<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xysj1990</id>
		<title>RiceWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Xysj1990"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php/Special:Contributions/Xysj1990"/>
		<updated>2026-08-27T18:06:14Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0563600&amp;diff=271535</id>
		<title>Os10g0563600</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0563600&amp;diff=271535"/>
				<updated>2016-07-01T08:59:58Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;''OsMSRA4.1'' is a member of MSRA, which belongs to methionine sulfoxide reductases (MSRs)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
*''OsMSRA4.1'' and ''OsMSRB1.1'' are constitutively expressed in all organs and can be induced by various stress conditions. Overexpression of either ''OsMSRA4.1'' or ''OsMSRB1.1'' in yeast enhanced cellular resistance to oxidative stress. In addition, OsMSRA4.1-overexpressing transgenic rice plants also showed enhanced viability under salt treatment.''OsMSRA4.1'' plays an important role in stress responses&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
*Cloning of ''OsMSRA4.1'' cDNAs:&amp;lt;br&amp;gt;Total RNA from rice leaves was extracted using the guanidinium isocyanate/acidic phenol method as described by ''Chomczynski and Sacchi''. cDNA synthesis and RTPCR were performed using a kit. The ''OsMSRA4.1'' gene-specific primers were 5'-TCGATGCCTCCTCTCCTCG-3'� and 5'-AGGATCCTTCACCCGTAGCAACGGAT-3' The ''OsMSRA4.1'' cDNAs was cloned into the yeast expression vector p181AINE and the constructs were transformed into yeast using the lithium acetate method&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0008113 GO:0008113], [http://amigo.geneontology.org/amigo/term/GO:0019538 GO:0019538]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
[[File:OsMSRA4.1 transgenic.jpg|left|thumb|300px|'''Figure 1.'''''Growth of OsMSRA4.1-overexpressing rice plants upon salt treatment.(from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;).'']]&lt;br /&gt;
To test whether OsMSRs are involved in stress responses, transgenic rice plants harboring OsMSRA4.1 were generated. Positive transgenic lines (line 9 and line 43) were confirmed by Northern and Western analyses and selected for further analysis&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;(Fig. 1a). &lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''OsMSRA4.1'' enhances yeast tolerance to H&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt;O&amp;lt;sub&amp;gt;2&amp;lt;/sub&amp;gt; stress, and that the ''OsMSRA4'' can compensate for a deficiency in MSRA.&lt;br /&gt;
*To better understand the functions, the expression patterns of ''OsMSRA4.1'' was examined by RT-PCR in difierent tissues. The results revealed that ''OsMSRA4.1'' was constitutively expressed in all the tissues including roots, stems, leaves, Xowers and callus.  &lt;br /&gt;
*To investigate the transcription inducibility of OsMSRs, Northern blot analysis was performed under various stress conditions.&lt;br /&gt;
''OsMSRA4.1'' expression was enhanced apparently by salt, mannitol, cold and high temperatures, and a slight increase was observed at the 48 h time point after ABA treatment. The expression of ''OsMSRA4.1'' was also induced by MV treatment at 1 h and subsequently&lt;br /&gt;
declined. &lt;br /&gt;
*''OsMSRA4.1'' and ''OsMSRB1.1'' were able to reduce both the free MetSO and protein-bound-like MetSO substrates in the presence of&lt;br /&gt;
the DTT reducing system. In addition, the proteins showed higher catalytic activities with dabsyl-MetSO than free MetSO as a substrate.&lt;br /&gt;
Transgenic rice plants harboring ''OsMSRA4.1'' showed no phenotypic diVerence from wildtype under normal growth condition (Fig. 1b).&lt;br /&gt;
However, when 3-week-old transgenic lines and the controls were treated with 100 mM NaCl for 2 weeks, all non-transgenic&lt;br /&gt;
control rice plants wilted during extended treatment and showed salt-induced leaf curling, while OsMSRA4.1 transgenic plants grew much better than the control plants(Fig. 1c). the photosynthetic rate of OsMSRA4.1-overexpressing lines was 17–27% higher&lt;br /&gt;
than that of wild-type plants under salt stress condition(Fig. 1d), which suggesting that overexpression of ''OsMSRA4.1'' reduced the severity of the stress-induced impact on the photosynthesis.As shown in Fig. 1e and f, the relative electrolyte leakage&lt;br /&gt;
values of OsMSRA4.1 transgenic lines were much lower(17–32%) than that of wild-type plants under salt treatment for 2 days, and MDA content in ''OsMSRA4.1'' transgenic lines is also lower than wild-type, indicating that transgenic lines were more tolerant to salt stress than wild-type. Under normal conditions, there is no obvious diVerence on relative conductance and MDA between transgenic plants and wild-type&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Subcellular localization===&lt;br /&gt;
[[File: MSR gene family.jpg|right|thumb|300px|'''Figure 2.'''''MSR gene family in rice.(from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;).'']]&lt;br /&gt;
*Subcellular localization and in vitro activity assay revealed that both OsMSR proteins are targeted to the chloroplast and have MSR activity.&lt;br /&gt;
*Based on the prediction software (TargetP), ''OsMSRA4'', ''OsMSRB1'', and ''OsMSRB3'' all have N-terminal extensions which are predicted to be chloroplast transit peptides. ''OsMSRA5'' is predicted to be localized to a secretory pathway. ''OsMSRA2.1'', ''OsMSRA2.2'', and ''OsMSRB5'' are possibly restricted to cytosol (Table 1), but the exact subcellular localization remains to be experimentally investigated&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
[[File: MSR Phylogenetic tree.jpg|left|thumb|300px|'''Table 1.'''''Phylogenetic tree of MSRAs and MSRBs from Arabidopsis thaliana, Populus trichocarpa and Oryza sativa.(from reference &amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;).'']]&lt;br /&gt;
*Using the blastP search engine in the NCBI database, seven MSR genes were found in rice genome (Table 1). To avoid confusion,&lt;br /&gt;
Sequence alignment revealed that ''OsMSRA2.1'', ''OsMSRA2.2'', ''OsMSRA4'', and ''OsMSRA5'' belong to the MSRA, and ''OsMSRB1'', ''OsMSRB3'', and ''OsMSRB5'' belong to the MSRB (Table 1). Accession numbers and chromosome locations of rice MSR gene family are listed in Table 1. Two transcripts (''OsMSRA4.1/2'' and ''OsMSRB1.1/2'') with diVerent lengths for OsMSRA4 and OsMSRB1 were found, respectively, probably resulted from alternative splicing.&lt;br /&gt;
*Multiple alignment of ''OsMSRA'' sequences revealed that high similarity was found among ''OsMSRA2.1'', ''OsMSRA2.2'', and ''OsMSRA4''. Three of the OsMSRA proteins contain one highly conserved cysteine residue housed in the GCFWG motif, while ''OsMSRA5'' possesses a serine residue instead of this cysteine residue. OsMSRB sequences are also highly conserved and all OsMSRBs have four additional conserved cysteine residues that are organized in two CXXC motifs (two cysteines separated by two amino acid residues) which were found to coordinate structural Zinc&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
*''OsMSRA4.1'' and ''OsMSRB1.1'' orthologs in Arabidopsis：''AtMSRA4'' and ''AtMSRB1''&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot;/&amp;gt;.&lt;br /&gt;
*Based on sequence alignments, on construction of unrooted phylogenetic trees and on some biochemical results, two MSRA subgroups can be distinguished. They differ essentially in the number and in the position of the cysteines involved in catalysis and enzyme&lt;br /&gt;
regeneration, but also in the subcellular localization. ''MSRA5'' isoforms constitute an independent subgroup, while other proteins, either cytosolic or chloroplastic, are grouped into the same clad (Fig. 2). When looking at sequence homology, the overall identities range from 55 to 66% for MSRA5 proteins, from 55 to 93% for MSRA1-4, but only from 21 to 34% between ''MSRA5'' proteins and other MSRAs. From the phylogenetic tree shown in Fig. 2, it appears that the chloroplastic MSRB1 isoforms constitute a distinct subgroup, while all other MSRB are grouped together&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
In rice genome, MSR is encoded by a multigene family with at least seven members. The relatively large number of MSR genes in plants is particularly signiWcant. In ''Arabidopsis'', the number of genes encoding for MSRs is even larger with 14 members, when compared to 9 in poplar and 7 in rice&amp;lt;ref name=&amp;quot;ref5&amp;quot;/&amp;gt; whereas generally mammals, yeast, and E. coli possess 2–4 MSR genes.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*State Key Laboratory of Plant Genomics, National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese Academy of Sciences (CAS), 100101 Beijing, China&lt;br /&gt;
*Graduate School of the Chinese Academy of Sciences, 100039 Beijing, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Guo X, Wu Y, Wang Y, et al. OsMSRA4. 1 and OsMSRB1. 1, two rice plastidial methionine sulfoxide reductases, are involved in abiotic stress responses[J]. Planta, 2009, 230(1): 227-238.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Rouhier N, Dos Santos C V, Tarrago L, et al. Plant methionine sulfoxide reductase A and B multigenic families[J]. Photosynthesis research, 2006, 89(2-3): 247-262.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Romero H M, Berlett B S, Jensen P J, et al. Investigations into the role of the plastidial peptide methionine sulfoxide reductase in response to oxidative stress in Arabidopsis[J]. Plant physiology, 2004, 136(3): 3784-3794.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;&lt;br /&gt;
Dos Santos C V, Cuiné S, Rouhier N, et al. The Arabidopsis plastidic methionine sulfoxide reductase B proteins. Sequence and activity characteristics, comparison of the expression with plastidic methionine sulfoxide reductase A, and induction by photooxidative stress[J]. Plant physiology, 2005, 138(2): 909-922.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;&lt;br /&gt;
Rouhier N, Dos Santos C V, Tarrago L, et al. Plant methionine sulfoxide reductase A and B multigenic families[J]. Photosynthesis research, 2006, 89(2-3): 247-262.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 10]]&lt;br /&gt;
[[Category:Chromosome 10]]&lt;br /&gt;
==Structured Information==&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0192000&amp;diff=271531</id>
		<title>Os01g0192000</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0192000&amp;diff=271531"/>
				<updated>2016-07-01T08:56:15Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice ''Os01g0192000'' is located at rice chromosome 1, which is involved in delaying leaf senescence in rice.  It was reported as '''''OsDOS'''''  by Chinese plant molecular biologists in 2006.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
[[File:Os01g0192000-1.png|right|thumb|274px|'''Figure 1.''' ''OsDOS mutant (RNAi) VS. WT(from reference) &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
===Function===&lt;br /&gt;
* Leaf senescence is a developmentally programmed degeneration process that constitutes the final step of leaf development and is controlled by multiple developmental and environmental signals.  &lt;br /&gt;
* Research shows that '''''OsDOS''''' acts as a novel negative regulator for leaf senescence by integrating developmental cues to senescence signaling cascades including the JA pathway. &lt;br /&gt;
* Scientists propose that '''''OsDOS''''' possibly plays a role at posttranscriptional level in delaying leaf senescence in rice. And the potential targets of '''''OsDOS''''' might be key positive elements that are required to promote the leaf senescence program.&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO asignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0001591 GO:0003676], [http://amigo.geneontology.org/amigo/term/GO:0008270 GO:0008270]&lt;br /&gt;
&lt;br /&gt;
===Wild Type &amp;amp; Mutants===&lt;br /&gt;
* '''RNAi interference of the''' '''''OsDOS'''''. The RNAi T 1 lines appeared normal during the vegetative growth. However, beginning at the time of late booting stage, slight but consistent leaf yellowing was clearly observed in the RNAi lines and then an accelerated leaf senescence occurred compared with that in the wild-type plants. &lt;br /&gt;
* At the grainfilling stage, striking leaf yellowing appeared in the whole plant, except the flag leaf showing a slightly less yellowing, and the senescence symptom was correlated with the reduction of the expression level of OsDOS. &lt;br /&gt;
&amp;lt;br&amp;gt;[[File:Os01g0192000-3.png|center|thumb|1000px|'''Figure 2.''' ''Gene structure of Os01g0192000'']]&lt;br /&gt;
* Compared with the OsDOS RNAi lines, the wild-type plants stayed much more green.&lt;br /&gt;
[[File:Os01g0192000-2.png|right|thumb|274px|'''Figure 3.''' ''OsDOS (Overexpression) mutant VS. WT(from reference) &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
* '''Overexpression of the ''OsDOS'''''.   The OsDOS OX lines showed a delay in growth, shorter stature, abnormally developed panicle, deferred heading, and severe sterility.  &lt;br /&gt;
* The florets of the OsDOS OX lines was found failed to open or scarcely opened after heading. Further phenotypic analysis showed that defects in anther dehiscence and pollen viability may be responsible for the severe sterility of the OX lines. &lt;br /&gt;
* Together, these results indicated that the ectopic overexpression of OsDOS has a pleiotropic impact on rice development.&lt;br /&gt;
&lt;br /&gt;
===Expression Pattern===&lt;br /&gt;
* Real-time PCR analysis was performed to examine the expression profile of '''''OsDOS'''''. The  '''''OsDOS''''' transcripts were detected throughout the plant, in panicles and leaves with a higher expression at the early stages. the temporal expression profiles of the OsDOS transcripts indicated a down-regulation of the OsDOS gene expression during natural leaf senescence. Down-regulation of the '''''OsDOS''''' expression also occurred during the panicle development process. In addition, the expression level of '''''OsDOS''''' was reduced after pollination&lt;br /&gt;
* RNA in situ hybridization analysis was also conducted to further examine tissue-specific expression patterns of '''''OsDOS'''''. Strong OsDOS expression was detected in the leaf primordium, incipient leaf, and shoot meristem, but weak expression was observed in the elder leaf tissue&lt;br /&gt;
[[File:Os01g0192000-4.png|right|thumb|274px|'''Figure 4.''' ''Expression patterns of OsDOS(from reference) &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
===Subcellular Localization===&lt;br /&gt;
* To examine the subcellular localization of OsDOS, a green fluorescent protein (GFP) reporter gene was fused in frame to the last codon of the OsDOS coding region to produce an OsDOS-GFP fusion protein in transgenic rice plants. And the OsDOS-GFP green fluorescent signal was detected predominantly in the nuclei of the transgenic rice plants. These results indicate that OsDOS is a nuclear-localized protein and presumably functions as a transcript regulator as predicted for other CCCH-type proteins.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
