
|Finished
|-
|705-6
|''OsIPT10''
|[[Os06g0729800]]
|10.1104/pp.106.085811
|
|Finished
|-
|706
|''OsRAN2''
|[[Os05g0574500]]
|10.1111/j.1365-3040.2010.02225.x
|
|Annotated
|-
|707
|''OsHDT1''
|[[Os05g0597100]]
|10.1371/journal.pone.0021789
|
|Annotated
|-
|708
|''OsDREB1C''
|[[Os06g0127100]]
|10.1093/pcp/pci230
|
|Annotated
|-
|709
|''OsENOD93-1''
|[[Os06g0142350]]
|10.1111/j.1365-3040.2009.02032.x
|
|Annotated
|-
|710
|''OsPTF1''
|[[Os06g0193400]]
|10.1104/pp.105.063115
|
|Annotated
|-
|711
|''bu1''
|[[Os06g0226500]]
|10.1104/pp.109.140806
|
|Finished
|-
|712
|''HOX1a''
|[[Os06g0229300]]
|10.1111/j.1744-7909.2011.01075.x
|
|Finished
|-
|713
|''OsGLK1''
|[[Os06g0348800]]
|10.1093/pcp/pcp138
|
|Annotated
|-
|714-1
|''OsHDAC1''
|[[Os06g0583400]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|714-2
|''OsHDAC2''
|[[Os02g0215200]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|714-3
|''OsHDAC3''
|[[Os02g0214900]]
|10.1046/j.1365-313X.2003.01650.x
|
|Finished
|-
|715
|''CYP734A4''
|[[Os06g0600400]]
|10.1111/j.1365-313X.2011.04567.x
|
|Finished
|-
|716
|''OsSPX1''
|[[Os06g0603600]]
|10.1111/j.1365-313X.2008.03734.x
|
|Finished
|-
|717
|''OsiSAP8''
|[[Os06g0612800]]
|10.1007/s11103-007-9284-2
|
|Finished
|-
|718
|''OVP1''
|[[Os06g0644200]]
|10.1016/j.plaphy.2010.09.014
|
|Finished
|-
|721
|''YK1''
|[[Os06g0651100]]
|10.1023/A:1019275218830
|
|Finished
|-
|722
|''OsPIN2''
|[[Os06g0660200]]
|10.1111/j.1467-7652.2011.00637.x
|
|Finished
|-
|723-1
|''OSH1''
|[[Os03g0727000]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-2
|''OSH15''
|[[Os07g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-3
|''OSH43''
|[[Os03g0771500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-4
|''OSH6''
|[[Os01g0302500]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|723-5
|''OSH71''
|[[Os05g0129700]]
|10.1006/dbio.2000.9624
|
|Finished
|-
|725
|''OsNek3''
|[[Os07g0176600]]
|10.1093/pcp/pcp026
|
|Finished
|-
|726
|''OsNRAMP1''
|[[Os07g0258400]]
|10.1093/jxb/err136
|
|Finished
|-
|727
|''OsPHR2''
|[[Os07g0438800]]
|10.1104/pp.107.111443
|
|Finished
|-
|728
|''CrtintP1''
|[[Os07g0498800]]
|10.1007/s00438-007-0220-6
|
|Finished
|-
|729
|''GH3-8''
|[[Os07g0592600]]
|10.1105/tpc.107.055657
|
|Finished
|-
|730
|''OsMADS18''
|[[Os07g0605200]]
|10.1104/pp.104.045039
|
|Finished
|-
|731
|''OsNHX1''
|[[Os07g0666900]]
|10.1093/pcp/pch014
|
|Finished
|-
|733
|''OsGAPC3''
|[[Os08g0126300]]
|10.1007/s11240-011-9950-6
|
|Finished
|-
|735
|''OsDOG''
|[[Os08g0504700]]
|10.1016/j.jplph.2010.12.013
|
|Finished
|-
|737
|''OsCPK21''
|[[Os08g0540400]]
|10.1007/s11103-010-9717-1
|
|Finished
|-
|740
|''OsCO3''
|[[Os09g0240200]]
|10.1007/s00425-008-0742-0
|
|Finished
|-
|741
|''OsWRKY76''
|[[Os09g0417600]]
|10.1007/s12284-010-9039-6
|
|Finished
|-
|743
|''OsbZIP72''
|[[Os09g0456200]]
|10.1007/s00425-008-0857-3
|
|Finished
|-
|744
|''OsEATB''
|[[Os09g0457900]]
|10.1104/pp.111.179945
|
|Finished
|-
|745
|''Oshox4''
|[[Os09g0470500]]
|10.1007/s11103-007-9270-8
|
|Finished
|-
|746
|''OsTFX1''
|[[Os09g0474000]]
|10.1073/pnas.0701742104
|
|Finished
|-
|747
|''RF2a''
|[[Os09g0516200]]
|10.1073/pnas.0810303105
|
|Finished
|-
|748
|''OsDREB1B''
|[[Os09g0522000]]
|10.1093/pcp/pci230
|
|Finished
|-
|749
|''OsDREB1A''
|[[Os09g0522200]]
|10.1093/pcp/pci230
|
|Finished
|-
|750
|''OsPIP2;7''
|[[Os09g0541000]]
|10.1093/pcp/pcn166
|
|Finished
|-
|751
|''SAUR39''
|[[Os09g0545300]]
|10.1104/pp.109.143875
|
|Finished
|-
|753-1
|''OsSPX1''
|[[Os06g0603600]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753-2
|''OsSPX2''
|[[Os02g0202200]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX3''
|[[Os10g0392600]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX4''
|[[Os03g0827500]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX5''
|[[Os03g0406100]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|753
|''OsSPX6''
|[[Os07g0614700]]
|10.1111/j.1744-7909.2009.00834.x
|
|Annotated
|-
|754
|''OsiICK6''
|[[Os10g0471700]]
|10.1093/aob/mcr057
|
|Finished
|-
|755
|''OsMADS56''
|[[Os10g0536100]]
|10.1111/j.1365-3040.2009.02008.x
|
|Finished
|-
|756
|''MYBS3''
|[[Os10g0561400]]
|10.1104/pp.110.153015
|
|Annotated
|-
|757
|''OsMSRA4.1''
|[[Os10g0563600]]
|10.1007/s00425-009-0934-2
|
|Annotated
|-
|758
|''Rir1b''
|[[Os10g0569400]]
|10.1023/A:1006423232753
|
|Finished
|-
|759
|''WOX3''
|[[Os11g0102100]]
|10.1104/pp.107.095737
|
|Annotated
|-
|760
|''OsCIPK15''
|[[Os11g0113700]]
|10.1104/pp.107.101295
|
|Finished
|-
|761
|''OsNAC10''
|[[Os11g0126900]]
|10.1104/pp.110.154773
|
|Finished
|-
|762
|''ONAC045''
|[[Os11g0127600]]
|10.1016/j.bbrc.2008.12.163
|
|Finished
|-
|763
|''RCN1''
|[[Os11g0152500]]
|10.1046/j.1365-313X.2002.01255.x
|
|Annotated
|-
|764
|''OsAsr1''
|[[Os11g0167800]]
|10.1007/s10059-009-0055-6
|
|Annotated
|-
|765-1
|''OsPR4a''
|[[Os11g0592200]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-2
|''OsPR4b''
|[[Os11g0592100]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-3
|''OsPR4c''
|[[Os11g0592000]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-4
|''OsPR4d''
|[[Os11g0591800]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|765-5
|''OsPR4e''
|[[Os11g0592200]]
|10.1016/j.jplph.2011.07.013
|
|Finished
|-
|766
|''OsMT1a''
|[[Os11g0704500]]
|10.1007/s11103-009-9466-1
|
|Finished
|-
|767
|''OsWAK1''
|[[Os11g0690066]]
|10.1007/s11103-008-9430-5
|
|Annotated
|-
|768
|''ZFP252''
|[[Os12g0583700]]
|10.1016/j.febslet.2008.02.052
|
|Finished
|-
|769
|''OsPID''
|[[Os12g0614600]]
|10.1093/pcp/pcm024
|
|Finished
|-
|771
|''OsTLP27''
|[[Os01g0102300]]
|10.1016/j.plantsci.2012.06.006
|
|Finished
|-
|772
|''OsHsp17.0''
|[[Os01g0136200]]
|10.1016/j.jplph.2011.12.014
|
|Finished
|-
|775
|''OsMKK6''
|[[Os01g0510100]]
|10.1016/j.jplph.2011.11.012
|
|Finished
|-
|776
|''OsRDR6''
|[[Os01g0527600]]
|10.1111/j.1365-313X.2012.05001.x
|
|Finished
|-
|777
|''RAD51C''
|[[Os01g0578000]]
|10.1093/jxb/ers190
|
|Finished
|-
|779
|''CFO1''
|[[Os01g0726400]]
|10.1104/pp.112.200980
|
|Finished
|-
|780
|''OsPAP10a''
|[[Os01g0776600]]
|10.1111/j.1744-7909.2012.01143.x
|
|Finished
|-
|782
|''OsCOI1''
|[[Os01g0853400]]
|10.1371/journal.pone.0036214
|
|Finished
|-
|783
|''OsMGT1''
|[[Os01g0869200]]
|10.1104/pp.112.199778
|
|Finished
|-
|784
|''PsbS''
|[[Os01g0869800]]
|10.1111/j.1365-313X.2012.04995.x
|
|Finished
|-
|785
|''OsHPL3''
|[[Os02g0110200]]
|10.1111/j.1365-313X.2012.05027.x
|
|Finished
|-
|786
|''MADS29''
|[[Os02g0170300]]
|10.1105/tpc.111.094854
|
|Finished
|-
|787
|''MTR1''
|[[Os02g0491300]]
|10.1016/j.devcel.2012.04.011
|
|Finished
|-
|788
|''cry1a''
|[[Os02g0573200]]
|10.1093/pcp/pcs097
|
|Finished
|-
|788-2
|''cry1b''
|[[Os04g0452100]]
|10.1093/pcp/pcs097
|
|Finished
|-
|789
|''OsABC1-2''
|[[Os02g0575500]]
|10.1016/j.gene.2012.02.017
|
|Finished
|-
|791
|''OsHk6''
|[[Os02g0738400]]
|10.1093/pcp/pcs079
|
|Finished
|-
|1227
|''OsHk3''
|[[Os01g0923700]]
|10.1093/pcp/pcs079
|
|Finished
|-
|1228
|''OsHk4''
|[[Os03g0717700]]
|10.1093/pcp/pcs079
|
|Finished
|-
|792
|''D50''
|[[Os02g0477700]]
|10.1111/j.1365-3040.2012.02534.x
|
|Finished
|-
|793
|''th1''
|[[Os02g0811000]]
|10.1007/s11103-011-9868-8
|Annotated
|
|-
|794
|''osdrm2''
|[[Os03g0110800]]
|10.1111/j.1365-313X.2012.04974.x
| Targeted disruption of an orthologue of DOMAINS REARRANGED METHYLASE 2, OsDRM2, impairs the growth of rice plants by abnormal DNA methylation
|
|-
|795
|''te''
|[[Os03g0123300]]
|10.1038/ncomms1716
|
|Finished
|-
|796
|''OsMYB2''
|[[Os03g0315400]]
|10.1093/jxb/err431
|The rice Os03g0315400 was reported as OsMYB2 in 2012 [1] by researchers from China.