* Laboratory of Molecular and Developmental Biology, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100080, China.&lt;br /&gt;
* National Centre for Plant Gene Research, Beijing 100080, China&lt;br /&gt;
* Graduate University of Chinese Academy of Sciences, Beijing 100049, China&lt;br /&gt;
* College of Life Sciences, Tianjin Normal University, Tianjin 300074, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Kong Z, Li M, Yang W, Xu W, Xue Y. A novel nuclear-localized CCCH-type zinc finger protein, OsDOS, is involved in delaying leaf senescence in rice. Plant Physiol. 2006 Aug;141(4):1376-88. Epub 2006 Jun 15. PubMed PMID: 16778011&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
==Structured Information==&lt;br /&gt;
     [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271525</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271525"/>
				<updated>2016-07-01T08:53:49Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* T-DNA Insertion Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|827px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
[[File:Os03g0125100-2.png|right|thumb|527px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.''']]&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Os03g0125100-3.png|right|thumb|527px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.''']]&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271523</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271523"/>
				<updated>2016-07-01T08:53:27Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|827px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
[[File:Os03g0125100-2.png|right|thumb|527px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Os03g0125100-3.png|right|thumb|527px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.''']]&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271521</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271521"/>
				<updated>2016-07-01T08:53:07Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|827px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
[[File:Os03g0125100-2.png|right|thumb|527px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:Os03g0125100-2.png|right|thumb|527px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271520</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271520"/>
				<updated>2016-07-01T08:52:48Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* T-DNA Insertion Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|827px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
[[File:Os03g0125100-2.png|right|thumb|527px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271519</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271519"/>
				<updated>2016-07-01T08:52:36Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* T-DNA Insertion Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|827px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
[[File:Os03g0125100-2.png|right|thumb|327px|'''Figure 2. Improved drought resistance of DSM2-overexpressing transgenic rice.&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.'']]&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271517</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271517"/>
				<updated>2016-07-01T08:51:17Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|827px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271516</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271516"/>
				<updated>2016-07-01T08:50:45Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|1000px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271515</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271515"/>
				<updated>2016-07-01T08:50:30Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
[[File:Os03g0125100-1.png|center|thumb|700px|'''Figure 1. Identification of dsm2 T-DNA insertion mutants and its drought sensitivity.'''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Os03g0125100-3.png&amp;diff=271514</id>
		<title>File:Os03g0125100-3.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Os03g0125100-3.png&amp;diff=271514"/>
				<updated>2016-07-01T08:49:07Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Os03g0125100-2.png&amp;diff=271513</id>
		<title>File:Os03g0125100-2.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Os03g0125100-2.png&amp;diff=271513"/>
				<updated>2016-07-01T08:48:56Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Os03g0125100-1.png&amp;diff=271512</id>
		<title>File:Os03g0125100-1.png</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Os03g0125100-1.png&amp;diff=271512"/>
				<updated>2016-07-01T08:48:43Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271511</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271511"/>
				<updated>2016-07-01T08:45:55Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Knowledge Extension */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Knowledge Extension==&lt;br /&gt;
* Abiotic stresses such as drought, salinity, and adverse temperatures are major limiting factors for plant growth and reproduction. To respond to environmental cues, plants have evolved a variety of biochemical and physiological mechanisms to adapt to adverse conditions during their growth and development. Abscisic acid (ABA) has been recognized as a stress hormone that coordinates the complex networks of stress responses. &lt;br /&gt;
* Under drought or salt stress conditions, plant endogenous ABA level can rise to about 40-fold, triggering the closure of stomata and accumulating reactive oxygen species (ROS), dehydrins, and late embryogenesis abundant proteins for osmotic adjustment (Verslues et al., 2006). The endogenous ABA level is determined by ABA biosynthesis, catabolism, and release of ABA from ABA-Glc conjugates. Therefore, identification of all the components affecting active ABA content is essential for a complete understanding of the action of the hormone.&lt;br /&gt;
&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271509</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271509"/>
				<updated>2016-07-01T08:43:44Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
* To test whether DSM2 overexpression has a significant effect on improving drought resistance, the full-length cDNA of DSM2 under the control of the cauliflower mosaic virus 35S promoter (Fig. 2A) was transformed into japonica rice ZH11. After severe drought stress (no watering for 1 week), the overexpression lines had a significantly higher survival rate (approximately 74%) than the negative control (completely died; Fig. 2, C and D). After drought treatments at the reproductive stage, the overexpression lines had more green leaves and higher spikelet fertility than negative transgenic lines. The overexpression lines had less oxidative damage on the leaves and higher seed-setting rates than the negative control (Fig. 2, E and F). These results suggest that overexpression of DSM2 has a significant effect on the improvement of drought resistance in rice.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271506</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271506"/>
				<updated>2016-07-01T08:41:19Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice &amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. The functional analysis of the '''''DSM2''''' suggested that DSM2 is essential for drought resistance in rice.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed&lt;br /&gt;
wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
*&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271505</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271505"/>
				<updated>2016-07-01T08:40:18Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice.'&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* The T-DNA insertion sites of dsm2-1 and dsm2-2 are located in the third intron and the first exon, respectively.Under normal conditions, the homozygous mutants showed no obvious phenotypic change compared with the wild-type genotype segregated from the heterozygous mutant.&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
* Drought sensitivity of the dsm2-1 mutant was also tested at the reproductive stage by growing the mutant and the wild type in a paddy field facilitated with a removable rain-off shelter and in polyvinyl chloride (PVC) tubes filled with sandy soil. During the course of drought stress development, dsm2-1 showed&lt;br /&gt;
wilting earlier than the wild type. After moderate drought stress in the PVC tubes, the total grain yield of dsm2-1 was reduced by about 52% compared with the wild type, and the pollen fertility of dsm2-1 (23%) was also significantly lower than that of the wild type (58%; Fig. 1D). The root depth and volume of dsm2-1 were significantly reduced compared with the wild type (Fig. 1D), and contents of chlorophyll and Pro in dsm2-1 were also reduced prominently.&lt;br /&gt;
====Overexpression of '''''DSM2'''''====&lt;br /&gt;
*&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271503</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271503"/>
				<updated>2016-07-01T08:35:00Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice.'&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
====T-DNA Insertion Mutation====&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271502</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271502"/>
				<updated>2016-07-01T08:33:11Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice.'&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
**T-DNA Insertion Mutation&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271501</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271501"/>
				<updated>2016-07-01T08:32:25Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Mutation */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice.'&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
* T-DNA insertion mutants in the background of japonica Zhonghua11 (ZH11) rice, selected from the Rice Mutant Database, for drought resistance under field conditions was screened by the researchers to identify critical genes required for drought resistance in rice. One of the drought-hypersensitive mutants showing drought sensitivity at both the seedling and panicle development stages, designated as ''dsm2-1'', was further characterized in this study.&lt;br /&gt;
&lt;br /&gt;
* To verify the drought-sensitive phenotype, mutant and wild-type plants at the four-leaf stage grown in sandy soil were subjected to drought stress. Under the moderate stress condition, the dsm2 mutant lines wilted faster than the wild type. After severe drought stress treatment followed by rewatering, almost all the mutant plants died, whereas wild-type plants had a significantly higher survival rate (Fig. 1C). Cosegregation analysis also suggested that the drought sensitivity was due to the T-DNA insertion in the OsBCH1 gene (data not shown). The dsm2-1 mutant was also more sensitive than the wild type to salt stress, but no significant difference was observed under cold or heat shock stress.&lt;br /&gt;
&lt;br /&gt;
===T-DNA Insertion Mutation===&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271498</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271498"/>
				<updated>2016-07-01T08:26:33Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice.'&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
*''dsm2-1'' and ''dsm2-2''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**The '''T-DNA insertion sites''' of ''dsm2-1'' and ''dsm2-2'' are located in the third intron and the first exon, respectively.&lt;br /&gt;
**The '''reduced yield''' and '''biomass''' of ''dsm2-1'' may be partially due to the reduced root growth, pollen fertility, and photosynthesis rate under drought stress.&lt;br /&gt;
**The '''amounts of zeaxanthin''' and '''ABA''' were significantly '''reduced''' in two allelic ''dsm2'' mutants after drought stress compared with the wild type.&lt;br /&gt;
**Under '''drought stress conditions''', the mutant '''leaves lost water faster''' than the wild type and the '''photosynthesis rate''', '''biomass''', and '''grain yield''' were significantly '''reduced''', whereas '''malondialdehyde level''' and '''stomata aperture''' were '''increased''' in the mutant. &lt;br /&gt;
**The mutant is also '''hypersensitive''' to '''oxidative stresses'''. &lt;br /&gt;
**The mutant had significantly '''lower maximal efficiency''' of '''photosystem II photochemistry''' and '''nonphotochemical quenching capacity''' than the wild type, indicating photoinhibition in photosystem II and '''decreased'' capacity for eliminating excess energy by thermal dissipation.&lt;br /&gt;
**Compared with the wild type, the '''SOD activity''' in the mutant was slightly '''higher''' before the stress but was significantly reduced after the stress.&lt;br /&gt;
*transgenic lines&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**Three positive transgenic lines:&lt;br /&gt;
***O11&lt;br /&gt;
***O13&lt;br /&gt;
***O17&lt;br /&gt;
**three negative transgenic lines:&lt;br /&gt;
***O2&lt;br /&gt;
***O3&lt;br /&gt;
***O4 &lt;br /&gt;
**They were tested for drought resistance at the four-leaf stage in barrels and at the reproductive stage in PVC tubes.&lt;br /&gt;
**After drought treatments at the '''reproductive stage''', the overexpression lines had '''more green leaves''' and '''higher spikelet fertility''' than negative transgenic lines. The overexpression lines had '''less oxidative damage''' on the '''leaves''' and '''higher seed-setting rates''' than the negative control.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271497</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271497"/>
				<updated>2016-07-01T08:26:22Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
The rice '''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of drought resistance in rice.'&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
*''dsm2-1'' and ''dsm2-2''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**The '''T-DNA insertion sites''' of ''dsm2-1'' and ''dsm2-2'' are located in the third intron and the first exon, respectively.&lt;br /&gt;
**The '''reduced yield''' and '''biomass''' of ''dsm2-1'' may be partially due to the reduced root growth, pollen fertility, and photosynthesis rate under drought stress.&lt;br /&gt;
**The '''amounts of zeaxanthin''' and '''ABA''' were significantly '''reduced''' in two allelic ''dsm2'' mutants after drought stress compared with the wild type.&lt;br /&gt;
**Under '''drought stress conditions''', the mutant '''leaves lost water faster''' than the wild type and the '''photosynthesis rate''', '''biomass''', and '''grain yield''' were significantly '''reduced''', whereas '''malondialdehyde level''' and '''stomata aperture''' were '''increased''' in the mutant. &lt;br /&gt;
**The mutant is also '''hypersensitive''' to '''oxidative stresses'''. &lt;br /&gt;
**The mutant had significantly '''lower maximal efficiency''' of '''photosystem II photochemistry''' and '''nonphotochemical quenching capacity''' than the wild type, indicating photoinhibition in photosystem II and '''decreased'' capacity for eliminating excess energy by thermal dissipation.&lt;br /&gt;
**Compared with the wild type, the '''SOD activity''' in the mutant was slightly '''higher''' before the stress but was significantly reduced after the stress.&lt;br /&gt;
*transgenic lines&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**Three positive transgenic lines:&lt;br /&gt;
***O11&lt;br /&gt;
***O13&lt;br /&gt;
***O17&lt;br /&gt;
**three negative transgenic lines:&lt;br /&gt;
***O2&lt;br /&gt;
***O3&lt;br /&gt;
***O4 &lt;br /&gt;
**They were tested for drought resistance at the four-leaf stage in barrels and at the reproductive stage in PVC tubes.&lt;br /&gt;
**After drought treatments at the '''reproductive stage''', the overexpression lines had '''more green leaves''' and '''higher spikelet fertility''' than negative transgenic lines. The overexpression lines had '''less oxidative damage''' on the '''leaves''' and '''higher seed-setting rates''' than the negative control.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271495</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271495"/>
				<updated>2016-07-01T08:25:57Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
'''''DSM2''''' gene significantly contributes to control of the xanthophyll cycle and ABA synthesis, both of which play critical roles in the establishment of&lt;br /&gt;
drought resistance in rice.'&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
 &lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
*''dsm2-1'' and ''dsm2-2''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**The '''T-DNA insertion sites''' of ''dsm2-1'' and ''dsm2-2'' are located in the third intron and the first exon, respectively.&lt;br /&gt;
**The '''reduced yield''' and '''biomass''' of ''dsm2-1'' may be partially due to the reduced root growth, pollen fertility, and photosynthesis rate under drought stress.&lt;br /&gt;
**The '''amounts of zeaxanthin''' and '''ABA''' were significantly '''reduced''' in two allelic ''dsm2'' mutants after drought stress compared with the wild type.&lt;br /&gt;
**Under '''drought stress conditions''', the mutant '''leaves lost water faster''' than the wild type and the '''photosynthesis rate''', '''biomass''', and '''grain yield''' were significantly '''reduced''', whereas '''malondialdehyde level''' and '''stomata aperture''' were '''increased''' in the mutant. &lt;br /&gt;
**The mutant is also '''hypersensitive''' to '''oxidative stresses'''. &lt;br /&gt;
**The mutant had significantly '''lower maximal efficiency''' of '''photosystem II photochemistry''' and '''nonphotochemical quenching capacity''' than the wild type, indicating photoinhibition in photosystem II and '''decreased'' capacity for eliminating excess energy by thermal dissipation.&lt;br /&gt;
**Compared with the wild type, the '''SOD activity''' in the mutant was slightly '''higher''' before the stress but was significantly reduced after the stress.&lt;br /&gt;
*transgenic lines&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**Three positive transgenic lines:&lt;br /&gt;
***O11&lt;br /&gt;
***O13&lt;br /&gt;
***O17&lt;br /&gt;
**three negative transgenic lines:&lt;br /&gt;
***O2&lt;br /&gt;
***O3&lt;br /&gt;
***O4 &lt;br /&gt;
**They were tested for drought resistance at the four-leaf stage in barrels and at the reproductive stage in PVC tubes.&lt;br /&gt;
**After drought treatments at the '''reproductive stage''', the overexpression lines had '''more green leaves''' and '''higher spikelet fertility''' than negative transgenic lines. The overexpression lines had '''less oxidative damage''' on the '''leaves''' and '''higher seed-setting rates''' than the negative control.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271494</id>
		<title>Os03g0125100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0125100&amp;diff=271494"/>
				<updated>2016-07-01T08:24:05Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The gene ''Os03g0125100'' (''LOC_Os03g03370'') was reported as '''''DSM2''''' in 2009. It encodes a '''putative BCH''' (named '''''DSM2'''''/'''''OsBCH1''''') belonging to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. This gene was also named '''''OsHYD3'''''&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''DSM2'' is a '''chloroplast protein''', and the response of ''DSM2'' to environmental stimuli is distinctive from the other two BCH members in rice. ''DSM2'' gene significantly contributes to '''control of the xanthophyll cycle''' and '''ABA synthesis''', both of which play critical roles in the establishment of '''drought resistance''' in rice. ''DSM2'' contributes to '''photosynthetic efficiency''' and '''NPQ capacity'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
 &lt;br /&gt;
'''GO assignment(s):''' [http://amigo.geneontology.org/amigo/term/GO:0003824 GO:0003824],[http://amigo.geneontology.org/amigo/term/GO:0008152 GO:0008152] &lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
*''dsm2-1'' and ''dsm2-2''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**The '''T-DNA insertion sites''' of ''dsm2-1'' and ''dsm2-2'' are located in the third intron and the first exon, respectively.&lt;br /&gt;
**The '''reduced yield''' and '''biomass''' of ''dsm2-1'' may be partially due to the reduced root growth, pollen fertility, and photosynthesis rate under drought stress.&lt;br /&gt;
**The '''amounts of zeaxanthin''' and '''ABA''' were significantly '''reduced''' in two allelic ''dsm2'' mutants after drought stress compared with the wild type.&lt;br /&gt;
**Under '''drought stress conditions''', the mutant '''leaves lost water faster''' than the wild type and the '''photosynthesis rate''', '''biomass''', and '''grain yield''' were significantly '''reduced''', whereas '''malondialdehyde level''' and '''stomata aperture''' were '''increased''' in the mutant. &lt;br /&gt;
**The mutant is also '''hypersensitive''' to '''oxidative stresses'''. &lt;br /&gt;
**The mutant had significantly '''lower maximal efficiency''' of '''photosystem II photochemistry''' and '''nonphotochemical quenching capacity''' than the wild type, indicating photoinhibition in photosystem II and '''decreased'' capacity for eliminating excess energy by thermal dissipation.&lt;br /&gt;
**Compared with the wild type, the '''SOD activity''' in the mutant was slightly '''higher''' before the stress but was significantly reduced after the stress.&lt;br /&gt;
*transgenic lines&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;:&lt;br /&gt;
**Three positive transgenic lines:&lt;br /&gt;
***O11&lt;br /&gt;
***O13&lt;br /&gt;
***O17&lt;br /&gt;
**three negative transgenic lines:&lt;br /&gt;
***O2&lt;br /&gt;
***O3&lt;br /&gt;
***O4 &lt;br /&gt;
**They were tested for drought resistance at the four-leaf stage in barrels and at the reproductive stage in PVC tubes.&lt;br /&gt;
**After drought treatments at the '''reproductive stage''', the overexpression lines had '''more green leaves''' and '''higher spikelet fertility''' than negative transgenic lines. The overexpression lines had '''less oxidative damage''' on the '''leaves''' and '''higher seed-setting rates''' than the negative control.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*Overexpression of ''DSM2'' in rice resulted in significantly '''increased resistance''' to '''drought''' and '''oxidative''' stresses and '''increases''' of the '''xanthophylls''' and '''nonphotochemical quenching'''. Some '''stress-related ABA responsive genes''' were '''up-regulated''' in the overexpression line&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. &lt;br /&gt;
&lt;br /&gt;
*Transcript analysis suggested that the expression of ''DSM2'' was abolished in the two allelic ''dsm2'' mutants. The ''DSM2'' transcript level was '''induced''' (7- to 9-fold) by '''drought''' and '''salt''' treatments and '''slightly''' induced by '''ABA'''. However, ''DSM2'' was '''not''' induced by the other treatments (and was '''slightly suppressed''' by '''cold''' stress)&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*A '''strong GFP signal''' was observed in the '''stamen''', '''plumule''', '''hull''', '''pistil''','''mature leaf''', and '''root''', and a '''weak GFP signal''' was detected in '''calli''', '''young shoot''' and '''root''', and '''endosperm''', suggesting an organ/ tissue-dependent differential expression pattern of ''DSM2'' in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
In the rice genome, there are '''two homologs''' of ''DSM2''/ ''OsBCH1'', designated ''OsBCH2'' (LOC_Os04g48880) and ''OsBCH3'' (LOC_Os10g38940), showing '''82%''' and '''75% identity''' to ''OsBCH1'', respectively. ''DSM2'' belongs to the '''BCH family'''&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
*The ''CYP97'' and ''BCH'' '''gene pairs''' are primarily responsible for hydroxylation of α- and β-carotenes, respectively, but exhibit some overlapping activities, most notably in hydroxylation of the β-ring of α-carotene. The BCH duplicates encode isozymes that show significant expression divergence in reproductive organs&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*The two BCH isozymes could hydroxylate the β-ring of α-carotene, though again to a lower extent than the full four enzyme complement in the wild type&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University, Wuhan 430070, China&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Du H, Wang N, Cui F, et al. Characterization of the β-carotene hydroxylase gene DSM2 conferring drought and oxidative stress resistance by increasing xanthophylls and abscisic acid synthesis in rice[J]. Plant Physiology, 2010, 154(3): 1304-1318.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Vallabhaneni R, Gallagher C E, Licciardello N, et al. Metabolite sorting of a germplasm collection reveals the hydroxylase3 locus as a new target for maize provitamin A biofortification[J]. Plant physiology, 2009, 151(3): 1635-1645.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
* &amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;&lt;br /&gt;
Kim J, Smith J J, Tian L, et al. The evolution and function of carotenoid hydroxylases in Arabidopsis[J]. Plant and cell physiology, 2009, 50(3): 463-479.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 3]]&lt;br /&gt;
[[Category:Chromosome 3]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Curated_Genes&amp;diff=271010</id>
		<title>Curated Genes</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Curated_Genes&amp;diff=271010"/>
				<updated>2016-06-25T07:09:14Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{|class=&amp;quot;wikitable sortable&amp;quot; style=&amp;quot;width:90%;text-align:center&amp;quot;  &lt;br /&gt;
|-&lt;br /&gt;
!'''Gene'''&lt;br /&gt;
!'''Total Contribution Score'''&lt;br /&gt;
!'''Summed Edit Quantity'''&lt;br /&gt;
!'''Averaged Edit Quality'''&lt;br /&gt;
!'''Contributor Count'''&lt;br /&gt;
!'''Edit Count*'''&lt;br /&gt;
!'''Last Edit Time'''&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0457900]]&lt;br /&gt;
| 42.219&lt;br /&gt;
| 42219&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 14:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0208800]]&lt;br /&gt;
| 35.205&lt;br /&gt;
| 40853&lt;br /&gt;
| 0.862&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:09&lt;br /&gt;
|-&lt;br /&gt;
|[[DWARF27]]&lt;br /&gt;
| 31.862&lt;br /&gt;
| 34044&lt;br /&gt;
| 0.936&lt;br /&gt;
| 2&lt;br /&gt;
| 4&lt;br /&gt;
| 2014/6/9 2:23&lt;br /&gt;
|-&lt;br /&gt;
|[[GW5]]&lt;br /&gt;
| 31.812&lt;br /&gt;
| 31817&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/8 22:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0122600]]&lt;br /&gt;
| 31.778&lt;br /&gt;
| 36672&lt;br /&gt;
| 0.867&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Du1]]&lt;br /&gt;
| 26.789&lt;br /&gt;
| 26797&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/5 11:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0771200]]&lt;br /&gt;
| 25.112&lt;br /&gt;
| 106499&lt;br /&gt;
| 0.236&lt;br /&gt;
| 3&lt;br /&gt;
| 14&lt;br /&gt;
| 2015/5/13 15:32&lt;br /&gt;
|-&lt;br /&gt;
|[[IPA1]]&lt;br /&gt;
| 22.636&lt;br /&gt;
| 22636&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 14:57&lt;br /&gt;
|-&lt;br /&gt;
|[[AB013448]]&lt;br /&gt;
| 21.65&lt;br /&gt;
| 21650&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0542100]]&lt;br /&gt;
| 21.515&lt;br /&gt;
| 25382&lt;br /&gt;
| 0.848&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:56&lt;br /&gt;
|-&lt;br /&gt;
|[[MADS]]&lt;br /&gt;
| 21.305&lt;br /&gt;
| 21310&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/7 19:11&lt;br /&gt;
|-&lt;br /&gt;
|[[MYB]]&lt;br /&gt;
| 21.082&lt;br /&gt;
| 21418&lt;br /&gt;
| 0.984&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/16 10:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0272900]]&lt;br /&gt;
| 21.033&lt;br /&gt;
| 24405&lt;br /&gt;
| 0.862&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0848400]]&lt;br /&gt;
| 20.688&lt;br /&gt;
| 31733&lt;br /&gt;
| 0.652&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0441900]]&lt;br /&gt;
| 18.815&lt;br /&gt;
| 18855&lt;br /&gt;
| 0.998&lt;br /&gt;
| 5&lt;br /&gt;
| 5&lt;br /&gt;
| 2014/6/11 0:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0240200]]&lt;br /&gt;
| 18.077&lt;br /&gt;
| 26433&lt;br /&gt;
| 0.684&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0271200]]&lt;br /&gt;
| 18.041&lt;br /&gt;
| 18413&lt;br /&gt;
| 0.98&lt;br /&gt;
| 5&lt;br /&gt;
| 9&lt;br /&gt;
| 2014/6/10 16:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0678500]]&lt;br /&gt;
| 17.989&lt;br /&gt;
| 29118&lt;br /&gt;
| 0.618&lt;br /&gt;
| 6&lt;br /&gt;
| 7&lt;br /&gt;
| 2015/5/13 15:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0332400]]&lt;br /&gt;
| 17.603&lt;br /&gt;
| 17603&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/12/27 21:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0196700]]&lt;br /&gt;
| 17.411&lt;br /&gt;
| 28849&lt;br /&gt;
| 0.604&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0261200]]&lt;br /&gt;
| 17.077&lt;br /&gt;
| 17414&lt;br /&gt;
| 0.981&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/1 17:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa7]]&lt;br /&gt;
| 16.58&lt;br /&gt;
| 16580&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/30 14:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0227700]]&lt;br /&gt;
| 16.238&lt;br /&gt;
| 28577&lt;br /&gt;
| 0.568&lt;br /&gt;
| 4&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Pb1]]&lt;br /&gt;
| 15.987&lt;br /&gt;
| 15987&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 15:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0597000]]&lt;br /&gt;
| 15.897&lt;br /&gt;
| 25737&lt;br /&gt;
| 0.618&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0841500]]&lt;br /&gt;
| 15.635&lt;br /&gt;
| 27885&lt;br /&gt;
| 0.561&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/13 15:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0114500]]&lt;br /&gt;
| 14.854&lt;br /&gt;
| 23746&lt;br /&gt;