|
|-
|797
|''OsCam1-1''
|[[Os03g0319300]]
|10.1007/s12374-011-0154-8
| The rice Os03g0319300 was reported as OsCam1-1 in 2012 [1] by researchers from Thailand.
|
|-
|798
|''OsLEA3-2''
|[[Os03g0322900]]
|10.1371/journal.pone.0045117
| OsLEA3-2, an Abiotic Stress Induced Gene of Rice Plays a Key Role in Salt and Drought Tolerance
|
|-
|800
|''ysa''
|[[Os03g0597200]]
|10.1104/pp.112.195081
|
|Disruption of a Rice Pentatricopeptide Repeat Protein Causes a Seedling-Specific Albino Phenotype and Its Utilization to Enhance Seed Purity in Hybrid Rice Production
|-
|801
|''OsSh1''
|[[Os03g0650000]]
|10.1038/ng.2281
| Parallel domestication of the Shattering1 genes in cereals
|
|-
|802
|''OsSWAP70A''
|[[Os03g0666200]]
|10.1111/j.1365-313X.2011.04874.x
|Annotated
|
|-
|803
|''OsDDM1b''
|[[Os03g0722400]]
|10.1007/s00438-012-0717-5
| DDM1 (Decrease in DNA Methylation) genes in rice (Oryza sativa)
|
|-
|804
|''OsDDM1a''
|[[Os09g0442700]]
|10.1007/s00438-012-0717-5
| DDM1 (Decrease in DNA Methylation) genes in rice (Oryza sativa)
|
|-
|806
|''OsPIL1''
|[[Os03g0782500]]
|10.1073/pnas.1207324109
|Annotated
|
|-
|807
|''gh1''
|[[Os03g0819600]]
|10.1007/s00425-012-1598-x
| A mutation in the rice chalcone isomerase gene causes the golden hull and internode 1 phenotype
|
|-
|808
|''OsPT1''
|[[Os03g0150600]]
|10.1104/pp.112.196345
|A Constitutive Expressed Phosphate Transporter, OsPht1;1, Modulates Phosphate Uptake and Translocation in Phosphate-Replete Rice
|
|-
|810
|''OsVIT1''
|[[Os04g0463400]]
|10.1111/j.1365-313X.2012.05088.x
| Annotated
|
|-
|811
|''YSL16''
|[[Os04g0542800]]
|10.1105/tpc.112.103820
| Annotated
|
|-
|812
|''cZOGT1''
|[[Os04g0556500]]
|10.1104/pp.112.196733
| Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|-
|813
|''cZOGT2''
|[[Os04g0556600]]
|10.1104/pp.112.196733
|Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|
|-
|1026
|''cZOGT3''
|[[Os04g0565400]]
|10.1104/pp.112.196733
| Cytokinin Activity of cis-Zeatin and Phenotypic Alterations Induced by Overexpression of Putative cis-Zeatin-O-glucosyltransferase in Rice
|
|-
|814
|''xiao''
|[[Os04g0576900]]
|10.1111/j.1365-313X.2011.04877.x
|XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassino steroids and cell cycling in rice
|
|-
|815
|''MPR25''
|[[Os04g0602600]]
|10.1111/j.1365-313X.2012.05091.x
| Annotated
|
|-
|816
|''shat1''
|[[Os04g0649100]]
|10.1105/tpc.111.094383
| Genetic Control of Seed Shattering in Rice by the APETALA2 Transcription Factor SHATTERING ABORTION1
|
|-
|817
|''SLAC1''
|[[Os04g0674700]]
|10.1093/jxb/ers216
| Increased leaf photosynthesis caused by elevated stomatal conductance in a rice mutant deficient in SLAC1, a guard cell anion channel protein
|
|-
|819
|''OsMYB2P-1 1''
|[[Os05g0140100]]
|10.1104/pp.112.194217
| OsMYB2P-1, an R2R3 MYB Transcription Factor, Is Involved in the Regulation of Phosphate-Starvation Responses and Root Architecture in Rice
|
|-
|820
|''OsSYP71''
|[[Os05g0553700]]
|10.1016/j.gene.2012.05.011
| Overexpression of the Qc-SNARE gene OsSYP71 enhances tolerance to oxidative stress and resistance to rice blast in rice
|
|-
|821
|''HDT701''
|[[Os05g0597100]]
|10.1105/tpc.112.101972
| HDT701, a Histone H4 Deacetylase, Negatively Regulates Plant Innate Immunity by Modulating Histone H4 Acetylation of Defense-Related Genes in Rice
|
|-
|822
|''OsELF3-1''
|[[Os06g0142600]]
|10.1371/journal.pone.0043705
| Annotated
|
|-
|823
|''Hd17''
|[[Os06g0142600]]
|10.1093/pcp/pcs028
| Natural Variation in Hd17, a Homolog of Arabidopsis ELF3 That is Involved in Rice Photoperiodic Flowering
|-
|825
|''LYP6''
|[[Os06g0208800]]
|10.1105/tpc.112.102475
| Annotated
|
|-
|826
|''OsbZIP46''
|[[Os06g0211200]]
|10.1104/pp.111.190389
| Constitutive Activation of Transcription Factor OsbZIP46 Improves Drought Tolerance in Rice
|
|-
|830
|''RPL1''
|[[Os06g0245600]]
|10.1093/mp/ssr091
| RPL1, a Gene Involved in Epigenetic Processes Regulates Phenotypic Plasticity in Rice
|
|-
|831
|''OsHSBP2''
|[[Os06g0274000]]
|10.1093/jxb/ers245
| Functional analysis of OsHSBP1 and OsHSBP2 revealed
|-
|1027
|''OsHSBP1''
|[[Os09g0375100]]
|10.1093/jxb/ers245
| Functional analysis of OsHSBP1 and OsHSBP2 revealed
|-
|832
|''OsMIOX''
|[[Os06g0561000]]
|10.1016/j.plantsci.2012.08.003
| Annotated
|
|-
|833
|''SE5''
|[[Os06g0603000]]
|10.1007/s11103-012-9945-7
| Annotated
|
|-
|834
|''OsCOM1''
|[[Os06g0613400]]
|10.1111/j.1365-313X.2012.05025.x
| The role of OsCOM1 in homologous chromosome synapsis and recombination in rice meiosis
|
|-
|835
|''OsbZIP52/RISBZ5''
|[[Os06g0662200]]
|10.1007/s00425-011-1564-z
| Annotated
|
|-
|836
|''SRL1''
|[[Os07g0102300]]
|10.1104/pp.112.199968
| Annotated
|
|-
|837
|''MADS15''
|[[Os07g0108900]]
|10.1105/tpc.112.097105
| Annotated
|
|-
|840
|''OsSWAP70B''
|[[Os07g0138100]]
|10.1111/j.1365-313X.2011.04874.x
| SWAP70 functions as a Rac/Rop guanine nucleotide-exchange factor in rice
|
|-
|841
|''spl5''
|[[Os07g0203700]]
|10.1007/s11032-011-9677-4
| SPL5, a cell death and defense-related gene, encodes a putative splicing factor 3b subunit 3 (SF3b3) in rice
|
|-
|842
|''Nramp5''
|[[Os07g0257200]]
|10.1105/tpc.112.096925
| Annotated
|
|-
|843
|''OsCHR4''
|[[Os07g0497000]]
|10.1007/s00425-012-1667-1
| Molecular cloning and characterization of OsCHR4, a rice chromatin-remodeling factor required for early chloroplast development in adaxial mesophyll
|
|-
|844
|''chr729''
|[[Os07g0497100]]
|10.1073/pnas.1203148109
| CHD3 protein recognizes and regulates methylated histone H3 lysines 4 and 27 over a subset of targets in the rice genome
|
|-
|845
|''OSRIP18''
|[[Os07g0556800]]
|10.1007/s11248-011-9568-9
| Annotated
|
|-
|846
|''ObgC''
|[[Os07g0669200]]
|10.1111/j.1365-313X.2012.04976.x
| Functional characterization of ObgC in ribosome biogenesis during chloroplast development
|
|-
|847
|''cslf6''
|[[Os08g0160500]]
|10.1104/pp.112.195495
| Loss of Cellulose Synthase-Like F6 Function Affects Mixed-Linkage Glucan Deposition, Cell Wall Mechanical Properties, and Defense Responses in Vegetative Tissues of Rice
|
|-
|848
|''OsLIS-L1''
|[[Os08g0162100]]
|10.1007/s00425-011-1532-7
| Annotated
|
|-
|851
|''WRKY30''
|[[Os08g0499300]]
|10.1007/s00425-012-1668-0
| Annotated
|
|-
|852
|''Orysa;CDKB2;1''
|[[Os08g0512600]]
|10.1111/j.1365-313X.2011.04847.x
| CDKB2 is involved in mitosis and DNA damage response in rice
|
|-
|853
|''qGW8''
|[[Os08g0531600]]
|10.1038/ng.2327
| Annotated
|
|-
|854
|''SDG724''
|[[Os09g0307800]]
|10.1105/tpc.112.101436
| Annotated
|
|-
|856
|''OsVIT2''
|[[Os09g0396900]]
|10.1111/j.1365-313X.2012.05088.x
| Annotated
|
|-
|857
|''OsDDM1a''
|[[Os09g0442700]]
|10.1007/s00438-012-0717-5
| Annotated
|
|-
|858
|''LYP4''
|[[Os09g0452200]]
|10.1105/tpc.112.102475
| Annotated
|
|-
|859
|''BC15/OsCTL1''
|[[Os09g0494200]]
|10.1104/pp.112.195529
|Annotated
|
|-
|860
|''LGD1''
|[[Os09g0502100]]
|10.1111/j.1365-313X.2012.04989.x
|Annotated
|
|-
|861
|''BSR1''
|[[Os09g0533600]]
|10.1111/j.1467-7652.2010.00568.x
|Screening for resistance against Pseudomonas syringae in rice-FOX Arabidopsis lines identified a putative receptor-like cytoplasmic kinase gene that confers resistance to major bacterial and fungal pathogens in Arabidopsis and rice.