| 0.626&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0182600]]&lt;br /&gt;
| 14.75&lt;br /&gt;
| 22705&lt;br /&gt;
| 0.65&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0162100]]&lt;br /&gt;
| 14.743&lt;br /&gt;
| 14743&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 17:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0738900]]&lt;br /&gt;
| 14.365&lt;br /&gt;
| 21439&lt;br /&gt;
| 0.67&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0594600]]&lt;br /&gt;
| 14.147&lt;br /&gt;
| 19008&lt;br /&gt;
| 0.744&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g57340]]&lt;br /&gt;
| 14.08&lt;br /&gt;
| 14080&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/27 20:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0718300]]&lt;br /&gt;
| 14.008&lt;br /&gt;
| 25923&lt;br /&gt;
| 0.54&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 15:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Du2]]&lt;br /&gt;
| 13.964&lt;br /&gt;
| 13964&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/5 11:53&lt;br /&gt;
|-&lt;br /&gt;
|[[OsMYB103L]]&lt;br /&gt;
| 13.96&lt;br /&gt;
| 13960&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/11 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0782100]]&lt;br /&gt;
| 13.897&lt;br /&gt;
| 27151&lt;br /&gt;
| 0.512&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 15:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0498800]]&lt;br /&gt;
| 13.782&lt;br /&gt;
| 17733&lt;br /&gt;
| 0.777&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0706400]]&lt;br /&gt;
| 13.739&lt;br /&gt;
| 20020&lt;br /&gt;
| 0.686&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0398400]]&lt;br /&gt;
| 13.721&lt;br /&gt;
| 13748&lt;br /&gt;
| 0.998&lt;br /&gt;
| 3&lt;br /&gt;
| 6&lt;br /&gt;
| 2014/6/3 16:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0141300]]&lt;br /&gt;
| 13.71&lt;br /&gt;
| 28137&lt;br /&gt;
| 0.487&lt;br /&gt;
| 5&lt;br /&gt;
| 10&lt;br /&gt;
| 2015/5/14 13:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0203800]]&lt;br /&gt;
| 13.693&lt;br /&gt;
| 13693&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0214100]]&lt;br /&gt;
| 13.62&lt;br /&gt;
| 31302&lt;br /&gt;
| 0.435&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:36&lt;br /&gt;
|-&lt;br /&gt;
|[[DWT1]]&lt;br /&gt;
| 13.275&lt;br /&gt;
| 13275&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 12:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0797600]]&lt;br /&gt;
| 13.247&lt;br /&gt;
| 13247&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/25 15:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0883800]]&lt;br /&gt;
| 13.17&lt;br /&gt;
| 24896&lt;br /&gt;
| 0.529&lt;br /&gt;
| 16&lt;br /&gt;
| 41&lt;br /&gt;
| 2016/6/17 17:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0524100]]&lt;br /&gt;
| 13.001&lt;br /&gt;
| 18711&lt;br /&gt;
| 0.695&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0559300]]&lt;br /&gt;
| 12.718&lt;br /&gt;
| 21018&lt;br /&gt;
| 0.605&lt;br /&gt;
| 3&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0225300]]&lt;br /&gt;
| 12.691&lt;br /&gt;
| 23520&lt;br /&gt;
| 0.54&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0155600]]&lt;br /&gt;
| 12.605&lt;br /&gt;
| 18316&lt;br /&gt;
| 0.688&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0607200]]&lt;br /&gt;
| 12.553&lt;br /&gt;
| 19986&lt;br /&gt;
| 0.628&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0616800]]&lt;br /&gt;
| 12.42&lt;br /&gt;
| 26693&lt;br /&gt;
| 0.465&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0546800]]&lt;br /&gt;
| 12.399&lt;br /&gt;
| 23039&lt;br /&gt;
| 0.538&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0102400]]&lt;br /&gt;
| 12.278&lt;br /&gt;
| 17739&lt;br /&gt;
| 0.692&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:13&lt;br /&gt;
|-&lt;br /&gt;
|[[WRKY]]&lt;br /&gt;
| 12.226&lt;br /&gt;
| 12233&lt;br /&gt;
| 0.999&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/5/31 12:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0286400]]&lt;br /&gt;
| 12.133&lt;br /&gt;
| 24113&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0536100]]&lt;br /&gt;
| 11.96&lt;br /&gt;
| 19080&lt;br /&gt;
| 0.627&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0725900]]&lt;br /&gt;
| 11.949&lt;br /&gt;
| 11949&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0725900]]&lt;br /&gt;
| 11.931&lt;br /&gt;
| 16469&lt;br /&gt;
| 0.724&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Waxy_gene]]&lt;br /&gt;
| 11.92&lt;br /&gt;
| 11920&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 21:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0626400]]&lt;br /&gt;
| 11.902&lt;br /&gt;
| 18881&lt;br /&gt;
| 0.63&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0726400]]&lt;br /&gt;
| 11.891&lt;br /&gt;
| 17625&lt;br /&gt;
| 0.675&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0422500]]&lt;br /&gt;
| 11.747&lt;br /&gt;
| 23511&lt;br /&gt;
| 0.5&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0250700]]&lt;br /&gt;
| 11.742&lt;br /&gt;
| 15681&lt;br /&gt;
| 0.749&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0701300]]&lt;br /&gt;
| 11.604&lt;br /&gt;
| 15691&lt;br /&gt;
| 0.74&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0126400]]&lt;br /&gt;
| 11.6&lt;br /&gt;
| 22962&lt;br /&gt;
| 0.505&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0570100]]&lt;br /&gt;
| 11.586&lt;br /&gt;
| 15710&lt;br /&gt;
| 0.737&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0793500]]&lt;br /&gt;
| 11.531&lt;br /&gt;
| 15843&lt;br /&gt;
| 0.728&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0536000]]&lt;br /&gt;
| 11.52&lt;br /&gt;
| 15150&lt;br /&gt;
| 0.76&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0848700]]&lt;br /&gt;
| 11.486&lt;br /&gt;
| 21573&lt;br /&gt;
| 0.532&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/15 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0907900]]&lt;br /&gt;
| 11.483&lt;br /&gt;
| 11485&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/2 17:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0130100]]&lt;br /&gt;
| 11.48&lt;br /&gt;
| 22964&lt;br /&gt;
| 0.5&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0666900]]&lt;br /&gt;
| 11.455&lt;br /&gt;
| 21522&lt;br /&gt;
| 0.532&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0459200]]&lt;br /&gt;
| 11.449&lt;br /&gt;
| 15381&lt;br /&gt;
| 0.744&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0102300]]&lt;br /&gt;
| 11.423&lt;br /&gt;
| 22326&lt;br /&gt;
| 0.512&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0186200]]&lt;br /&gt;
| 11.413&lt;br /&gt;
| 20165&lt;br /&gt;
| 0.566&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0226800]]&lt;br /&gt;
| 11.245&lt;br /&gt;
| 21415&lt;br /&gt;
| 0.525&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0114200]]&lt;br /&gt;
| 11.137&lt;br /&gt;
| 17754&lt;br /&gt;
| 0.627&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0596300]]&lt;br /&gt;
| 11.085&lt;br /&gt;
| 15490&lt;br /&gt;
| 0.716&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0178800]]&lt;br /&gt;
| 11.079&lt;br /&gt;
| 14720&lt;br /&gt;
| 0.753&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0811100]]&lt;br /&gt;
| 11.068&lt;br /&gt;
| 14957&lt;br /&gt;
| 0.74&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0395300]]&lt;br /&gt;
| 11.063&lt;br /&gt;
| 16461&lt;br /&gt;
| 0.672&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g03150]]&lt;br /&gt;
| 10.972&lt;br /&gt;
| 10972&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 12:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0189500]]&lt;br /&gt;
| 10.931&lt;br /&gt;
| 20645&lt;br /&gt;
| 0.529&lt;br /&gt;
| 7&lt;br /&gt;
| 7&lt;br /&gt;
| 2015/6/13 17:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0211200]]&lt;br /&gt;
| 10.925&lt;br /&gt;
| 19995&lt;br /&gt;
| 0.546&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 16:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0100200]]&lt;br /&gt;
| 10.917&lt;br /&gt;
| 21797&lt;br /&gt;
| 0.501&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:17&lt;br /&gt;
|-&lt;br /&gt;
|[[BHLH]]&lt;br /&gt;
| 10.829&lt;br /&gt;
| 10829&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/21 20:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0703900]]&lt;br /&gt;
| 10.813&lt;br /&gt;
| 10898&lt;br /&gt;
| 0.992&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2014/6/9 23:54&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g44260]]&lt;br /&gt;
| 10.787&lt;br /&gt;
| 10787&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 21:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0405500]]&lt;br /&gt;
| 10.742&lt;br /&gt;
| 10877&lt;br /&gt;
| 0.988&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/8 23:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0815100]]&lt;br /&gt;
| 10.722&lt;br /&gt;
| 15783&lt;br /&gt;
| 0.679&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0561400]]&lt;br /&gt;
| 10.656&lt;br /&gt;
| 22236&lt;br /&gt;
| 0.479&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[NAC]]&lt;br /&gt;
| 10.646&lt;br /&gt;
| 10646&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/15 8:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0523800]]&lt;br /&gt;
| 10.633&lt;br /&gt;
| 21943&lt;br /&gt;
| 0.485&lt;br /&gt;
| 6&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/13 17:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0540400]]&lt;br /&gt;
| 10.561&lt;br /&gt;
| 19732&lt;br /&gt;
| 0.535&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0257200]]&lt;br /&gt;
| 10.556&lt;br /&gt;
| 10556&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 16:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0661100]]&lt;br /&gt;
| 10.544&lt;br /&gt;
| 18837&lt;br /&gt;
| 0.56&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0164000]]&lt;br /&gt;
| 10.534&lt;br /&gt;
| 11864&lt;br /&gt;
| 0.888&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:33&lt;br /&gt;
|-&lt;br /&gt;
|[[AF465255.1]]&lt;br /&gt;
| 10.501&lt;br /&gt;
| 10501&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 20:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0476200]]&lt;br /&gt;
| 10.44&lt;br /&gt;
| 17073&lt;br /&gt;
| 0.611&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0497300]]&lt;br /&gt;
| 10.431&lt;br /&gt;
| 18232&lt;br /&gt;
| 0.572&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0108900]]&lt;br /&gt;
| 10.425&lt;br /&gt;
| 20545&lt;br /&gt;
| 0.507&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/12 16:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0215400]]&lt;br /&gt;
| 10.412&lt;br /&gt;
| 14715&lt;br /&gt;
| 0.708&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0174700]]&lt;br /&gt;
| 10.335&lt;br /&gt;
| 21519&lt;br /&gt;
| 0.48&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:28&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0121700]]&lt;br /&gt;
| 10.278&lt;br /&gt;
| 14300&lt;br /&gt;
| 0.719&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0201700]]&lt;br /&gt;
| 10.276&lt;br /&gt;
| 20440&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:03&lt;br /&gt;
|-&lt;br /&gt;
|[[OsCHR4]]&lt;br /&gt;
| 10.24&lt;br /&gt;
| 10240&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/13 21:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0577600]]&lt;br /&gt;
| 10.16&lt;br /&gt;
| 18081&lt;br /&gt;
| 0.562&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0839100]]&lt;br /&gt;
| 10.128&lt;br /&gt;
| 13298&lt;br /&gt;
| 0.762&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0567200]]&lt;br /&gt;
| 10.127&lt;br /&gt;
| 10127&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0237250]]&lt;br /&gt;
| 10.125&lt;br /&gt;
| 14184&lt;br /&gt;
| 0.714&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0133000]]&lt;br /&gt;
| 10.084&lt;br /&gt;
| 22204&lt;br /&gt;
| 0.454&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0805100]]&lt;br /&gt;
| 10.051&lt;br /&gt;
| 13542&lt;br /&gt;
| 0.742&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0621300]]&lt;br /&gt;
| 10.043&lt;br /&gt;
| 11896&lt;br /&gt;
| 0.844&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:46&lt;br /&gt;
|-&lt;br /&gt;
|[[AB013449]]&lt;br /&gt;
| 10.03&lt;br /&gt;
| 10030&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 22:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0605200]]&lt;br /&gt;
| 10.027&lt;br /&gt;
| 19041&lt;br /&gt;
| 0.527&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0194900]]&lt;br /&gt;
| 10.026&lt;br /&gt;
| 20580&lt;br /&gt;
| 0.487&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0764800]]&lt;br /&gt;
| 10.024&lt;br /&gt;
| 18674&lt;br /&gt;
| 0.537&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0111300]]&lt;br /&gt;
| 10.013&lt;br /&gt;
| 12909&lt;br /&gt;
| 0.776&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 12:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0127900]]&lt;br /&gt;
| 10.013&lt;br /&gt;
| 20618&lt;br /&gt;
| 0.486&lt;br /&gt;
| 4&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/6/13 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0644200]]&lt;br /&gt;
| 10.007&lt;br /&gt;
| 15443&lt;br /&gt;
| 0.648&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0171800]]&lt;br /&gt;
| 9.976&lt;br /&gt;
| 10824&lt;br /&gt;
| 0.922&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0662000]]&lt;br /&gt;
| 9.949&lt;br /&gt;
| 19796&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0254600]]&lt;br /&gt;
| 9.94&lt;br /&gt;
| 12129&lt;br /&gt;
| 0.82&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0330100]]&lt;br /&gt;
| 9.935&lt;br /&gt;
| 18990&lt;br /&gt;
| 0.523&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/12 16:13&lt;br /&gt;
|-&lt;br /&gt;
|[[ORF1]]&lt;br /&gt;
| 9.92&lt;br /&gt;
| 9920&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/30 9:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0471100]]&lt;br /&gt;
| 9.898&lt;br /&gt;
| 19356&lt;br /&gt;
| 0.511&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0603000]]&lt;br /&gt;
| 9.889&lt;br /&gt;
| 9889&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 17:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0535200]]&lt;br /&gt;
| 9.858&lt;br /&gt;
| 18774&lt;br /&gt;
| 0.525&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0281300]]&lt;br /&gt;
| 9.857&lt;br /&gt;
| 21855&lt;br /&gt;
| 0.451&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0919400]]&lt;br /&gt;
| 9.837&lt;br /&gt;
| 9837&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/6 17:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0573900]]&lt;br /&gt;
| 9.818&lt;br /&gt;
| 16399&lt;br /&gt;
| 0.599&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0197100]]&lt;br /&gt;
| 9.81&lt;br /&gt;
| 19279&lt;br /&gt;
| 0.509&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/5/13 14:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0216300]]&lt;br /&gt;
| 9.795&lt;br /&gt;
| 13761&lt;br /&gt;
| 0.712&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0102900]]&lt;br /&gt;
| 9.726&lt;br /&gt;
| 9726&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 14:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0249000]]&lt;br /&gt;