|Resistance
|-
|862
|''OsLDC-like 1''
|[[Os09g0547500]]
|10.1007/s10059-012-0067-5
|Increased Polyamine Biosynthesis Enhances Stress Tolerance by Preventing the Accumulation of Reactive Oxygen Species: T-DNA Mutational Analysis of Oryza sativa Lysine Decarboxylase-like Protein 1
|
|-
|863
|''OsDEES1''
|[[Os09g0561600]]
|10.1104/pp.112.203943
|Annotated
|
|-
|864
|''OsFbx352''
|[[Os10g0127900]]
|10.1093/jxb/ers206
|Annotated
|
|-
|865
|''rl14''
|[[Os10g0558900]]
|10.1111/j.1467-7652.2012.00679.x
|Annotated
|
|-
|866
|''ospk1''
|[[Os11g0148500]]
|10.1007/s11105-011-0386-2
| Downregulation of OsPK1 Contributes to Oxidative Stress and the Variations in ABA/GA Balance in Rice
|
|-
|867
|''MIL2''
|[[Os12g0152500]]
|10.1111/j.1469-8137.2012.04270.x
| MIL2 (MICROSPORELESS2) regulates early cell differentiation in the rice anther
|
|-
|868
|''PSTOL1''
|[[BAK26566]]
|10.1038/nature11346
|
|-
|869
|''p/tms12-1''
|[[smRNA615912]]
|10.1038/cr.2012.28
|
|-
|870
|''OsHsp23.7''
|[[Os12g0569700]]
|10.1016/j.jplph.2011.12.014
| Annotated
|
|-
|871
|''Amy1A''
|[[Os02g0765600]]
|10.1111/j.1467-7652.2012.00741.x
| Annotated
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|872
|''Amy2A''
|[[Os06g0713800]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|873
|''Amy3A''
|[[Os09g0457400]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|874
|''Amy3B''
|[[Os09g0457600]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1236
|''Amy3C''
|[[Os09g0457800]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1237
|''Amy3D''
|[[Os08g0473900]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|1238
|''Amy3E''
|[[Os08g0473600]]
|10.1111/j.1467-7652.2012.00741.x
|Suppression of a-amylase genes improves quality of rice grain ripened under high temperature
|
|-
|875
|''ylc1''
|[[Os09g0380200]]
|10.1007/s00425-012-1756-1
| Young Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lu
|
|-
|878
|''OsIAGLU''
|[[Os03g0693600]]
|10.1007/s12374-012-0238-0
| Tiller Formation in Rice is Altered by Overexpression of OsIAGLU Gene Encoding an IAA-conjugating Enzyme or Exogenous Treatment of Free IAA
|
|-
|879
|''OsOAT''
|[[Os03g0643300]]
|10.1016/j.plantsci.2012.09.002
| Annotated
|
|-
|1230
|''OsAPS1''
|[[Os09g0298200]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1231
|''OsAPS2''
|[[Os08g0345800]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1232
|''OsAGPL1''
|[[Os03g0735000]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1234
|''OsAPL3''
|[[Os05g0580000]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|1235
|''OsAPL4''
|[[Os07g0243200]]
|10.1071/FP12186
| Gene Expression of ADP-glucose Pyrophosphorylase and Starch Contents in Rice Cultured Cells are Cooperatively Regulated by Sucrose and ABA
|
|-
|881
|''OsGH3-2''
|[[Os01g0764800]]
|10.1093/jxb/ers300
| Annotated
|
|-
|882
|''OsDMI3''
|[[Os05g0489900]]
|10.1093/mp/sss068
|
|Annotated
|-
|883
|''Psi?LDMAR''
|[[Os12g0545900]]
|10.1093/mp/sss095
| Annotated
|
|-
|884
|''OsJAZ8''
|[[Os09g0439200]]
|10.1093/pcp/pcs145
| Annotated
|
|-
|885
|''Osj10gBTF3''
|[[Os10g0483000]]
|10.1093/pcp/pcs146
| Inhibition of a Basal Transcription Factor 3-Like Gene Osj10gBTF3 in Rice Results in Significant Plant Miniaturization and Typical Pollen Abortion
|
|-
|886
|''LPA1''
|[[Os03g0237250]]
|10.1104/pp.112.208496
| Annotated
|
|-
|887
|''PT11''
|[[Os01g0657100]]
|10.1105/tpc.112.104901
| Nonredundant Regulation of Rice Arbuscular Mycorrhizal Symbiosis by Two Members of the PHOSPHATE TRANSPORTER1 Gene Family
|
|-
|888
|''PT13''
|[[ Os04g0186800]]
|10.1105/tpc.112.104901
| Nonredundant Regulation of Rice Arbuscular Mycorrhizal Symbiosis by Two Members of the PHOSPHATE TRANSPORTER1 Gene Family
|
|-
|889
|''OsMYB55''
|[[Os05g0553400]]
|10.1371/journal.pone.0052030
| Annotated
|
|-
|890
|''DDF1''
|[[Os06g0138700]]
|10.1111/j.1365-313X.2012.05126.x
|Dwarf and deformed flower 1, encoding an F‐box protein, is critical for vegetative and floral development in rice (Oryza sativa L.)
|
|-
|891
|''OsPIN3t''
|[[Os01g0643300]]
|10.1111/j.1365-313X.2012.05121.x
| Annotated
|
|-
|892
|''OsbHLH133''
|[[Os12g0508500]]
|10.1111/j.1365-3040.2012.02569.x
| Identification of OsbHLH133 as a regulator of iron distribution between roots and shoots in Oryza sativa
|
|-
|893
|''PGR5''
|[[Os08g0566600]]
|10.1093/pcp/pcs153
| PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice
|
|-
|894
|''OsNRT2.3a''
|[[Os01g0704100]]
|10.1104/pp.112.204461
| Annotated
|
|-
|895
|''bls1''
|[[Os02g0811000]]
|10.1007/s11105-012-0480-0
| BEAK LIKE SPIKELET1 is Required for Lateral Development of Lemma and Palea in Ri
|
|-
|896
|''UIP1''
|[[Os02g0818000]]
|10.1007/s11816-012-0239-y
| Transgenic overexpression of UIP1, an interactor of the 3 0 untranslated region of the Rubisco small subunit mRNA, increases rice tolerance to drought
|
|-
|897
|''OrbHLH001''
|[[Os01g0928000]]
|10.1016/j.jplph.2012.08.019
| Annotated
|
|-
|898
|''CSA''
|[[Os01g0274800]]
|10.1073/pnas.1213041110
|Annotated
|
|-
|899
|''qGL3''
|[[Os03g0646900]]
|10.1073/pnas.1219776110
|Annotated
|
|-
|900
|''OsPPKL2''
|[[Os05g0144400]]
|10.1073/pnas.1219776110
| Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice
|
|-
|901
|''OsPPKL3''
|[[Os12g0617900]]
|10.1073/pnas.1219776110
| Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice
|
|-
|902
|''OsSRO1c''
|[[Os03g0230300]]
|10.1093/jxb/ers349
|
* Annotated
|-
|903
|''OsGT1''
|[[Os01g0262600]]
|10.1104/pp.112.210948
|
* Annotated
|-
|904
|''FIE1''
|[[Os08g0137250]]
|10.1105/tpc.112.102269
|
* Annotated
|-
|905
|''APIP6''
|[[Os05g0154600]]
|10.1105/tpc.112.105429
| The Magnaporthe oryzae Effector AvrPiz-t Targets the RING E3 Ubiquitin Ligase APIP6 to Suppress Pathogen Associated Molecular Pattern–Triggered Immunity in Rice
|
|-
|906
|''BRK1''
|[[Os07g0508500]]
|10.1105/tpc.112.105874
| BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis
|
|-
|907
|''OsARG''
|[[Os04g0106300]]
|10.1111/j.1365-313x.2012.05122.x
|
* Annotated
|-
|908
|''DEC''
|[[Os12g0465700]]
|10.1111/j.1365-313x.2012.05123.x
| Rice DECUSSATE controls phyllotaxy by affecting the cytokinin signaling pathway
|
|-
|909
|''OsIDD10''
|[[Os04g0566400]]
|10.1111/nph.12075
| Regulatory role of indeterminate domain 10 (IDD10) in ammonium-dependent gene expression in rice roots
|
|-
|910
|''OsARF16''
|[[Os06g0196700]]
|10.1111/pce.12001
|
* Annotated
|-
|911
|''OsMADS29''
|[[Os02g0170300]]
|10.1371/journal.pone.0051435
|
|Annotated
|-
|912
|''OsPDCD5''
|[[Os05g0547850]]
|10.1007/s11032-012-9793-9
|
|Annotated
|-
|913
|''OsCDPK1''
|[[Os03g0128700]]
|10.1007/s11103-012-0006-z
|
|Annotated
|-
|914
|''PDA1''
|[[Os06g0607700]]
|10.1007/s12374-013-0902-z
|
|Annotated
|-
|915
|''JMJ703''
|[[Os05g0196500]]
|10.1073/pnas.1217020110
|
|Annotated
|-
|916
|''OsVIL2''
|[[Os02g0152500]]
|10.1111/tpj.12057
| OsVIL2 functions with PRC2 to induce flowering by repressing OsLFL1 in rice
|
|-
|917
|''AIP1''
|[[Os01g0125800]]
|10.1111/tpj.12065
| Oryza sativa actin-interacting protein 1 is required for rice growth by promoting actin turnover
|
|-
|918
|''Xb25''
|[[Os09g0513000]]
|10.1111/tpj.12076
| The XA21 binding protein XB25 is required for maintaining XA21-mediated disease resistance
|
|-
|919
|''DTH2''
|[[Os02g0724000]]
|10.1073/pnas.1213962110
|
|Annotated
|-
|920
|''reg1''
|[[Os03g0786400]]
|10.1073/pnas.1300359110
|
|Annotated
|-
|924
|''fgl''
|[[Os10g0496900]]
|10.1111/tpj.12110
|
|Annotated
|-
|925
|''Ehd4''
|[[Os03g0112700]]
|10.1371/journal.pgen.1003281
|
|Annotated
|-
|926
|''GnTI''
|[[Os02g0833000]]
|10.1111/tpj.12087
| N-glycan maturation is crucial for cytokinin-mediated development and cellulose synthesis in Oryza sativa
|
|-
|927
|''OsFH1''
|[[Os01g0897700]]
|10.1007-s00425-013-1838-8
|
|Annotated
|-
|928
|''moc2''
|[[Os01g0866400]]
|10.5511/plantbiotechnology.12.1210a
| Rice monoculm mutation moc2, which inhibits outgrowth of the second tillers, is ascribed to lack of a fructose-1,6-bisphosphatase
|
|-
|929
|''OsHsfA7''
|[[Os01g0571300]]
|10.5483/BMBRep.2013.46.1.090
|
|Annotated
|-
|930
|''OsPIANK1''
|[[Os11g0182500]]
|10.1371/journal.pone.0059699
| Functional Analysis and Expressional Characterization of Rice Ankyrin Repeat-Containing Protein, OsPIANK1, in Basal Defense against Magnaporthe oryzae Attack
|
|-
|931
|''OsFIE2''
|[[Os08g0137100]]
|10.1371/journal.pgen.1003322
|
|Annotated
|-
|933
|''OsORC3''
|[[Os10g0402200]]
|10.1111/tpj.12126
| OsORC3 is required for lateral root development in rice
|
|-
|934
|''OsAOC''
|[[Os03g0438100]]
|10.1111/tpj.12115
| Identification of rice Allene Oxide Cyclase mutants and the function of jasmonate for defence against Magnaporthe oryzae
|
|-
|935
|''OsSNDP1''
|[[Os10g0122600]]
|10.1007-s11103-013-0033-4
| OsSNDP1, a Sec14-nodulin domain-containing protein, plays a critical role in root hair elongation in rice
|
|-
|936
|''OsRP1L1''
|[[Os05g0365300]]
|10.1007-s11105-012-0537-0
|
|Annotated
|-
|937
|''OsVPS22''
|[[Os09g0529700]]
|10.1007/s11033-012-2422-1
| Knockout of the VPS22 component of the ESCRT-II complex in rice (Oryza sativa L.) causes chalky endosperm and early seedling lethality
|
|-
|938
|''OsTZF1''
|[[Os05g0195200]]
|10.1104/pp.112.205385
|
|Annotated
|-
|939
|''OsAt10''
|[[Os06g0594700]]
|10.1104/pp.112.208694
| Overexpression of a BAHD Acyltransferase, OsAt10, Alters Rice Cell Wall Hydroxycinnamic Acid Content and Saccharification
|
|-
|940
|''Cga1''
|[[Os02g0220400]]
|10.1104/pp.113.217265
|
|Annotated
|-
|941
|''nal2''
|[[Os11g0102100]]
|10.1111/nph.12231
| A WUSCHEL-LIKE HOMEOBOX Gene Represses a YABBY Gene Expression Required for Rice Leaf Development
|
|-
|942
|''nal3''
|[[Os12g0101600]]
|10.1111/nph.12231
|
|Annotated
|-
|943
|''OsPTR9''
|[[Os06g0706400]]
|10.1111/pbi.12031
|
|Annotated
|-
|944
|''OsDHAR1''
|[[Os05g0116100]]
|10.1007/s00425-013-1862-8
| Homologous expression of cytosolic dehydroascorbate reductase increases grain yield and biomass under paddy field conditions in transgenic rice
|
|-
|945
|''ASR1''
|[[Os11g0167800]]
|10.1007/s10059-013-0036-7
|
|Annotated
|-
|946
|''ASR3''
|[[Os02g0543000]]
|10.1007/s10059-013-0036-7
| Abiotic Stress Responsive Rice ASR1 and ASR3 Exhibit Different Tissue-Dependent Sugar and Hormone-Sensitivities
|
|-
|947
|''OsDIL1''
|[[Os10g0148000]]
|10.1007/s11103-013-0057-9
|
|Annotated
|-
|948
|''SLL1''
|[[Os04g0379900]]
|10.1016/j.plantsci.2013.01.003
| SLL1, which encodes a member of the stearoyl-acyl carrier protein fatty acid desaturase family, is involve
|
|-
|949
|''Oscyp71Z2''
|[[Os07g0217600]]
|10.1016/j.plantsci.2013.02.005
| Oscyp71Z2 involves diterpenoid phytoalexin biosynthesis that contributes to bacterial blight resistance in rice
|
|-
|950
|''OsGPX3''
|[[Os02g0664000]]
|10.1016/j.plantsci.2013.03.017
|The mitochondrial glutathione peroxidase GPX3 is essential for H 2 O 2 homeostasis and root and shoot development in rice
|
|-
|951
|''OsGS1;2''
|[[Os03g0223400]]
|10.1093/pcp/pct046
|
|Annotated
|-
|952
|''MSF1''
|[[Os05g0497200]]
|10.1104/pp.113.216044
|Annotated
|
|-
|953
|''CAP1''
|[[Os02g0141300]]
|10.1104/pp.113.216523
|
|Annotated
|-
|954
|''glup6''
|[[Os03g0262900]]
|10.1104/pp.113.217869
|Annotated
|
|-
|955
|''OsGDCH''
|[[Os10g0516100]]
|10.1111/pce.12078
| Knockdown of GDCH gene reveals reactive oxygen species-induced leaf senescence in rice
|
|-
|956
|''RGA4''
|[[Os11g0225100]]
|10.1105/tpc.112.107201
|
|Annotated
|-
|957
|''RGA5''
|[[Os11g0225300]]
|10.1105/tpc.112.10720
| The Rice Resistance Protein Pair RGA4/RGA5 Recognizes the Magnaporthe oryzae Effectors AVR-Pia and AVR1-CO39 by Direct Binding
|
|-
|958
|''LOX3''
|[[Os03g0700400]]
|10.1007/s12374-013-0085-7
| Molecular Genetic Characterization of Rice Seed Lipoxygenase 3 and Assessment of Its Effects on Seed Longevity
|
|-
|959
|''Sar1a''
|[[Os01g0338000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|-
|960
|''Sar1b''
|[[Os12g0560300 ]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|961
|''Sar1c''
|[[Os01g0254000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|961
|''Sar1d''
|[[Os06g0225000]]
|10.1093/jxb/ert128
| Small GTPase Sar1 is crucial for proglutelin and α-globulin export from the endoplasmic reticulum in rice endosperm
|
|-
|962
|''vyl''
|[[Os03g0411500]]
|10.1104/pp.113.217604
|
|Annotated
|-
|963
|''SERF1''
|[[Os05g0420300]]
|10.1105/tpc.113.113068
| SALT-RESPONSIVE ERF1 Regulates Reactive Oxygen Species–Dependent Signaling during the Initial Response to Salt Stress in Rice
|
|-
|964
|''dep''
|[[Os05g0118700]]
|10.1186/1939-8433-5-28
|A WUSCHEL-related homeobox 3B gene, depilous (dep), confers glabrousness of rice leaves and glumes
|
|-
|965
|''LC1''
|[[Os01g0785400]]
|10.1093/mp/sss064
|
|
|-
|966
|''TUD1''
|[[Os03g0232600]]
|10.1371/journal.pgen.1003391
|Annotated
|
|-
|967
|''GL3.1''
|[[Os03g0646900]]
|10.1038/cr.2012.151
|
|Annotated
|-
|971
|''Oshox22''
|[[Os04g0541700]]
|10.1007/s11103-012-9967-1
|Annotated
|
|-
|972
|''OsLG1''
|[[Os04g0656500]]
|10.1038/ng.2567
| OsLG1 regulates a closed panicle trait in domesticated rice
|
|-
|973
|''OsMSH5''
|[[Os05g0498300]]
|10.1093/mp/sss145
|Annotated
|
|-
|974
|''ABCG15''
|[[Os06g0607700]]
|10.1093/pcp/pcs162
|Annotated
|
|-
|975
|''TGW6''
|[[Os06g0623700]]
|10.1038/ng.2612
|Loss of function of the IAA-glucose hydrolase gene TGW6 enhances rice grain weight and increases yield
|
|-
|976
|''OsFD2''
|[[Os06g0720900]]
|10.1093/pcp/pct005
| Functional Diversification of FD Transcription Factors in Rice, Components of Florigen Activation Complexes
|Annotated
|-
|127
|''OsFD1''
|[[Os09g0540800]]
|10.1038/nature10272
| Functional Diversification of FD Transcription Factors in Rice, Components of Florigen Activation Complexes
|-
|977
|''OsDGL1''
|[[Os07g0209000]]
|10.1093/pcp/pcs159
| OsDGL1, a Homolog of an Oligosaccharyltransferase Complex Subunit, is Involved in N-Glycosylation and Root Development in Rice
|
|-
|978
|''Rurm1''
|[[Os07g0466300]]
|10.1093/mp/sst042
|Loss-of-Function of a Ubiquitin-Related Modifier Promotes the Mobilization of the Active MITE mPing
|
|-
|979
|''RSS3''
|[[Os11g0446000]]
|10.1105/tpc.113.112052
|
|Annotated
|-
|980
|''OsRecQl4''
|[[Os04g0433800]]
|10.1093/pcp/pcs155
| DNA replication arrest leads to enhanced homologous recombination and cell death in meristems of rice OsRecQl4 mutants
|
|-
|981
|''OsExo1''
|[[Os01g0777300]]
|10.1093/pcp/pcs155
| Rice exonuclease-1 homologue, OsEXO1, that interacts with DNA polymerase k and RPA subunit proteins, is involved in cell proliferation
|
|-
|982
|''OsIRX10''
|[[Os01g0926700]]
|10.1093/mp/sss135
| Inactivation of OsIRX10 Leads to Decreased Xylan Content in Rice Culm Cell Walls and Improved Biomass Saccharification
|
|-
|983
|''OsCpn60α1''
|[[Os12g0277500]]
|10.1007/s10059-013-2337-2
| OsCpn60α1, Encoding the Plastid Chaperonin 60α Subunit, Is Essential for Folding of rbcL
|
|-
|985
|''Dro1''
|[[Os09g0439800]]
|10.1038/ng.2725
|Annotated
|
|-
|986
|''OsSAG12-1''
|[[Os01g0907600]]
|10.1007/s12038-013-9334-7
| Down-regulation of OsSAG12-1 results in enhanced senescence and pathogen-induced cell death in transgenic rice plants
|
|-
|987
|''BGL11(t)''
|[[Os11g0592900]]
|10.1007/s13258-013-0094-4
| Identification and characterization of BGL11(t), a novel gene regulating leaf-color mutation in rice (Oryza sativa L.)