| 9.718&lt;br /&gt;
| 17393&lt;br /&gt;
| 0.559&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0467800]]&lt;br /&gt;
| 9.68&lt;br /&gt;
| 22133&lt;br /&gt;
| 0.437&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/13 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0682200]]&lt;br /&gt;
| 9.577&lt;br /&gt;
| 17192&lt;br /&gt;
| 0.557&lt;br /&gt;
| 3&lt;br /&gt;
| 13&lt;br /&gt;
| 2015/5/14 13:53&lt;br /&gt;
|-&lt;br /&gt;
|[[AB462324]]&lt;br /&gt;
| 9.542&lt;br /&gt;
| 9542&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 10:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0569500]]&lt;br /&gt;
| 9.526&lt;br /&gt;
| 18834&lt;br /&gt;
| 0.506&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0456800]]&lt;br /&gt;
| 9.468&lt;br /&gt;
| 13735&lt;br /&gt;
| 0.689&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0274900]]&lt;br /&gt;
| 9.449&lt;br /&gt;
| 18241&lt;br /&gt;
| 0.518&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0724900]]&lt;br /&gt;
| 9.361&lt;br /&gt;
| 19950&lt;br /&gt;
| 0.469&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0611100]]&lt;br /&gt;
| 9.349&lt;br /&gt;
| 15330&lt;br /&gt;
| 0.61&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0509600]]&lt;br /&gt;
| 9.346&lt;br /&gt;
| 17625&lt;br /&gt;
| 0.53&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 17:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0558000]]&lt;br /&gt;
| 9.337&lt;br /&gt;
| 13289&lt;br /&gt;
| 0.703&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0449000]]&lt;br /&gt;
| 9.33&lt;br /&gt;
| 16966&lt;br /&gt;
| 0.55&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0415000]]&lt;br /&gt;
| 9.31&lt;br /&gt;
| 9310&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 19:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0471000]]&lt;br /&gt;
| 9.278&lt;br /&gt;
| 18586&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0170900]]&lt;br /&gt;
| 9.272&lt;br /&gt;
| 19337&lt;br /&gt;
| 0.479&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0610300]]&lt;br /&gt;
| 9.171&lt;br /&gt;
| 11979&lt;br /&gt;
| 0.766&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0583400]]&lt;br /&gt;
| 9.15&lt;br /&gt;
| 11481&lt;br /&gt;
| 0.797&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0622100]]&lt;br /&gt;
| 9.147&lt;br /&gt;
| 12303&lt;br /&gt;
| 0.743&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0203200]]&lt;br /&gt;
| 9.128&lt;br /&gt;
| 17233&lt;br /&gt;
| 0.53&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 13:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0660200]]&lt;br /&gt;
| 9.119&lt;br /&gt;
| 20530&lt;br /&gt;
| 0.444&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 16:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0403000]]&lt;br /&gt;
| 9.104&lt;br /&gt;
| 15463&lt;br /&gt;
| 0.589&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0112700]]&lt;br /&gt;
| 9.094&lt;br /&gt;
| 17122&lt;br /&gt;
| 0.531&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 12:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0799100]]&lt;br /&gt;
| 9.068&lt;br /&gt;
| 16095&lt;br /&gt;
| 0.563&lt;br /&gt;
| 3&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/5/14 14:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0307800]]&lt;br /&gt;
| 9.029&lt;br /&gt;
| 11279&lt;br /&gt;
| 0.801&lt;br /&gt;
| 4&lt;br /&gt;
| 15&lt;br /&gt;
| 2014/6/6 8:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0424500]]&lt;br /&gt;
| 9.021&lt;br /&gt;
| 17768&lt;br /&gt;
| 0.508&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0184900]]&lt;br /&gt;
| 9.016&lt;br /&gt;
| 15182&lt;br /&gt;
| 0.594&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0203700]]&lt;br /&gt;
| 9.003&lt;br /&gt;
| 12324&lt;br /&gt;
| 0.731&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0125000]]&lt;br /&gt;
| 8.97&lt;br /&gt;
| 12695&lt;br /&gt;
| 0.707&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0612800]]&lt;br /&gt;
| 8.934&lt;br /&gt;
| 14002&lt;br /&gt;
| 0.638&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0128700]]&lt;br /&gt;
| 8.928&lt;br /&gt;
| 17882&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0215200]]&lt;br /&gt;
| 8.927&lt;br /&gt;
| 14196&lt;br /&gt;
| 0.629&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 13:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0952800]]&lt;br /&gt;
| 8.922&lt;br /&gt;
| 8922&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 21:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0494100]]&lt;br /&gt;
| 8.906&lt;br /&gt;
| 12742&lt;br /&gt;
| 0.699&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0149100]]&lt;br /&gt;
| 8.897&lt;br /&gt;
| 13456&lt;br /&gt;
| 0.661&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 11:15&lt;br /&gt;
|-&lt;br /&gt;
|[[BZIP]]&lt;br /&gt;
| 8.894&lt;br /&gt;
| 8924&lt;br /&gt;
| 0.997&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/21 21:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0625900]]&lt;br /&gt;
| 8.872&lt;br /&gt;
| 13033&lt;br /&gt;
| 0.681&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0229800]]&lt;br /&gt;
| 8.835&lt;br /&gt;
| 16807&lt;br /&gt;
| 0.526&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0651100]]&lt;br /&gt;
| 8.803&lt;br /&gt;
| 18547&lt;br /&gt;
| 0.475&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0232900]]&lt;br /&gt;
| 8.79&lt;br /&gt;
| 18004&lt;br /&gt;
| 0.488&lt;br /&gt;
| 3&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/6/12 16:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0129700]]&lt;br /&gt;
| 8.789&lt;br /&gt;
| 18504&lt;br /&gt;
| 0.475&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0641400]]&lt;br /&gt;
| 8.735&lt;br /&gt;
| 8735&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 13:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0137100]]&lt;br /&gt;
| 8.717&lt;br /&gt;
| 8717&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 17:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Htd1]]&lt;br /&gt;
| 8.705&lt;br /&gt;
| 8705&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 14:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0707600]]&lt;br /&gt;
| 8.666&lt;br /&gt;
| 16659&lt;br /&gt;
| 0.52&lt;br /&gt;
| 2&lt;br /&gt;
| 5&lt;br /&gt;
| 2014/5/28 0:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa23]]&lt;br /&gt;
| 8.641&lt;br /&gt;
| 8641&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 21:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0235200]]&lt;br /&gt;
| 8.563&lt;br /&gt;
| 17156&lt;br /&gt;
| 0.499&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0100600]]&lt;br /&gt;
| 8.559&lt;br /&gt;
| 15027&lt;br /&gt;
| 0.57&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0597000]]&lt;br /&gt;
| 8.509&lt;br /&gt;
| 16209&lt;br /&gt;
| 0.525&lt;br /&gt;
| 4&lt;br /&gt;
| 11&lt;br /&gt;
| 2014/5/19 22:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0583700]]&lt;br /&gt;
| 8.489&lt;br /&gt;
| 12862&lt;br /&gt;
| 0.66&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0232100]]&lt;br /&gt;
| 8.485&lt;br /&gt;
| 15567&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0452500]]&lt;br /&gt;
| 8.484&lt;br /&gt;
| 8484&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 16:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0556800]]&lt;br /&gt;
| 8.473&lt;br /&gt;
| 12924&lt;br /&gt;
| 0.656&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0363900]]&lt;br /&gt;
| 8.473&lt;br /&gt;
| 12412&lt;br /&gt;
| 0.683&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0426800]]&lt;br /&gt;
| 8.447&lt;br /&gt;
| 9634&lt;br /&gt;
| 0.877&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0253300]]&lt;br /&gt;
| 8.439&lt;br /&gt;
| 17745&lt;br /&gt;
| 0.476&lt;br /&gt;
| 5&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/5/13 15:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0683400]]&lt;br /&gt;
| 8.438&lt;br /&gt;
| 8438&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 14:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0553300]]&lt;br /&gt;
| 8.403&lt;br /&gt;
| 35721&lt;br /&gt;
| 0.235&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0522000]]&lt;br /&gt;
| 8.335&lt;br /&gt;
| 8335&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 21:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0580300]]&lt;br /&gt;
| 8.329&lt;br /&gt;
| 15752&lt;br /&gt;
| 0.529&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0499300]]&lt;br /&gt;
| 8.324&lt;br /&gt;
| 17032&lt;br /&gt;
| 0.489&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0445700]]&lt;br /&gt;
| 8.317&lt;br /&gt;
| 10922&lt;br /&gt;
| 0.761&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0505700]]&lt;br /&gt;
| 8.312&lt;br /&gt;
| 16220&lt;br /&gt;
| 0.512&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/13 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0559200]]&lt;br /&gt;
| 8.294&lt;br /&gt;
| 15586&lt;br /&gt;
| 0.532&lt;br /&gt;
| 6&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/13 17:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0179400]]&lt;br /&gt;
| 8.292&lt;br /&gt;
| 14840&lt;br /&gt;
| 0.559&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0553200]]&lt;br /&gt;
| 8.204&lt;br /&gt;
| 8204&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0571300]]&lt;br /&gt;
| 8.184&lt;br /&gt;
| 14946&lt;br /&gt;
| 0.548&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0401100]]&lt;br /&gt;
| 8.183&lt;br /&gt;
| 17216&lt;br /&gt;
| 0.475&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0181300]]&lt;br /&gt;
| 8.174&lt;br /&gt;
| 13252&lt;br /&gt;
| 0.617&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0346200]]&lt;br /&gt;
| 8.14&lt;br /&gt;
| 8233&lt;br /&gt;
| 0.989&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/5 17:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0502100]]&lt;br /&gt;
| 8.139&lt;br /&gt;
| 15501&lt;br /&gt;
| 0.525&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0820300]]&lt;br /&gt;
| 8.137&lt;br /&gt;
| 11604&lt;br /&gt;
| 0.701&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0381100]]&lt;br /&gt;
| 8.133&lt;br /&gt;
| 9672&lt;br /&gt;
| 0.841&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0118800]]&lt;br /&gt;
| 8.097&lt;br /&gt;
| 8097&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0230300]]&lt;br /&gt;
| 8.029&lt;br /&gt;
| 15193&lt;br /&gt;
| 0.528&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0438800]]&lt;br /&gt;
| 8.026&lt;br /&gt;
| 15610&lt;br /&gt;
| 0.514&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0534400]]&lt;br /&gt;
| 7.997&lt;br /&gt;
| 16635&lt;br /&gt;
| 0.481&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0165600]]&lt;br /&gt;
| 7.982&lt;br /&gt;
| 11937&lt;br /&gt;
| 0.669&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0490600]]&lt;br /&gt;
| 7.98&lt;br /&gt;
| 16603&lt;br /&gt;
| 0.481&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0585700]]&lt;br /&gt;
| 7.966&lt;br /&gt;
| 7966&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 23:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0194300]]&lt;br /&gt;
| 7.966&lt;br /&gt;
| 11111&lt;br /&gt;
| 0.717&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0869900]]&lt;br /&gt;
| 7.964&lt;br /&gt;
| 16289&lt;br /&gt;
| 0.489&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0160700]]&lt;br /&gt;
| 7.962&lt;br /&gt;
| 15027&lt;br /&gt;
| 0.53&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0451500]]&lt;br /&gt;
| 7.903&lt;br /&gt;
| 10040&lt;br /&gt;
| 0.787&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0759400]]&lt;br /&gt;
| 7.902&lt;br /&gt;
| 15742&lt;br /&gt;
| 0.502&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0205100]]&lt;br /&gt;
| 7.891&lt;br /&gt;
| 12914&lt;br /&gt;
| 0.611&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0244900]]&lt;br /&gt;
| 7.89&lt;br /&gt;
| 11371&lt;br /&gt;
| 0.694&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:38&lt;br /&gt;
|-&lt;br /&gt;
|[[HTD2]]&lt;br /&gt;
| 7.887&lt;br /&gt;
| 7887&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/4 22:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0482400]]&lt;br /&gt;
| 7.873&lt;br /&gt;
| 11843&lt;br /&gt;
| 0.665&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0478000]]&lt;br /&gt;
| 7.871&lt;br /&gt;
| 12275&lt;br /&gt;
| 0.641&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0258400]]&lt;br /&gt;
| 7.866&lt;br /&gt;
| 13708&lt;br /&gt;
| 0.574&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0445400]]&lt;br /&gt;
| 7.848&lt;br /&gt;
| 15652&lt;br /&gt;
| 0.501&lt;br /&gt;
| 6&lt;br /&gt;
| 15&lt;br /&gt;
| 2015/6/13 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0273800]]&lt;br /&gt;
| 7.843&lt;br /&gt;
| 9988&lt;br /&gt;
| 0.785&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0643300]]&lt;br /&gt;
| 7.839&lt;br /&gt;
| 16276&lt;br /&gt;
| 0.482&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 15:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0186000]]&lt;br /&gt;
| 7.817&lt;br /&gt;
| 12275&lt;br /&gt;
| 0.637&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0286700]]&lt;br /&gt;
| 7.816&lt;br /&gt;
| 16653&lt;br /&gt;
| 0.469&lt;br /&gt;
| 6&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/12 16:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0104300]]&lt;br /&gt;
| 7.791&lt;br /&gt;
| 11682&lt;br /&gt;
| 0.667&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0150700]]&lt;br /&gt;
| 7.79&lt;br /&gt;
| 15994&lt;br /&gt;
| 0.487&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0563600]]&lt;br /&gt;
| 7.778&lt;br /&gt;
| 13380&lt;br /&gt;
| 0.581&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0494200]]&lt;br /&gt;
| 7.776&lt;br /&gt;
| 7776&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 23:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0603600]]&lt;br /&gt;
| 7.774&lt;br /&gt;
| 15383&lt;br /&gt;
| 0.505&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0181500]]&lt;br /&gt;
| 7.751&lt;br /&gt;
| 12230&lt;br /&gt;
| 0.634&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 13:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0814200]]&lt;br /&gt;
| 7.743&lt;br /&gt;
| 13379&lt;br /&gt;
| 0.579&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0306400]]&lt;br /&gt;
| 7.71&lt;br /&gt;
| 12551&lt;br /&gt;
| 0.614&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0103800]]&lt;br /&gt;
| 7.686&lt;br /&gt;
| 7686&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 14:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0225100]]&lt;br /&gt;
| 7.669&lt;br /&gt;
| 12296&lt;br /&gt;
| 0.624&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Pi1]]&lt;br /&gt;
| 7.644&lt;br /&gt;
| 7644&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/5 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0307500]]&lt;br /&gt;
| 7.639&lt;br /&gt;
| 7639&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/7 21:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0648000]]&lt;br /&gt;
| 7.638&lt;br /&gt;
| 15767&lt;br /&gt;
| 0.484&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0442400]]&lt;br /&gt;
| 7.638&lt;br /&gt;
| 7638&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Chalk5]]&lt;br /&gt;