|
|-
|990
|''OsDET1''
|[[Os01g0104600]]
|10.1016/j.plantsci.2013.06.003
| Mutation of OsDET1 increases chlorophyll content in rice
|
|-
|991
|''OsVHA-A''
|[[Os06g0662000]]
|10.1371/journal.pone.0069046
|Annotated
|
|-
|992
|''TIFY11b''
|[[Os03g0181100]]
|10.1271/bbb.120545
| Overexpression of a Rice TIFY Gene Increases Grain Size through Enhanced Accumulation of Carbohydrates in the Stem
|
|-
|994
|''GE''
|[[Os07g0603700]]
|10.1111/tpj.12223
| GIANT EMBRYO encodes CYP78A13, required for proper size balance between embryo and endosperm in rice
|
|-
|999
|''OsAP65''
|[[Os07g0592200]]
|10.1093/jxb/ert173
| OsAP65, a rice aspartic protease, is essential for male fertility and plays a role in pollen germination and pollen tube growth
|
|-
|1000
|''OsbZIP58''
|[[Os07g0182000]]
|10.1093/jxb/ert187
| OsbZIP58, a basic leucine zipper transcription factor, regulates starch biosynthesis in rice endosperm
|
|-
|1001
|''YGL138(t)''
|[[Os11g0153600]]
|10.1186/1939-8433-6-7
| YGL138(t), encoding a putative signal recognition
particle 54 kDa protein, is involved in chloroplast
development of rice
|Development
|-
|1003
|''OsGA20ox3''
|[[Os07g0169700]]
|10.1094/MPMI-05-12-0138-R
| Gibberellin 20-Oxidase Gene OsGA20ox3 Regulates
Plant Stature and Disease Development in Rice
|Stress
|-
|1004
|''Hd16''
|[[Os03g0793500]]
|10.1111/tpj.12268
|
|Annotated
|-
|1005
|''Bh4''
|[[Os04g0460200]]
|10.1104/pp.110.168500
| Genetic Control of a Transition from Black to Straw-White Seed Hull in Rice Domestication
|Development
|-
|1006
|''OsSUV3''
|[[Os03g0746500]]
|10.1111/tpj.12277
|
|Annotated
|-
|1007
|''OsMPS''
|[[Os02g0618400]]
|10.1111/tpj.12286
|
|Annotated
|-
|1008
|''OsCDT3''
|[[Os01g0178300]]
|10.1111/tpj.12296
|A plasma membrane-localized small peptide is involved in rice aluminum tolerance
|Stress
|-
|1009
|''CRC1''
|[[Os04g0479000]]
|10.1105/tpc.113.113175
| CENTRAL REGION COMPONENT1, a Novel Synaptonemal Complex Component, Is Essential for Meiotic Recombination Initiation in Rice
|Development
|-
|1010
|''ASL1''
|[[Os01g0678600]]
|10.1534/g3.113.007856
|Disruption of the Rice Plastid Ribosomal Protein S20 Leads to Chloroplast Developmental Defects and Seedling Lethality
|Development
|-
|1011
|''OsNAP''
|[[Os03g0327800]]
|10.1186/1471-2229-13-132
|
|Annotated
|-
|1012
|''GS6''
|[[Os06g0127800]]
|10.1111/jipb.12062
|
|Annotated
|-
|1013
|''OsHOS1''
|[[Os03g0737200]]
|10.1007/s11103-013-0092-6
| Isolation and characterization of rice (Oryza sativa L.) E3-ubiquitin ligase OsHOS1 gene in the modulation of cold stress response
|Stress
|-
|1014
|''SGRL''
|[[Os04g0692600]]
|10.1016/j.jplph.2013.05.016
|
|The Stay-Green Rice like (SGRL) gene regulates chlorophyll degradation in rice
|-
|1017
|''An-1''
|[[Os04g0350700]]
|10.1105/tpc.113.113589
|
|Annotated
|-
|1018
|''OslecRK''
|[[Os04g0201900]]
|10.1111/tpj.12328
|
|A rice lectin receptor-like kinase that is involved in innateimmune responses also contributes to seed germination
|-
|1020
|''OsVOZ2''
|[[Os05g0515700]]
|10.1371/journal.pone.0073346
|Xanthomonas oryzae pv. oryzae Type III Effector XopN Targets OsVOZ2 and a Putative Thiamine Synthase as a Virulence Factor in Rice
|Stress
|-
|1021
|''OsHsfB2b''
|[[Os08g0546800]]
|10.1007/s00299-013-1492-4
|
|Annotated
|-
|1022
|''OsGRX8''
|[[Os02g0512400]]
|10.1007/s00425-013-1940-y
|Modified expression of an auxin‐responsive rice CC‐type glutaredoxin gene affects multiple abiotic stress responses
| stress
|-
|1023
|''DAO''
|[[Os04g0475600]]
|10.1016/j.devcel.2013.09.005
|
|Annotated
|-
|1024
|''OsHMA5''
|[[Os04g0556000]]
|10.1104/pp.113.226225
|A Member of the Heavy Metal P-Type ATPase OsHMA5 Is Involved in Xylem Loading of Copper in Rice
|Stress
|-
|1025
|''Osoxo4''
|[[Os03g0693700]]
|10.1111/mpp.12055
|
|Rice oxalate oxidase gene driven by green tissue-specific promoter increases tolerance to sheath blight pathogen (Rhizoctonia solani) in transgenic rice
|-
|1026
|''OsSTN8''
|[[Os05g0480000]]
|10.1111/tpj.12331
|
|Loss-of-function of OsSTN8 suppresses the photosystem II core protein phosphorylation and interferes with the photosystem II repair mechanism in rice
|-
|1027
|''OsEXPA8''
|[[Os01g0248900]]
|10.1371/journal.pone.0075997
|
|Overexpression of OsEXPA8, a root-specific gene, improves rice growth and root system architecture by facilitating cell extension
|-
|1028
|''OsPRR37''
|[[Os07g0695100]]
|10.1093/mp/sst088
|
|Natural Variation in OsPRR37 Regulates Heading Date and Contributes to Rice Cultivation at a Wide Range of Latitudes
|-
|1029
|''OsMADS57''
|[[Os02g0731200]]
|10.1038/ncomms2542
|
|Annotated
|-
|1030
|''DWA1''
|[[Os04g0473900]]
|10.1073/pnas.1316412110
|
|Annotated
|-
|1031
|''gpa2''
|[[Os03g0262900]]
|10.1093/mp/sst081
|
|Annotated
|-
|1032
|''MHZ7/OsEIN2''
|[[Os07g0155600]]
|10.1093/mp/sst087
|
|Annotated
|-
|1033
|''YGL2''
|[[Os06g0603000]]
|10.1007/s00299-013-1498-y
|
|Annotated
|-
|1034
|''OsMTP8.1''
|[[Os03g0226400]]
|10.1093/jxb/ert243
|Mn tolerance in rice is mediated by MTP8.1, a member of the cation diffusion facilitator family
|
|-
|1035
|''this1''
|[[Os01g0751600]]
|10.1093/jxb/ert256
| THIS1 is a putative lipase that regulates tillering, plant height, and spikelet fertility in rice
|
|-
|1036
|''OsABCG15''
|[[Os06g0607700]]
|10.1111/jipb.12053
|
|The ATP‐binding Cassette Transporter OsABCG15 is Required for Anther Development and Pollen Fertility in Rice
|-
|1037
|''OsRRMh''
|[[Os09g0516300]]
|10.1111/jipb.12056
| OsRRMh, a Spen-like gene, plays an important role during the vegetative to reproductive transition in rice.
|
|-
|1038
|''OsCTR2''
|[[Os02g0527600]]
|10.1093/jxb/ert272
| Rice CONSTITUTIVE TRIPLE-RESPONSE2 is involved in the ethylene-receptor signalling and regulation of various aspects of rice growth and development
|
|-
|1039
|''OsbZIP71''
|[[Os09g0306400]]
|10.1007/s11103-013-0115-3
|
|Annotated
|-
|1040
|''OsHox33''
|[[Os12g0612700]]
|10.1007/s11427-013-4565-2
|Knockdown of OsHox33, a member of the class III homeodomain-leucine zipper gene family, accelerates leaf senescence in rice
|
|-
|1041
|''OsGAPDHB''
|[[Os03g0129300]]
|10.1016/j.plantsci.2013.09.010
|A proteomic study of rice cultivar TNG67 and its high aroma mutant SA0420.
|
|-
|1042
|''OsAPX7''
|[[Os04g0434800]]
|10.1016/j.plantsci.2013.10.001
| The knockdown of chloroplastic ascorbate peroxidases reveals its regulatory role in the photosynthesis and protection under photo-oxidative stress in rice
|
|-
|1043
|''OsAPX8''
|[[Os02g0553200]]
|10.1016/j.plantsci.2013.10.001
|
|Annotated
|-
|1044
|''OsRNS4''
|[[Os09g0537700]]
|10.1016/j.plantsci.2013.10.003
|
|Annotated
|-
|1045
|''D53''
|[[Os11g0104300]]
|"10.1038/nature12870, 10.1038/nature12878"
|
|Annotated
|-
|1046
|''OsHRZ1''
|[[Os01g0689451]]
|10.1038/ncomms3792
| Iron-binding haemerythrin RING ubiquitin ligases regulate plant iron responses and accumulation
|
|-
|1047
|''OsHRZ2''
|[[Os05g0551000]]
|10.1038/ncomms3792
|Iron-binding haemerythrin RING ubiquitin ligases regulate plant iron responses and accumulation
|
|-
|1048
|''PTB1''
|[[Os05g0145000]]
|10.1038/ncomms3793
| Natural variation in PTB1 regulates rice seed setting rate by controlling pollen tube growth
|
|-
|1050
|''OsBOR4''
|[[Os05g0176800]]
|10.1093/pcp/pct136
|
|Annotated
|-
|1051
|''LYL1''
|[[Os02g0744900]]
|10.1371/journal.pone.0075299
| Mutation of the Light-Induced Yellow Leaf 1 Gene, Which Encodes a Geranylgeranyl Reductase, Affects Chlorophyll Biosynthesis and Light Sensitivity in Rice
|
|-
|1052
|''OsEBS''
|[[Os05g0591400]]
|10.1111/pbi.12097
|Identification and characterization of OsEBS, a gene involved in enhanced plant biomass and spikelet number in rice
|
|-
|1053
|''SOR1''
|[[Os04g0101800]]
|10.1186/1939-8433-6-30
| Isolation of a novel mutant gene for soil-surface rooting in rice (Oryza sativa L.)
|
|-
|1054
|''OsCPK10''
|[[Os03g0788500]]
|10.1016/j.plaphy.2013.10.004
|
|Annotated
|-
|1055
|''JMJ705''
|[[Os01g0907400]]
|10.1105/tpc.113.118802
| Jumonji C Domain Protein JMJ705-Mediated Removal of Histone H3 Lysine 27 Trimethylation Is Involved in Defense-Related Gene Activation in Rice
|Stress
|-
|1056
|''OsCCaMK''
|[[Os05g0489900]]
|10.1128/AEM.03646-13.
| A rice gene for microbial symbiosis, OsCCaMK, reduces CH 4 flux in a paddy field with low nitrogen input
|Stress
|-
|1061
|''LH8''
|[[Os08g0174500]]
|10.1038/srep04263
|
|Annotated
|-
|1063
|''OsTrx1''
|[[Os09g0134500]]
|10.1104/pp.113.228049
| Trithorax group protein Oryza sativa Trithorax1 controls flowering time in rice via interaction with early heading date3
|
|-
|1071
|''RIXI''
|[[Os11g0701800]]
|10.1007/s10658-013-0342-0
| Functional characterization of a new pathogen induced xylanase inhibitor (RIXI) from rice
|
|-
|1072
|''TCD9''
|[[Os09g0563300]]
|10.1016/j.plantsci.2013.11.003
|Importance of the rice TCD9 encoding α subunit of chaperonin protein 60 (Cpn60α) for the chloroplast development during the early leaf stage.
|
|-
|1074
|''OsBURP16''
|[[Os10g0409400]]
|10.1111/pce.12223
| Overexpression of stress-inducible OsBURP16, the β subunit of polygalacturonase 1, decreases pectin content and cell adhesion and increases abiotic stress sensitivity in rice
|
|-
|1075
|''OsDSR2''
|[[Os01g0839200]]
|10.1007/s00299-013-1532-0
|Overexpression of a new stress-repressive gene OsDSR2 encodinga protein with a DUF966 domain increases salt and simulated drought stress sensitivities and reduces ABA sensitivity in rice
|
|-
|1076
|''ssg4''
|[[Os01g0179400]]
|10.1104/pp.113.229591
| Amyloplast-Localized SUBSTANDARD STARCH GRAIN4 Protein Influences the Size of Starch Grains in Rice Endosperm
|
|-
|1080
|''OsAMT1;1''
|[[Os04g0509600]]
|10.1093/jxb/ert458
| AMT1;1 transgenic rice plants with enhanced NH4+ permeability show superior growth and higher yield under optimal and suboptimal NH4+ conditions
|
|-
|1082
|''WLP1''
|[[Os01g0749200]]
|10.1007/s11103-013-0134-0
| The rice nuclear gene WLP1 encoding a chloroplast ribosome L13 protein is needed for chloroplast development in rice grown under low temperature conditions
|
|-
|1083
|''ADH1''
|[[Os11g0210300]]
|10.1093/aob/mct305
|
|Annotated
|-
|1084
|''OsAlba1''
|[[Os01g0173100]]
|10.1016/j.phytochem.2014.01.015
|
|Annotated
|-
|1086
|''OsDCL3a''
|[[Os01g0909200]]
|10.1073/pnas.1318131111
|
|Annotated
|-
|1087
|''SGL''
|[[Os05g0154700]]
|10.1007/s00299-013-1524-0
|
|Annotated
|-
|1088
|''OsHI-XIP''
|[[Os05g0247100]]
|10.1007/s11105-013-0661-5
| Overexpression of a Xylanase Inhibitor Gene, OsHI-XIP, Enhances Resistance in Rice to Herbivore
|
|-
|1089
|''OsZHD1''
|[[Os09g0466400]]
|10.1007/s00425-013-2009-7
|
|Annotated
|-
|1090
|''CYP96B4''
|[[Os03g0140400]]
|10.1371/journal.pone.0088068
| The rice semi-dwarf mutant sd37, caused by a mutation in CYP96B4, plays an important role in the fine-tuning of plant growth.
|
|-
|1092
|''FLO6''
|[[Os03g0686900]]
|10.1111/tpj.12444
| FLOURY ENDOSPERM6 encodes a CBM48 domain-containing protein involved in compound granule formation and starch synthesis in rice endosperm
|
|-
|1093
|''OsKS2''
|[[Os04g0612000]]
|10.1111/plb.12069
|
|Annotated
|-
|1094
|''OsDG2''
|[[Os02g0606000]]
| 10.1007/s00299-013-1549-4
| The rice OsDG2 encoding a glycine-rich protein is involved in the regulation of chloroplast development during early seedling stage
|
|-
|1095
|''Hwi2''
|[[Os01g0795400]]
|10.1038/ncomms4357
|
|A two-locus interaction causes interspecific hybrid weakness in rice
|-
|1222
|''Hwi1''
|[[Os11g0173500]]
|10.1038/ncomms4357
|
|A two-locus interaction causes interspecific hybrid weakness in rice
|-
|1096
|''OsGLO4''
|[[Os07g0152900]]
|10.1111/ppl.12104
| Suppression of glycolate oxidase causes glyoxylate accumulation that inhibits photosynthesis through deactivating Rubisco in rice
|
|-
|1097
|''DL''
|[[Os03g0215200]]
|10.1111/tpj/12411
|
|Annotated
|-
|1098
|''OsETT2''
|[[Os01g0670800]]
|10.1111/tpj/12411
| The DROOPING LEAF and OsETTIN2 genes promote awndevelopment in rice
|
|-
|1099
|''SHL2''
|[[Os01g0527600]]
|10.1111/tpj/12411
| Rice RNA-dependent RNA polymerase 6 acts in small RNA biogenesis and spikelet development.
|
|-
|1100
|''OsLIS''
|[[Os02g0121700]]
|10.1111/pce.12169
| Jasmonate induction of the monoterpene linalool confers resistance to rice bacterial blight and its biosynthesis is regulated by JAZ protein in rice
|
|-
|1101
|''OsPT9''
|[[Os06g0324800]]
|10.1111/pce.12224
|Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in rice.
|
|-
|1102
|''OsPT10''
|[[Os06g0325200]]
|10.1111/pce.12224
| Phosphate transporters OsPHT1;9 and OsPHT1;10 are involved in phosphate uptake in rice.