| 7.635&lt;br /&gt;
| 7635&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/29 11:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0140300]]&lt;br /&gt;
| 7.633&lt;br /&gt;
| 13769&lt;br /&gt;
| 0.554&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0622900]]&lt;br /&gt;
| 7.632&lt;br /&gt;
| 14288&lt;br /&gt;
| 0.534&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0292200]]&lt;br /&gt;
| 7.626&lt;br /&gt;
| 12859&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0230500]]&lt;br /&gt;
| 7.618&lt;br /&gt;
| 14126&lt;br /&gt;
| 0.539&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0472500]]&lt;br /&gt;
| 7.581&lt;br /&gt;
| 13819&lt;br /&gt;
| 0.549&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[RPA2]]&lt;br /&gt;
| 7.58&lt;br /&gt;
| 7580&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/21 13:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0262900]]&lt;br /&gt;
| 7.571&lt;br /&gt;
| 15719&lt;br /&gt;
| 0.482&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0107700]]&lt;br /&gt;
| 7.533&lt;br /&gt;
| 7533&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/6 9:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g57310]]&lt;br /&gt;
| 7.531&lt;br /&gt;
| 7531&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 14:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0104200]]&lt;br /&gt;
| 7.502&lt;br /&gt;
| 15399&lt;br /&gt;
| 0.487&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0142600]]&lt;br /&gt;
| 7.492&lt;br /&gt;
| 11545&lt;br /&gt;
| 0.649&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0788500]]&lt;br /&gt;
| 7.454&lt;br /&gt;
| 10159&lt;br /&gt;
| 0.734&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0139000]]&lt;br /&gt;
| 7.443&lt;br /&gt;
| 15282&lt;br /&gt;
| 0.487&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0168600]]&lt;br /&gt;
| 7.43&lt;br /&gt;
| 12348&lt;br /&gt;
| 0.602&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0669400]]&lt;br /&gt;
| 7.383&lt;br /&gt;
| 7383&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0117400]]&lt;br /&gt;
| 7.353&lt;br /&gt;
| 11607&lt;br /&gt;
| 0.633&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0223400]]&lt;br /&gt;
| 7.313&lt;br /&gt;
| 14417&lt;br /&gt;
| 0.507&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 13:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0731200]]&lt;br /&gt;
| 7.311&lt;br /&gt;
| 14927&lt;br /&gt;
| 0.49&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g02650]]&lt;br /&gt;
| 7.302&lt;br /&gt;
| 7302&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 19:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0859300]]&lt;br /&gt;
| 7.265&lt;br /&gt;
| 12246&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0105000]]&lt;br /&gt;
| 7.237&lt;br /&gt;
| 15311&lt;br /&gt;
| 0.473&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 17:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0110800]]&lt;br /&gt;
| 7.203&lt;br /&gt;
| 14838&lt;br /&gt;
| 0.485&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0367100]]&lt;br /&gt;
| 7.2&lt;br /&gt;
| 12561&lt;br /&gt;
| 0.573&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/9 9:53&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0191600]]&lt;br /&gt;
| 7.2&lt;br /&gt;
| 13785&lt;br /&gt;
| 0.522&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0137250]]&lt;br /&gt;
| 7.185&lt;br /&gt;
| 14660&lt;br /&gt;
| 0.49&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0220400]]&lt;br /&gt;
| 7.158&lt;br /&gt;
| 17791&lt;br /&gt;
| 0.402&lt;br /&gt;
| 6&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/5/14 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0404500]]&lt;br /&gt;
| 7.151&lt;br /&gt;
| 7164&lt;br /&gt;
| 0.998&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/7 23:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0177200]]&lt;br /&gt;
| 7.15&lt;br /&gt;
| 9017&lt;br /&gt;
| 0.793&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0504700]]&lt;br /&gt;
| 7.149&lt;br /&gt;
| 10763&lt;br /&gt;
| 0.664&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0496900]]&lt;br /&gt;
| 7.143&lt;br /&gt;
| 14022&lt;br /&gt;
| 0.509&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0313400]]&lt;br /&gt;
| 7.12&lt;br /&gt;
| 14554&lt;br /&gt;
| 0.489&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0117000]]&lt;br /&gt;
| 7.092&lt;br /&gt;
| 8202&lt;br /&gt;
| 0.865&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0127600]]&lt;br /&gt;
| 7.065&lt;br /&gt;
| 12576&lt;br /&gt;
| 0.562&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0531700]]&lt;br /&gt;
| 7.054&lt;br /&gt;
| 13276&lt;br /&gt;
| 0.531&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0499500]]&lt;br /&gt;
| 7.051&lt;br /&gt;
| 12958&lt;br /&gt;
| 0.544&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0188400]]&lt;br /&gt;
| 7.05&lt;br /&gt;
| 12067&lt;br /&gt;
| 0.584&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0649900]]&lt;br /&gt;
| 7.031&lt;br /&gt;
| 12503&lt;br /&gt;
| 0.562&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0442700]]&lt;br /&gt;
| 7.028&lt;br /&gt;
| 10589&lt;br /&gt;
| 0.664&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0438600]]&lt;br /&gt;
| 7.022&lt;br /&gt;
| 14835&lt;br /&gt;
| 0.473&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0124700]]&lt;br /&gt;
| 6.998&lt;br /&gt;
| 14469&lt;br /&gt;
| 0.484&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0126100]]&lt;br /&gt;
| 6.985&lt;br /&gt;
| 6985&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0662200]]&lt;br /&gt;
| 6.942&lt;br /&gt;
| 12388&lt;br /&gt;
| 0.56&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0639100]]&lt;br /&gt;
| 6.934&lt;br /&gt;
| 11269&lt;br /&gt;
| 0.615&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0167800]]&lt;br /&gt;
| 6.92&lt;br /&gt;
| 10521&lt;br /&gt;
| 0.658&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0615050]]&lt;br /&gt;
| 6.92&lt;br /&gt;
| 9869&lt;br /&gt;
| 0.701&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0610200]]&lt;br /&gt;
| 6.911&lt;br /&gt;
| 12604&lt;br /&gt;
| 0.548&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0587400]]&lt;br /&gt;
| 6.901&lt;br /&gt;
| 8826&lt;br /&gt;
| 0.782&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0123300]]&lt;br /&gt;
| 6.87&lt;br /&gt;
| 15272&lt;br /&gt;
| 0.45&lt;br /&gt;
| 4&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/6/12 13:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0727200]]&lt;br /&gt;
| 6.864&lt;br /&gt;
| 13184&lt;br /&gt;
| 0.521&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0682800]]&lt;br /&gt;
| 6.853&lt;br /&gt;
| 13550&lt;br /&gt;
| 0.506&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0446000]]&lt;br /&gt;
| 6.838&lt;br /&gt;
| 13942&lt;br /&gt;
| 0.49&lt;br /&gt;
| 5&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0182900]]&lt;br /&gt;
| 6.821&lt;br /&gt;
| 13295&lt;br /&gt;
| 0.513&lt;br /&gt;
| 5&lt;br /&gt;
| 11&lt;br /&gt;
| 2015/6/12 16:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0205700]]&lt;br /&gt;
| 6.813&lt;br /&gt;
| 12490&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0333200]]&lt;br /&gt;
| 6.778&lt;br /&gt;
| 8703&lt;br /&gt;
| 0.779&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/9 9:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0167600]]&lt;br /&gt;
| 6.756&lt;br /&gt;
| 14570&lt;br /&gt;
| 0.464&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0227800]]&lt;br /&gt;
| 6.744&lt;br /&gt;
| 10826&lt;br /&gt;
| 0.623&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0567400]]&lt;br /&gt;
| 6.732&lt;br /&gt;
| 13437&lt;br /&gt;
| 0.501&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:58&lt;br /&gt;
|-&lt;br /&gt;
|[[DEP2]]&lt;br /&gt;
| 6.724&lt;br /&gt;
| 6763&lt;br /&gt;
| 0.994&lt;br /&gt;
| 3&lt;br /&gt;
| 7&lt;br /&gt;
| 2014/6/10 22:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0592600]]&lt;br /&gt;
| 6.72&lt;br /&gt;
| 15320&lt;br /&gt;
| 0.439&lt;br /&gt;
| 5&lt;br /&gt;
| 11&lt;br /&gt;
| 2015/6/12 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0323700]]&lt;br /&gt;
| 6.709&lt;br /&gt;
| 11315&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:29&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0126900]]&lt;br /&gt;
| 6.705&lt;br /&gt;
| 6705&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 12:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0561600]]&lt;br /&gt;
| 6.699&lt;br /&gt;
| 11352&lt;br /&gt;
| 0.59&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/13 16:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Sub1A]]&lt;br /&gt;
| 6.679&lt;br /&gt;
| 6679&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/4 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0126300]]&lt;br /&gt;
| 6.658&lt;br /&gt;
| 13730&lt;br /&gt;
| 0.485&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0472000]]&lt;br /&gt;
| 6.592&lt;br /&gt;
| 12098&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0117400]]&lt;br /&gt;
| 6.569&lt;br /&gt;
| 6850&lt;br /&gt;
| 0.959&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0533600]]&lt;br /&gt;
| 6.522&lt;br /&gt;
| 8207&lt;br /&gt;
| 0.795&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0397400]]&lt;br /&gt;
| 6.52&lt;br /&gt;
| 11105&lt;br /&gt;
| 0.587&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0712700]]&lt;br /&gt;
| 6.51&lt;br /&gt;
| 7624&lt;br /&gt;
| 0.854&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/9 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0237000]]&lt;br /&gt;
| 6.46&lt;br /&gt;
| 6460&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 18:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0811000]]&lt;br /&gt;
| 6.453&lt;br /&gt;
| 11487&lt;br /&gt;
| 0.562&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0505200]]&lt;br /&gt;
| 6.444&lt;br /&gt;
| 6444&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/13 9:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0247300]]&lt;br /&gt;
| 6.442&lt;br /&gt;
| 13081&lt;br /&gt;
| 0.492&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0687700]]&lt;br /&gt;
| 6.434&lt;br /&gt;
| 7690&lt;br /&gt;
| 0.837&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0569700]]&lt;br /&gt;
| 6.412&lt;br /&gt;
| 13859&lt;br /&gt;
| 0.463&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[AY986492]]&lt;br /&gt;
| 6.408&lt;br /&gt;
| 6408&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/10 21:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0700700]]&lt;br /&gt;
| 6.404&lt;br /&gt;
| 6404&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 20:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0771400]]&lt;br /&gt;
| 6.399&lt;br /&gt;
| 6702&lt;br /&gt;
| 0.955&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/5/12 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0127800]]&lt;br /&gt;
| 6.393&lt;br /&gt;
| 10797&lt;br /&gt;
| 0.592&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0120500]]&lt;br /&gt;
| 6.372&lt;br /&gt;
| 6372&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/5/14 13:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0854500]]&lt;br /&gt;
| 6.367&lt;br /&gt;
| 10086&lt;br /&gt;
| 0.631&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0275000]]&lt;br /&gt;
| 6.307&lt;br /&gt;
| 11994&lt;br /&gt;
| 0.526&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0561000]]&lt;br /&gt;
| 6.249&lt;br /&gt;
| 12468&lt;br /&gt;
| 0.501&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0759800]]&lt;br /&gt;
| 6.249&lt;br /&gt;
| 12883&lt;br /&gt;
| 0.485&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0101000]]&lt;br /&gt;
| 6.239&lt;br /&gt;
| 10862&lt;br /&gt;
| 0.574&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0456200]]&lt;br /&gt;
| 6.23&lt;br /&gt;
| 10901&lt;br /&gt;
| 0.572&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0101600]]&lt;br /&gt;
| 6.221&lt;br /&gt;
| 35095&lt;br /&gt;
| 0.177&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/5/31 21:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0695800]]&lt;br /&gt;
| 6.213&lt;br /&gt;
| 8582&lt;br /&gt;
| 0.724&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[LOC_Os08g30910]]&lt;br /&gt;
| 6.211&lt;br /&gt;
| 6211&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 22:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0606700]]&lt;br /&gt;
| 6.198&lt;br /&gt;
| 12432&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0210300]]&lt;br /&gt;
| 6.196&lt;br /&gt;
| 12384&lt;br /&gt;
| 0.5&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0736400]]&lt;br /&gt;
| 6.183&lt;br /&gt;
| 11839&lt;br /&gt;
| 0.522&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0549100]]&lt;br /&gt;
| 6.175&lt;br /&gt;
| 10093&lt;br /&gt;
| 0.612&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0452200]]&lt;br /&gt;
| 6.171&lt;br /&gt;
| 11987&lt;br /&gt;
| 0.515&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0170300]]&lt;br /&gt;
| 6.166&lt;br /&gt;
| 12582&lt;br /&gt;
| 0.49&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/14 13:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0224700]]&lt;br /&gt;
| 6.166&lt;br /&gt;
| 11925&lt;br /&gt;
| 0.517&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 13:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0508500]]&lt;br /&gt;
| 6.13&lt;br /&gt;
| 7194&lt;br /&gt;
| 0.852&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0558500]]&lt;br /&gt;
| 6.078&lt;br /&gt;
| 12744&lt;br /&gt;
| 0.477&lt;br /&gt;
| 5&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/12 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0511000]]&lt;br /&gt;
| 6.076&lt;br /&gt;
| 12097&lt;br /&gt;
| 0.502&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:35&lt;br /&gt;
|-&lt;br /&gt;
|[[OsWRKY13]]&lt;br /&gt;
| 6.069&lt;br /&gt;
| 6101&lt;br /&gt;
| 0.995&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/4 20:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0308100]]&lt;br /&gt;
| 6.062&lt;br /&gt;
| 12455&lt;br /&gt;
| 0.487&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0113700]]&lt;br /&gt;
| 5.961&lt;br /&gt;
| 12261&lt;br /&gt;
| 0.486&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0113100]]&lt;br /&gt;
| 5.915&lt;br /&gt;
| 5915&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0656600]]&lt;br /&gt;
| 5.915&lt;br /&gt;
| 10022&lt;br /&gt;
| 0.59&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0600400]]&lt;br /&gt;
| 5.902&lt;br /&gt;
| 7925&lt;br /&gt;
| 0.745&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0733200]]&lt;br /&gt;
| 5.889&lt;br /&gt;
| 5889&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 11:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0785400]]&lt;br /&gt;
| 5.864&lt;br /&gt;
| 10600&lt;br /&gt;
| 0.553&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0541700]]&lt;br /&gt;
| 5.857&lt;br /&gt;
| 6037&lt;br /&gt;
| 0.97&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/8 16:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0140500]]&lt;br /&gt;
| 5.829&lt;br /&gt;
| 11343&lt;br /&gt;
| 0.514&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:26&lt;br /&gt;
|-&lt;br /&gt;
|[[IPK1]]&lt;br /&gt;
| 5.803&lt;br /&gt;