|
|-
|1106
|''LTG1''
|[[Os02g0622100]]
|10.1111/tpj.12487
| Annotated
|-
|1107
|''OsRPK1''
|[[Os05g0486100]]
|10.1016/j.bbagen.2014.01.003
|
|Annotated
|-
|1108
|''d89''
|[[Os05g0333200]]
|10.1007/s10681-014-1071-y
|
|Annotated
|-
|1112
|''OsEMF2b''
|[[Os09g0306800]]
|10.1007/s11105-014-0733-1
| OsEMF2b Acts as a Regulator of Flowering Transition and Floral Organ Identity by Mediating H3K27me3 Deposition at OsLFL1 and OsMADS4 in Rice
|
|-
|1117
|''OsFIE1''
|[[Os08g0137250]]
|10.1104/pp.113.232413
|
|Annotated
|-
|1118
|''OsUGE1''
|[[Os05g0595100]]
|10.1371/journal.pone.0096158
| Functional Characterization of the Rice UDP-glucose 4- epimerase 1, OsUGE1: A Potential Role in Cell Wall Carbohydrate Partitioning during Limiting Nitrogen Conditions
|
|-
|1119
|''OsATG7''
|[[Os01g0614900]]
|10.4161/auto.28279
| OsATG7 is required for autophagy-dependent lipid metabolism in rice postmeiotic anther development
|
|-
|1120
|''chalk5''
|[[Os05g0156900]]
|10.1038/ng.2923
| Chalk5 encodes a vacuolar H + -translocating pyrophosphatase influencing grain chalkiness in rice
|
|-
|1122
|''cl7(t)''
|[[Os07g0616000]]
|10.1093/jxb/eru074
|Rice DENSE AND ERECT PANICLE 2 is essential for determining panicle outgrowth and elongation
|
|-
|1123
|''OsGPX1''
|[[Os04g0556300]]
|10.1007/s10535-014-0394-9
|Chloroplastic and mitochondrial GPX genes play a critical role in rice development
|
|-
|1124
|''OsGPX4''
|[[Os06g0185900]]
|10.1007/s10535-014-0394-9
| Chloroplastic and mitochondrial GPX genes play a critical role in rice development
|
|-
|1125
|''D1352''
|[[Os03g0232600]]
|10.1007/s11032-014-0021-7
|
|Annotated
|-
|1126
|''OsAHP1''
|[[Os08g0557700]]
|10.1104/pp.113.232629
| Two Rice Authentic Histidine Phosphotransfer Proteins, OsAHP1 and OsAHP2, Mediate Cytokinin Signaling and Stress Responses in Rice
|
|-
|1127
|''OsAHP2''
|[[Os09g0567400]]
|10.1104/pp.113.232629
| Two Rice Authentic Histidine Phosphotransfer Proteins, OsAHP1 and OsAHP2, Mediate Cytokinin Signaling and Stress Responses in Rice
|
|-
|1128
|''OsWR2''
|[[Os06g0604000]]
|10.1007/s11105-013-0687-8
|
|Annotated
|-
|1129
|''Se14''
|[[Os03g0151300]]
|10.1371/journal.pone.0096064
| Se14, Encoding a JmjC Domain-Containing Protein, Plays Key Roles in Long-Day Suppression of Rice Flowering through the Demethylation of H3K4me3 of RFT1
|
|-
|1130
|''MET1b''
|[[Os07g0182900]]
|10.1007/s11103-014-0178-9
|
|Annotated
|-
|1131
|''MET1a''
|[[Os03g0798300]]
|10.1007/s11103-014-0178-9
| Homologous recombination-mediated knock-in targeting of the MET1a gene for a maintenance DNA methyltransferase reproducibly reveals dosage-dependent spatiotemporal gene expression in rice
|
|-
|1133
|''smos1''
|[[Os05g0389000]]
|10.1093/pcp/pcu023
| A Novel AP2-Type Transcription Factor, SMALL ORGAN SIZE1, Controls Organ Size Downstream of an Auxin Signaling Pathway
|
|-
|1135
|''OsCPK4''
|[[Os02g0126400]]
|10.1104/pp.113.230268
|
|Annotated
|-
|1136
|''OsPAD4''
|[[Os11g0195500]]
|10.1111/tpj.12500
| Rice OsPAD4 functions differently from Arabidopsis AtPAD4 in host-pathogen interactions
|
|-
|1137
|''OsMOGS''
|[[Os01g0921200]]
|10.1111/tpj.12497
|
|Annotated
|-
|1138
|''OsJAR1''
|[[Os05g0586200]]
|10.1111/pce.12201
|
|Annotated
|-
|1139
|''OsMADS34''
|[[Os03g0756100]]
|10.1111/nph.12657
|
|Annotated
|-
|1140
|''OsMRP5''
|[[Os03g0142800]]
|10.1007/s11248-014-9792-1
| Seed-specific silencing of OsMRP5 reduces seed phytic acid and weight in rice
|
|-
|1141
|''TMS 9-1(OsMS1)''
|[[Os09g0449000]]
|10.1007/s00122-014-2289-8
|
|Annotated
|-
|1142
|''epsps''
|[[Os06g0133900]]
|10.1111/nph.12428
|A novel 5-enolpyruvoylshikimate-3-phosphate (EPSP) synthase transgene for glyphosate resistance stimulates growth and fecundity in weedy rice (Oryza sativa) without herbicide
|
|-
|1143
|''DWT1''
|[[Os01g0667400]]
|10.1371/journal.pgen.1004154
|
|Annotated
|-
|1144
|''DP2''
|[[Os02g0531600]]
|10.1007/s13258-013-0169-2
| Morphological characteristics and gene mapping of a dense panicle (dp2) mutant in rice (Oryza sativa L.)
|
|-
|1145
|''OsRACK1A''
|[[Os01g0686800]]
|10.1371/journal.pone.0097120
|OsRACK1 Is Involved in Abscisic Acid- and H 2 O 2 - Mediated Signaling to Regulate Seed Germination in Rice (Oryza sativa, L.)
|
|-
|1223
|''OsCAF1A''
|[[Os08g0440300]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1146
|''OsCAF1B''
|[[Os04g0684900]]
|10.1007/s11103-014-0196-7
|
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|-
|1147
|''OsCAF1G''
|[[Os09g0416800]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1148
|''OsCAF1H''
|[[Os02g0796300]]
|10.1007/s11103-014-0196-7
| Divergence of the expression and subcellular localization of CCR4‐associated factor 1 (CAF1) deadenylase proteins in Oryza sativa
|
|-
|1149
|''OsLOX2 (L-2)''
|[[Os03g0738600]]
|10.1007/s11248-014-9803-2
| OsLOX2, a rice type I lipoxygenase, confers opposite effects on seed germination and longevity
|
|-
|1150
|''OsNAC111''
|[[Os10g0177000]]
|10.1094/mpmi-03-14-0065-r
| OsNAC111, a Blast Disease–Responsive Transcription Factor in Rice, Positively Regulates the Expression of Defense-Related Genes
|
|-
|1152
|''OsCKX4''
|[[Os01g0940000]]
|10.1104/pp.114.238584
|
|Annotated
|-
|1155
|''DIF1''
|[[Os01g0626400]]
|10.1371/journal.pone.0102529
|
|Annotated
|-
|1164
|''CYP93G1''
|[[Os04g0101400]]
|10.1104/pp.114.239723
| Cytochrome P450 93G1 Is a Flavone Synthase II That Channels Flavanones to the Biosynthesis of Tricin O-Linked Conjugates in Rice
|
|-
|1224
|''CYP93G2''
|[[Os06g0102100]]
|10.1104/pp.114.239723
| CYP93G2 Is a Flavanone 2-Hydroxylase Required for C-Glycosylflavone Biosynthesis in Rice
|
|-
|1165
|''OsMYB4P''
|[[Os11g0558200]]
|10.1016/j.plaphy.2014.02.024
| Overexpression of OsMYB4P, an R2R3-type MYB transcriptional activator, increases phosphate acquisition in rice
|
|-
|1166
|''rip-3 (a-tubulin)''
|[[Os03g0726100]]
|10.1016/j.plaphy.2014.04.011
| Water-stress-induced inhibition of a -tubulin gene expression during growth, and its implications for reproductive success in rice
|
|-
|1167
|''OsRDR1''
|[[Os02g0736200]]
|10.1186/1471-2229-14-177
| Mutation of the RDR1 gene caused genome-wide changes in gene expression, regional variation in small RNA clusters and localized alteration in DNA methylation in rice
|
|-
|1168
|''ygl7''
|[[Os03g0811100]]
|10.1371/journal.pone.0099564
|
|Annotated
|-
|1169
|''OsDREB6''
|[[Os09g0369000]]
|10.1007/s12374-013-0480-0
| Characterization of OsDREB6 Responsive to Osmotic and Cold Stresses in Rice
|
|-
|1170
|''OsPAO7''
|[[Os09g0368500]]
|10.1093/pcp/pcu047
| Polyamine Oxidase 7 is a Terminal Catabolism-Type Enzyme in Oryza sativa and is Specifically Expressed in Anthers
|
|-
|1172
|''OsAGPL2''
|[[Os01g0633100]]
|10.1093/pcp/pcu057
| The Rice Endosperm ADP-Glucose Pyrophosphorylase Large Subunit is Essential for Optimal Catalysis and Allosteric Regulation of the Heterotetrameric Enzyme
|
|-
|1173
|''OsMYB103L''
|[[Os08g0151300]]
|10.1186/1471-2229-14-158
| OsMYB103L, an R2R3-MYB transcription factor, influences leaf rolling and mechanical strength in rice
|
|-
|1174
|''DRO1''
|[[Os09g0439800]]
|10.1038/srep05563
|
|Annotated
|-
|1175
|''FIB''
|[[Os01g0169800]]
|10.1111/tpj.12517
|
|Annotated
|-
|1176
|''OsNIP3;1''
|[[Os10g0513200]]
|10.1111/tpj.12511
| OsNIP3;1, a rice boric acid channel, regulates boron distribution and is essential for growth under boron-deficient conditions
|
|-
|1177
|''OsETOL1''
|[[Os03g0294700]]
|10.1111/tpj.12508
|
|Annotated
|-
|1178
|''OsGLY1-11.2''
|[[Os08g0191700]]
|10.1111/tpj.12521
| A unique Ni 2+ -dependent and methylglyoxal-inducible rice glyoxalase I possesses a single active site and functions in abiotic stress response
|
|-
|1179
|''OsKTN80a''
|[[Os10g0494800]]
|10.1111/jipb.12170
| Overexpression of OsKTN80a, a katanin P80 ortholog, caused the repressed cell elongation and stalled cell division mediated by microtubule apparatus defects in primary root in Oryza Sativa
|
|-
|1180
|''WRKY45''
|[[Os05g0322900]]
|10.1007/s11103-014-0221-x
|
|Annotated
|-
|1181
|''OsRZFP34''
|[[Os01g0719100]]
|10.1007/s11103-014-0217-6
|Expression of a gene encoding a rice RING zinc‐finger protein, OsRZFP34, enhances stomata opening
|Stress
|-
|1182
|''OsSPS1''
|[[Os01g0919400]]
|10.1016/j.plantsci.2014.05.018
|
|Annotated
|-
|1183
|''AM1''
|[[Os04g0682800]]
|10.1007/s00299-014-1639-y
|
|Annotated
|-
|1184
|''OsMPK3''
|[[Os02g0148100]]
|10.1007/s00299-014-1620-9
|
|Annotated
|-
|1186
|''OsMet1-2''
|[[Os07g0182900]]
|10.1073/pnas.1410761111
|
|Annotated
|-
|1189
|''sped1''
|[[Os06g0597500]]
|10.1534/genetics.114.163931
|Regulation of Inflorescence Branch Development in Rice Through a Novel Pathway Involving the Pentatricopeptide Repeat Protein sped1-D
|
|-
|1190
|''OsXXT1''
|[[Os03g0300000]]
|10.1093/jxb/eru189
| Mutation in xyloglucan 6-xylosytransferase results in abnormal root hair development in Oryza sativa
|
|-
|1191
|''Nrat1''
|[[Os02g0131800]]
|10.1093/jxb/eru201
|
|Annotated
|-
|1192
|''SLCHL4 (NAL1)''
|[[Os04g0615000]]
|10.1093/mp/ssu055
|
|Annotated
|-
|1193
|''OsNMD3''
|[[Os10g0573900]]
|10.1093/jxb/eru150
|
|Annotated
|-
|1194
|''OsRAN1''
|[[Os01g0611100]]
|10.1093/jxb/eru178
|
|Annotated
|-
|1195
|''OsABCB14''
|[[Os04g0459000]]
|10.1111/tpj.12544
| OsABCB14 functions in auxin transport and iron homeostasis in rice (Oryza sativa.L)
|
|-
|1196
|''OsRAD51D''
|[[Os09g0104200]]
|10.1111/tpj.12558
|
|Annotated
|-
|1197
|''OsYUCCA11''
|[[Os12g0189500]]
|10.1111/tpj.12553
|
|Annotated
|-
|1198
|''Roc5(rl(t))''
|[[Os02g0674800]]
|10.1007/s11434-014-0357-8
|Isolation and characterization of rl (t) , a gene that controls leaf rolling in rice
|
|-
|1199
|''OsWRKY42''
|[[Os02g0462800]]
|10.14348/molcells.2014.0128
|
|Annotated
|-
|1200
|''OsB12D1''
|[[Os07g0604700]]
|10.3390/ijms150813461
|The Mitochondrion-Located Protein OsB12D1 Enhances Flooding Tolerance during Seed Germination and Early Seedling Growth in Rice
|Stress
|-
|1201
|''OsHO2''
|[[Os03g0395000]]
|10.1007/s00425-014-2116-0
|Annotated
|Biosynthesis
|-
|1202
|''CL4 (= dwarf11)''
|[[Os04g0469800]]
|10.1007/s11434-014-0568-z
|Annotated
|Development
|-
|1203
|''OsEXPA3''
|[[Os05g0276500]]
|10.2135/cropsci2013.11.0746
|Repression of OsEXPA3 Expression Leadsto Root System Growth Suppression in Rice
|Stress,Development
|-
|1204
|''bHLH142''
|[[Os01g0293100]]
|10.1105/tpc.114.126292
|Annotated
|Development
|-
|1205
|''SIT1''
|[[Os02g0640500]]
|10.1105/tpc.114.125187
|The Receptor-Like Kinase SIT1 Mediates Salt
Sensitivity by Activating MAPK3/6 and Regulating
Ethylene Homeostasis in Rice
|Stress
|-
|1206
|''SIT2''
|[[Os04g0531400]]
|10.1105/tpc.114.125187
| The Receptor-Like Kinase SIT1 Mediates Salt
Sensitivity by Activating MAPK3/6 and Regulating
Ethylene Homeostasis in Rice
|Stress
|-
|1207
|''CPK18''
|[[Os07g0409900]]
|10.1105/tpc.114.126441
| Direct Phosphorylation and Activation of a Mitogen-Activated
Protein Kinase by a Calcium-Dependent Protein
Kinase in Rice
|Stress
|-
|1208
|''OsHPR1''
|[[Os02g0101500]]
|10.1111/jipb.12125
| Two hydroxypyruvate reductases encoded by OsHPR1 and OsHPR2 are involved in
photorespiratory metabolism in rice
|Metabolism
|-
|1222
|''OsHPR2''
|[[Os01g0228600]]
|10.1111/jipb.12125
| Two hydroxypyruvate reductases encoded by OsHPR1 and OsHPR2 are involved in
photorespiratory metabolism in rice
|Metabolism
|-
|1209
|''OsCAD2''
|[[Os02g0187800]]
|10.1038/srep06567
|Annotated
|
|-
|1210
|''OsSLI1''
|[[Os02g0649300]]
|10.1155/2014/809353
|OsSLI1, a Homeodomain Containing Transcription Activator, Involves Abscisic Acid Related Stress Response in Rice (Oryza sativa L.)
|Stress,Development
|-
|1211
|''OsMKK1 (MAPKK)''
|[[Os06g0147800]]
|10.1016/j.plantsci.2014.08.007
|The mitogen-activated protein kinase cascade MKK1-MPK4 mediates salt signaling in rice
|Stress
|-
|1212
|''SPK1(SYG1)''
|[[Os06g0603600]]
|10.1073/pnas.1404680111
|Annotated
|Finished
|-
|1213
|''SPK2(SYG2)''
|[[Os02g0202200]]
|10.1073/pnas.1404680111
| Rice SPX1 and SPX2 inhibit phosphate starvation responses through interacting with PHR2 in a phosphate-dependent manner
|
|-
|1215
|''OsAAP6''
|[[Os01g0878700]]
|10.1038/ncomms5847
| OsAAP6 functions as an important regulator of grain protein content and nutritional quality in rice
|
|-
|1216
|''OsSOT1(STV11)''
|[[Os11g0505300]]
|10.1038/ncomms5768
| STV11 encodes a sulphotransferase and confers durable resistance to rice stripe virus
|
|-
|1217
|''tms5''
|[[Os02g0214300]]
|10.1038/srep06567
|
|Annotated
|-
|1218
|''CYP703A3''
|[[Os08g0131100]]
|10.1111/jipb.12212
|Rice CYP703A3, a cytochrome P450 hydroxylase, is essential for development of anther cuticle and pollen exine
|Development
|-
|1219
|''OsGUN4''
|[[Os11g0267000]]
|10.1007/s00122-014-2393-9
|A down-regulated epi-allele of the genomes uncoupled 4 gene generates a xantha marker trait in rice.
|Color
|-
|1220
|''OsBADH1''
|[[Os04g0464200]]
|OsBADH1 is possibly involved in acetaldehyde oxidation in rice plant peroxisomes
|OsBADH1 is possibly involved in acetaldehyde oxidation in rice plant peroxisomes
|Stress
|-
|243
|''gh2''
|[[Os02g0187800]]
|10.1104/pp.105.073007
|Increased lodging resistance in long-culm, low-lignin gh2 rice for improved feed and bioenergy production
|Stress
|-
|1221
|''OsABCC1''
|[[Os04g0620000]]
|10.1073/pnas.1414968111
|A rice ABC transporter, OsABCC1, reduces arsenic accumulation in the grain
|Stress
|-
|demo
|demo
|[[Os04g0459000]]
|demo
|demo
|demo
|}

Os01g0841500

2017-03-08T05:37:36Z

Xysj1981: /* Annotated Information */

The rice '''''Os01g0841500''''' was reported as '''''OsMYB3R-2''''' in 2009 <ref name="ref1" /> by researchers from China.

==Annotated Information==
[[File:Os01g08415002.jpg|right|thumb|527px|'''Figure 2.''' ''Phenotype analysis of the T2 generation of OsMYB3R-2 transgenic rice.<ref name="ref1" />.'']]

===Gene Symbol===
*'''''Os01g0841500''''' '''''<=>''''' '''''OsMYB3R-2, OsMYB3R2, MYB3R2'''''

===Function===
* MYB transcription factors play central roles in plant responses to abiotic stresses.
* '''''OsMYB3R-2''''' functions in both stress and developmental processes in rice (Oryza sativa).
* '''''OsMYB3R-2''''' functions in both stress and developmental processes in rice (Oryza sativa).
* '''''OsMYB3R-2''''' specifically bound to a mitosis-specific activator cis-element, (T/C)C(T/C)AACGG(T/C)(T/C)A, a conserved sequence that was found in promoters of cyclin genes such as '''''OsCycB1;1''''' and '''''OsKNOLLE2'''''.

===Phenotypic analysis===
* Over-expression of '''''OsMYB3R-2(Os01g0841500) ''''' may significantly improve cold tolerance by mediating the alteration in cell cycle and ectopic expression of stress genes in rice.
* overexpression of OsMYB3R-2 in rice led to higher transcript levels of several G2/M phase-specific genes, including '''''OsCycB1;1, OsCycB2;1, OsCycB2;2, and OsCDC20.1''''' than those in '''''OsMYB3R-2''''' antisense lines or wild-type plants in response to cold treatment.
* Flow cytometry analysis revealed an increased cell mitotic index in overexpressed transgenic lines of '''''OsMYB3R-2''''' after cold treatment.
* Furthermore, resistance to cold stress in the transgenic plants overexpressing OsCycB1;1 was also enhanced. The level of cellular free proline was increased in the overexpressed rice lines of '''''OsMYB3R-2''''' and '''''OsCycB1;1''''' transgenic plants compared with wild-type plants under the cold
treatment.
* These results suggest that '''''OsMYB3R-2''''' targets '''''OsCycB1;1''''' and regulates the progress of the cell cycle during chilling stress.
* '''''OsCPT1''''', which may be involved in the dehydration-responsive element-binding factor 1A pathway, showed the same transcription pattern in response to cold as did OsCycB1;1 in transgenic rice.

===Expression===
* Cold treatment greatly induced the expression of '''''OsMYB3R-2''''', which encodes an active transcription factor.

==Labs working on this gene==
* Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing 100093, China
* Graduate University of Chinese Academy of Sciences, Beijing 100049, China
* College of Life Sciences, Shandong Agricultural University, Tai’an 271018, China
* National Center for Plant Gene Research, Beijing 100093, China

==References==
<references>
* <ref name="ref1">
Ma Q, Dai X, Xu Y, Guo J, Liu Y, Chen N, Xiao J, Zhang D, Xu Z, Zhang X, Chong
K. Enhanced tolerance to chilling stress in OsMYB3R-2 transgenic rice is mediated
by alteration in cell cycle and ectopic expression of stress genes. Plant
Physiol. 2009 May;150(1):244-56. doi: 10.1104/pp.108.133454. PubMed PMID:
19279197; PubMed Central PMCID: PMC2675741.
</ref>
</references>

==Structured Information==

[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]