| 5803&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 16:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0434200]]&lt;br /&gt;
| 5.792&lt;br /&gt;
| 11879&lt;br /&gt;
| 0.488&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0522100]]&lt;br /&gt;
| 5.713&lt;br /&gt;
| 9270&lt;br /&gt;
| 0.616&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0417600]]&lt;br /&gt;
| 5.713&lt;br /&gt;
| 10209&lt;br /&gt;
| 0.56&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0177900]]&lt;br /&gt;
| 5.693&lt;br /&gt;
| 11327&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0149800]]&lt;br /&gt;
| 5.681&lt;br /&gt;
| 11452&lt;br /&gt;
| 0.496&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0831000]]&lt;br /&gt;
| 5.68&lt;br /&gt;
| 9517&lt;br /&gt;
| 0.597&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0103900]]&lt;br /&gt;
| 5.674&lt;br /&gt;
| 5674&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 16:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0580500]]&lt;br /&gt;
| 5.66&lt;br /&gt;
| 5660&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/23 11:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0693800]]&lt;br /&gt;
| 5.613&lt;br /&gt;
| 11290&lt;br /&gt;
| 0.497&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[OsCERK1]]&lt;br /&gt;
| 5.61&lt;br /&gt;
| 5610&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 18:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0586100]]&lt;br /&gt;
| 5.609&lt;br /&gt;
| 6240&lt;br /&gt;
| 0.899&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0116200]]&lt;br /&gt;
| 5.602&lt;br /&gt;
| 7206&lt;br /&gt;
| 0.777&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0678600]]&lt;br /&gt;
| 5.575&lt;br /&gt;
| 11240&lt;br /&gt;
| 0.496&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0567800]]&lt;br /&gt;
| 5.558&lt;br /&gt;
| 5558&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0610350]]&lt;br /&gt;
| 5.547&lt;br /&gt;
| 5547&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 13:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0657000]]&lt;br /&gt;
| 5.536&lt;br /&gt;
| 9210&lt;br /&gt;
| 0.601&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Wbph8]]&lt;br /&gt;
| 5.531&lt;br /&gt;
| 5531&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 18:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0563300]]&lt;br /&gt;
| 5.487&lt;br /&gt;
| 11105&lt;br /&gt;
| 0.494&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0701700]]&lt;br /&gt;
| 5.432&lt;br /&gt;
| 8295&lt;br /&gt;
| 0.655&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0419200]]&lt;br /&gt;
| 5.432&lt;br /&gt;
| 9118&lt;br /&gt;
| 0.596&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[OsCEBiP]]&lt;br /&gt;
| 5.419&lt;br /&gt;
| 5419&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 12:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa10]]&lt;br /&gt;
| 5.416&lt;br /&gt;
| 5416&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 16:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0272300]]&lt;br /&gt;
| 5.41&lt;br /&gt;
| 9862&lt;br /&gt;
| 0.549&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0117900]]&lt;br /&gt;
| 5.381&lt;br /&gt;
| 8815&lt;br /&gt;
| 0.61&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0528300]]&lt;br /&gt;
| 5.364&lt;br /&gt;
| 9566&lt;br /&gt;
| 0.561&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Badh2]]&lt;br /&gt;
| 5.363&lt;br /&gt;
| 5363&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 19:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0233900]]&lt;br /&gt;
| 5.348&lt;br /&gt;
| 9011&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa21]]&lt;br /&gt;
| 5.345&lt;br /&gt;
| 5345&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Bls1]]&lt;br /&gt;
| 5.308&lt;br /&gt;
| 5308&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 15:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0157700]]&lt;br /&gt;
| 5.304&lt;br /&gt;
| 10277&lt;br /&gt;
| 0.516&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0260200]]&lt;br /&gt;
| 5.302&lt;br /&gt;
| 7745&lt;br /&gt;
| 0.685&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0232600]]&lt;br /&gt;
| 5.249&lt;br /&gt;
| 10595&lt;br /&gt;
| 0.495&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0125100]]&lt;br /&gt;
| 5.183&lt;br /&gt;
| 10331&lt;br /&gt;
| 0.502&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0212900]]&lt;br /&gt;
| 5.175&lt;br /&gt;
| 6651&lt;br /&gt;
| 0.778&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0491300]]&lt;br /&gt;
| 5.166&lt;br /&gt;
| 10047&lt;br /&gt;
| 0.514&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0470500]]&lt;br /&gt;
| 5.144&lt;br /&gt;
| 9661&lt;br /&gt;
| 0.532&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0439800]]&lt;br /&gt;
| 5.122&lt;br /&gt;
| 8022&lt;br /&gt;
| 0.638&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 17:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0555500]]&lt;br /&gt;
| 5.108&lt;br /&gt;
| 8929&lt;br /&gt;
| 0.572&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0129200]]&lt;br /&gt;
| 5.081&lt;br /&gt;
| 5081&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0508600]]&lt;br /&gt;
| 5.066&lt;br /&gt;
| 7754&lt;br /&gt;
| 0.653&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0174500]]&lt;br /&gt;
| 5.017&lt;br /&gt;
| 9397&lt;br /&gt;
| 0.534&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:28&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0267200]]&lt;br /&gt;
| 5.008&lt;br /&gt;
| 7991&lt;br /&gt;
| 0.627&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0622700]]&lt;br /&gt;
| 5&lt;br /&gt;
| 9868&lt;br /&gt;
| 0.507&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[SBP]]&lt;br /&gt;
| 4.997&lt;br /&gt;
| 4997&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/21 18:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0465800]]&lt;br /&gt;
| 4.939&lt;br /&gt;
| 4939&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0491000]]&lt;br /&gt;
| 4.912&lt;br /&gt;
| 8991&lt;br /&gt;
| 0.546&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0206700]]&lt;br /&gt;
| 4.909&lt;br /&gt;
| 9664&lt;br /&gt;
| 0.508&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0132100]]&lt;br /&gt;
| 4.9&lt;br /&gt;
| 4900&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0643300]]&lt;br /&gt;
| 4.869&lt;br /&gt;
| 7953&lt;br /&gt;
| 0.612&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0180800]]&lt;br /&gt;
| 4.859&lt;br /&gt;
| 8158&lt;br /&gt;
| 0.596&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:04&lt;br /&gt;
|-&lt;br /&gt;
|[[BPH_gene]]&lt;br /&gt;
| 4.857&lt;br /&gt;
| 4857&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/11 11:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0805600]]&lt;br /&gt;
| 4.842&lt;br /&gt;
| 4842&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/5 18:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0701600]]&lt;br /&gt;
| 4.831&lt;br /&gt;
| 7482&lt;br /&gt;
| 0.646&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0531600]]&lt;br /&gt;
| 4.818&lt;br /&gt;
| 4825&lt;br /&gt;
| 0.999&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/5/27 23:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0139000]]&lt;br /&gt;
| 4.811&lt;br /&gt;
| 9008&lt;br /&gt;
| 0.534&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0254700]]&lt;br /&gt;
| 4.802&lt;br /&gt;
| 7514&lt;br /&gt;
| 0.639&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0615100]]&lt;br /&gt;
| 4.794&lt;br /&gt;
| 7379&lt;br /&gt;
| 0.65&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:19&lt;br /&gt;
|-&lt;br /&gt;
|[[HSF]]&lt;br /&gt;
| 4.772&lt;br /&gt;
| 4781&lt;br /&gt;
| 0.998&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/21 20:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0125800]]&lt;br /&gt;
| 4.629&lt;br /&gt;
| 9410&lt;br /&gt;
| 0.492&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0628500]]&lt;br /&gt;
| 4.606&lt;br /&gt;
| 8573&lt;br /&gt;
| 0.537&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0433500]]&lt;br /&gt;
| 4.582&lt;br /&gt;
| 4582&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0694700]]&lt;br /&gt;
| 4.569&lt;br /&gt;
| 8480&lt;br /&gt;
| 0.539&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0293100]]&lt;br /&gt;
| 4.568&lt;br /&gt;
| 8480&lt;br /&gt;
| 0.539&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Rl14]]&lt;br /&gt;
| 4.564&lt;br /&gt;
| 4764&lt;br /&gt;
| 0.958&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/10 11:19&lt;br /&gt;
|-&lt;br /&gt;
|[[OsRPA2]]&lt;br /&gt;
| 4.552&lt;br /&gt;
| 4552&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 9:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0604000]]&lt;br /&gt;
| 4.53&lt;br /&gt;
| 8229&lt;br /&gt;
| 0.55&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0192000]]&lt;br /&gt;
| 4.527&lt;br /&gt;
| 4527&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/7/30 23:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0922800]]&lt;br /&gt;
| 4.506&lt;br /&gt;
| 4506&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 18:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0787300]]&lt;br /&gt;
| 4.483&lt;br /&gt;
| 6886&lt;br /&gt;
| 0.651&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0439200]]&lt;br /&gt;
| 4.477&lt;br /&gt;
| 8745&lt;br /&gt;
| 0.512&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0580800]]&lt;br /&gt;
| 4.463&lt;br /&gt;
| 4463&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0822900]]&lt;br /&gt;
| 4.447&lt;br /&gt;
| 7550&lt;br /&gt;
| 0.589&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/13 15:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0167500]]&lt;br /&gt;
| 4.432&lt;br /&gt;
| 8906&lt;br /&gt;
| 0.498&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Sucrose_synthase]]&lt;br /&gt;
| 4.428&lt;br /&gt;
| 4436&lt;br /&gt;
| 0.998&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/18 11:20&lt;br /&gt;
|-&lt;br /&gt;
|[[CL971152]]&lt;br /&gt;
| 4.417&lt;br /&gt;
| 4472&lt;br /&gt;
| 0.988&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/10 21:51&lt;br /&gt;
|-&lt;br /&gt;
|[[GID1]]&lt;br /&gt;
| 4.384&lt;br /&gt;
| 4384&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 21:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0603700]]&lt;br /&gt;
| 4.375&lt;br /&gt;
| 9322&lt;br /&gt;
| 0.469&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[GS3]]&lt;br /&gt;
| 4.372&lt;br /&gt;
| 4372&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 20:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0618400]]&lt;br /&gt;
| 4.347&lt;br /&gt;
| 8707&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0182800]]&lt;br /&gt;
| 4.322&lt;br /&gt;
| 6519&lt;br /&gt;
| 0.663&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:05&lt;br /&gt;
|-&lt;br /&gt;
|[[ARF]]&lt;br /&gt;
| 4.308&lt;br /&gt;
| 4308&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/21 20:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0183000]]&lt;br /&gt;
| 4.286&lt;br /&gt;
| 4286&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 20:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0654700]]&lt;br /&gt;
| 4.285&lt;br /&gt;
| 8306&lt;br /&gt;
| 0.516&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0466400]]&lt;br /&gt;
| 4.265&lt;br /&gt;
| 8095&lt;br /&gt;
| 0.527&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0103300]]&lt;br /&gt;
| 4.188&lt;br /&gt;
| 7457&lt;br /&gt;
| 0.562&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0100150]]&lt;br /&gt;
| 4.188&lt;br /&gt;
| 4188&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0111500]]&lt;br /&gt;
| 4.119&lt;br /&gt;
| 4375&lt;br /&gt;
| 0.941&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0834400]]&lt;br /&gt;
| 4.109&lt;br /&gt;
| 4109&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 19:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0512200]]&lt;br /&gt;
| 4.095&lt;br /&gt;
| 7690&lt;br /&gt;
| 0.533&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Bph9]]&lt;br /&gt;
| 4.084&lt;br /&gt;
| 4084&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 12:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0181700]]&lt;br /&gt;
| 4.083&lt;br /&gt;
| 7433&lt;br /&gt;
| 0.549&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0222600]]&lt;br /&gt;
| 4.023&lt;br /&gt;
| 6741&lt;br /&gt;
| 0.597&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0157500]]&lt;br /&gt;
| 4.013&lt;br /&gt;
| 7888&lt;br /&gt;
| 0.509&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0537700]]&lt;br /&gt;
| 3.992&lt;br /&gt;
| 6731&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0610500]]&lt;br /&gt;
| 3.946&lt;br /&gt;
| 3946&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/20 11:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0529600]]&lt;br /&gt;
| 3.915&lt;br /&gt;
| 6908&lt;br /&gt;
| 0.567&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[LTN1]]&lt;br /&gt;
| 3.869&lt;br /&gt;
| 3869&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/5 23:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0106700]]&lt;br /&gt;
| 3.845&lt;br /&gt;
| 6498&lt;br /&gt;
| 0.592&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0568700]]&lt;br /&gt;
| 3.845&lt;br /&gt;
| 6600&lt;br /&gt;
| 0.583&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0123700]]&lt;br /&gt;
| 3.826&lt;br /&gt;
| 6076&lt;br /&gt;
| 0.63&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0441100]]&lt;br /&gt;
| 3.819&lt;br /&gt;
| 7418&lt;br /&gt;
| 0.515&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Pik-p]]&lt;br /&gt;
| 3.816&lt;br /&gt;
| 3816&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 10:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0493100]]&lt;br /&gt;
| 3.804&lt;br /&gt;
| 7241&lt;br /&gt;
| 0.525&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0552700]]&lt;br /&gt;
| 3.779&lt;br /&gt;
| 6604&lt;br /&gt;
| 0.572&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0100500]]&lt;br /&gt;
| 3.729&lt;br /&gt;
| 5669&lt;br /&gt;
| 0.658&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0129200]]&lt;br /&gt;
| 3.716&lt;br /&gt;
| 6629&lt;br /&gt;
| 0.561&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0558900]]&lt;br /&gt;
| 3.699&lt;br /&gt;
| 7398&lt;br /&gt;
| 0.5&lt;br /&gt;
| 5&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0177400]]&lt;br /&gt;
| 3.693&lt;br /&gt;
| 6293&lt;br /&gt;
| 0.587&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 14:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0380200]]&lt;br /&gt;
| 3.69&lt;br /&gt;
| 6890&lt;br /&gt;
| 0.536&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0163400]]&lt;br /&gt;
| 3.662&lt;br /&gt;
| 3662&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 20:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0665800]]&lt;br /&gt;
| 3.593&lt;br /&gt;
| 3593&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/2 15:50&lt;br /&gt;
|-&lt;br /&gt;
|[[QGL3]]&lt;br /&gt;
| 3.57&lt;br /&gt;
| 3570&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/20 23:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Qsw5]]&lt;br /&gt;
| 3.512&lt;br /&gt;
| 3512&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/7 22:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0225300]]&lt;br /&gt;
| 3.493&lt;br /&gt;
| 4174&lt;br /&gt;
| 0.837&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0112400]]&lt;br /&gt;
| 3.44&lt;br /&gt;
| 6824&lt;br /&gt;
| 0.504&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0396900]]&lt;br /&gt;
| 3.437&lt;br /&gt;
| 6527&lt;br /&gt;
| 0.527&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0633300]]&lt;br /&gt;
| 3.406&lt;br /&gt;
| 4141&lt;br /&gt;
| 0.823&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0786400]]&lt;br /&gt;
| 3.372&lt;br /&gt;
| 3372&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/20 0:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Bhp-3]]&lt;br /&gt;
| 3.33&lt;br /&gt;
| 3330&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 23:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0513200]]&lt;br /&gt;
| 3.31&lt;br /&gt;
| 34126&lt;br /&gt;
| 0.097&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0133700]]&lt;br /&gt;
| 3.237&lt;br /&gt;
| 3237&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0641200]]&lt;br /&gt;
| 3.212&lt;br /&gt;
| 6389&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0549600]]&lt;br /&gt;
| 3.204&lt;br /&gt;
| 5875&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Bph27]]&lt;br /&gt;
| 3.194&lt;br /&gt;
| 3194&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 15:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0573450]]&lt;br /&gt;
| 3.13&lt;br /&gt;
| 3130&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0582500]]&lt;br /&gt;
| 3.13&lt;br /&gt;
| 5666&lt;br /&gt;
| 0.552&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0135700]]&lt;br /&gt;
| 3.126&lt;br /&gt;
| 3126&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/7 0:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0459200]]&lt;br /&gt;
| 3.094&lt;br /&gt;
| 5090&lt;br /&gt;
| 0.608&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0523700]]&lt;br /&gt;
| 3.071&lt;br /&gt;
| 3079&lt;br /&gt;
| 0.997&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/3 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0522200]]&lt;br /&gt;
| 3.031&lt;br /&gt;
| 5920&lt;br /&gt;
| 0.512&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 22:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0127100]]&lt;br /&gt;
| 3.015&lt;br /&gt;
| 5846&lt;br /&gt;
| 0.516&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0573400]]&lt;br /&gt;
| 3.009&lt;br /&gt;
| 6148&lt;br /&gt;
| 0.489&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 16:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0282000]]&lt;br /&gt;
| 2.99&lt;br /&gt;
| 4364&lt;br /&gt;
| 0.685&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[OsDPR]]&lt;br /&gt;
| 2.951&lt;br /&gt;
| 2951&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/11 9:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0118800]]&lt;br /&gt;
| 2.824&lt;br /&gt;
| 2824&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0422100]]&lt;br /&gt;
| 2.806&lt;br /&gt;
| 3394&lt;br /&gt;
| 0.827&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0274800]]&lt;br /&gt;
| 2.805&lt;br /&gt;
| 2805&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/28 21:34&lt;br /&gt;
|-&lt;br /&gt;
|[[BGIOSGA033504]]&lt;br /&gt;
| 2.803&lt;br /&gt;
| 2818&lt;br /&gt;
| 0.995&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/3 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0454000]]&lt;br /&gt;
| 2.786&lt;br /&gt;
| 5342&lt;br /&gt;
| 0.522&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Ygl1]]&lt;br /&gt;
| 2.729&lt;br /&gt;
| 2729&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 22:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0148000]]&lt;br /&gt;
| 2.697&lt;br /&gt;
| 5106&lt;br /&gt;
| 0.528&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0566600]]&lt;br /&gt;
| 2.632&lt;br /&gt;
| 4314&lt;br /&gt;
| 0.61&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0150200]]&lt;br /&gt;
| 2.621&lt;br /&gt;
| 5115&lt;br /&gt;
| 0.512&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:03&lt;br /&gt;
|-&lt;br /&gt;
|[[SCM2]]&lt;br /&gt;
| 2.618&lt;br /&gt;
| 2618&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 14:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0341600]]&lt;br /&gt;
| 2.592&lt;br /&gt;
| 2640&lt;br /&gt;
| 0.982&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/1 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[STR2]]&lt;br /&gt;
| 2.541&lt;br /&gt;
| 2541&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/11 19:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0248900]]&lt;br /&gt;
| 2.537&lt;br /&gt;
| 5733&lt;br /&gt;
| 0.443&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0100200]]&lt;br /&gt;
| 2.251&lt;br /&gt;
| 2918&lt;br /&gt;
| 0.771&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa33(t)]]&lt;br /&gt;
| 2.219&lt;br /&gt;
| 2219&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/12 23:54&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g47210]]&lt;br /&gt;
| 2.152&lt;br /&gt;
| 2152&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 17:23&lt;br /&gt;
|-&lt;br /&gt;
|[[TestTemplate]]&lt;br /&gt;
| 2.146&lt;br /&gt;
| 2146&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/5/7 11:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0568500]]&lt;br /&gt;
| 2.145&lt;br /&gt;
| 2832&lt;br /&gt;
| 0.757&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Du-1]]&lt;br /&gt;
| 2.102&lt;br /&gt;
| 2102&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/14 15:22&lt;br /&gt;
|-&lt;br /&gt;
|[[OS08G0523000]]&lt;br /&gt;
| 2.006&lt;br /&gt;
| 2006&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/26 22:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0492000]]&lt;br /&gt;
| 1.777&lt;br /&gt;
| 1777&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 23:45&lt;br /&gt;
|-&lt;br /&gt;
|[[AU030811]]&lt;br /&gt;
| 1.776&lt;br /&gt;
| 1776&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 21:33&lt;br /&gt;
|-&lt;br /&gt;
|[[GS6]]&lt;br /&gt;
| 1.7&lt;br /&gt;
| 1700&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/15 20:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Brown_planthopper_resistance-1]]&lt;br /&gt;
| 1.584&lt;br /&gt;
| 1584&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 14:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0741100]]&lt;br /&gt;
| 1.578&lt;br /&gt;
| 1578&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/19 3:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0102100]]&lt;br /&gt;
| 1.347&lt;br /&gt;
| 1347&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 19:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0401300]]&lt;br /&gt;
| 1.308&lt;br /&gt;
| 1308&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/14 14:15&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Curated_Genes&amp;diff=271009</id>
		<title>Curated Genes</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Curated_Genes&amp;diff=271009"/>
				<updated>2016-06-25T07:06:44Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{|class=&amp;quot;wikitable sortable&amp;quot; style=&amp;quot;width:90%;text-align:center&amp;quot;  &lt;br /&gt;
|-&lt;br /&gt;
!'''Gene'''&lt;br /&gt;
!'''Total Contribution Score'''&lt;br /&gt;
!'''Summed Edit Quantity'''&lt;br /&gt;
!'''Averaged Edit Quality'''&lt;br /&gt;
!'''Contributor Count'''&lt;br /&gt;
!'''Edit Count*'''&lt;br /&gt;
!'''Last Edit Time'''&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0457900]]&lt;br /&gt;
| 42.219&lt;br /&gt;
| 42219&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 14:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0208800]]&lt;br /&gt;
| 35.205&lt;br /&gt;
| 40853&lt;br /&gt;
| 0.862&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:09&lt;br /&gt;
|-&lt;br /&gt;
|[[DWARF27]]&lt;br /&gt;
| 31.862&lt;br /&gt;
| 34044&lt;br /&gt;
| 0.936&lt;br /&gt;
| 2&lt;br /&gt;
| 4&lt;br /&gt;
| 2014/6/9 2:23&lt;br /&gt;
|-&lt;br /&gt;
|[[GW5]]&lt;br /&gt;
| 31.812&lt;br /&gt;
| 31817&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/8 22:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0122600]]&lt;br /&gt;
| 31.778&lt;br /&gt;
| 36672&lt;br /&gt;
| 0.867&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Du1]]&lt;br /&gt;
| 26.789&lt;br /&gt;
| 26797&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/5 11:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0771200]]&lt;br /&gt;
| 25.112&lt;br /&gt;
| 106499&lt;br /&gt;
| 0.236&lt;br /&gt;
| 3&lt;br /&gt;
| 14&lt;br /&gt;
| 2015/5/13 15:32&lt;br /&gt;
|-&lt;br /&gt;
|[[IPA1]]&lt;br /&gt;
| 22.636&lt;br /&gt;
| 22636&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 14:57&lt;br /&gt;
|-&lt;br /&gt;
|[[AB013448]]&lt;br /&gt;
| 21.65&lt;br /&gt;
| 21650&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0542100]]&lt;br /&gt;
| 21.515&lt;br /&gt;
| 25382&lt;br /&gt;
| 0.848&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:56&lt;br /&gt;
|-&lt;br /&gt;
|[[MADS]]&lt;br /&gt;
| 21.305&lt;br /&gt;
| 21310&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/7 19:11&lt;br /&gt;
|-&lt;br /&gt;
|[[MYB]]&lt;br /&gt;
| 21.082&lt;br /&gt;
| 21418&lt;br /&gt;
| 0.984&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/16 10:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0272900]]&lt;br /&gt;
| 21.033&lt;br /&gt;
| 24405&lt;br /&gt;
| 0.862&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0848400]]&lt;br /&gt;
| 20.688&lt;br /&gt;
| 31733&lt;br /&gt;
| 0.652&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0441900]]&lt;br /&gt;
| 18.815&lt;br /&gt;
| 18855&lt;br /&gt;
| 0.998&lt;br /&gt;
| 5&lt;br /&gt;
| 5&lt;br /&gt;
| 2014/6/11 0:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0240200]]&lt;br /&gt;
| 18.077&lt;br /&gt;
| 26433&lt;br /&gt;
| 0.684&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0271200]]&lt;br /&gt;
| 18.041&lt;br /&gt;
| 18413&lt;br /&gt;
| 0.98&lt;br /&gt;
| 5&lt;br /&gt;
| 9&lt;br /&gt;
| 2014/6/10 16:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0678500]]&lt;br /&gt;
| 17.989&lt;br /&gt;
| 29118&lt;br /&gt;
| 0.618&lt;br /&gt;
| 6&lt;br /&gt;
| 7&lt;br /&gt;
| 2015/5/13 15:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0332400]]&lt;br /&gt;
| 17.603&lt;br /&gt;
| 17603&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/12/27 21:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0196700]]&lt;br /&gt;
| 17.411&lt;br /&gt;
| 28849&lt;br /&gt;
| 0.604&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0261200]]&lt;br /&gt;
| 17.077&lt;br /&gt;
| 17414&lt;br /&gt;
| 0.981&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/1 17:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa7]]&lt;br /&gt;
| 16.58&lt;br /&gt;
| 16580&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/30 14:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0227700]]&lt;br /&gt;
| 16.238&lt;br /&gt;
| 28577&lt;br /&gt;
| 0.568&lt;br /&gt;
| 4&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Pb1]]&lt;br /&gt;
| 15.987&lt;br /&gt;
| 15987&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 15:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0597000]]&lt;br /&gt;
| 15.897&lt;br /&gt;
| 25737&lt;br /&gt;
| 0.618&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0841500]]&lt;br /&gt;
| 15.635&lt;br /&gt;
| 27885&lt;br /&gt;
| 0.561&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/13 15:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0114500]]&lt;br /&gt;
| 14.854&lt;br /&gt;
| 23746&lt;br /&gt;
| 0.626&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0182600]]&lt;br /&gt;
| 14.75&lt;br /&gt;
| 22705&lt;br /&gt;
| 0.65&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0162100]]&lt;br /&gt;
| 14.743&lt;br /&gt;
| 14743&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 17:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0738900]]&lt;br /&gt;
| 14.365&lt;br /&gt;
| 21439&lt;br /&gt;
| 0.67&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0594600]]&lt;br /&gt;
| 14.147&lt;br /&gt;
| 19008&lt;br /&gt;
| 0.744&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g57340]]&lt;br /&gt;
| 14.08&lt;br /&gt;
| 14080&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/27 20:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0718300]]&lt;br /&gt;
| 14.008&lt;br /&gt;
| 25923&lt;br /&gt;
| 0.54&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 15:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Du2]]&lt;br /&gt;
| 13.964&lt;br /&gt;
| 13964&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/5 11:53&lt;br /&gt;
|-&lt;br /&gt;
|[[OsMYB103L]]&lt;br /&gt;
| 13.96&lt;br /&gt;
| 13960&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/11 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0782100]]&lt;br /&gt;
| 13.897&lt;br /&gt;
| 27151&lt;br /&gt;
| 0.512&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 15:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0498800]]&lt;br /&gt;
| 13.782&lt;br /&gt;
| 17733&lt;br /&gt;
| 0.777&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0706400]]&lt;br /&gt;
| 13.739&lt;br /&gt;
| 20020&lt;br /&gt;
| 0.686&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0398400]]&lt;br /&gt;
| 13.721&lt;br /&gt;
| 13748&lt;br /&gt;
| 0.998&lt;br /&gt;
| 3&lt;br /&gt;
| 6&lt;br /&gt;
| 2014/6/3 16:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0141300]]&lt;br /&gt;
| 13.71&lt;br /&gt;
| 28137&lt;br /&gt;
| 0.487&lt;br /&gt;
| 5&lt;br /&gt;
| 10&lt;br /&gt;
| 2015/5/14 13:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0203800]]&lt;br /&gt;
| 13.693&lt;br /&gt;
| 13693&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0214100]]&lt;br /&gt;
| 13.62&lt;br /&gt;
| 31302&lt;br /&gt;
| 0.435&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:36&lt;br /&gt;
|-&lt;br /&gt;
|[[DWT1]]&lt;br /&gt;
| 13.275&lt;br /&gt;
| 13275&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 12:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0797600]]&lt;br /&gt;
| 13.247&lt;br /&gt;
| 13247&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/25 15:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0883800]]&lt;br /&gt;
| 13.17&lt;br /&gt;
| 24896&lt;br /&gt;
| 0.529&lt;br /&gt;
| 16&lt;br /&gt;
| 41&lt;br /&gt;
| 2016/6/17 17:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0524100]]&lt;br /&gt;
| 13.001&lt;br /&gt;
| 18711&lt;br /&gt;
| 0.695&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0559300]]&lt;br /&gt;
| 12.718&lt;br /&gt;
| 21018&lt;br /&gt;
| 0.605&lt;br /&gt;
| 3&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0225300]]&lt;br /&gt;
| 12.691&lt;br /&gt;
| 23520&lt;br /&gt;
| 0.54&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0155600]]&lt;br /&gt;
| 12.605&lt;br /&gt;
| 18316&lt;br /&gt;
| 0.688&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0607200]]&lt;br /&gt;
| 12.553&lt;br /&gt;
| 19986&lt;br /&gt;
| 0.628&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0616800]]&lt;br /&gt;
| 12.42&lt;br /&gt;
| 26693&lt;br /&gt;
| 0.465&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0546800]]&lt;br /&gt;
| 12.399&lt;br /&gt;
| 23039&lt;br /&gt;
| 0.538&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0102400]]&lt;br /&gt;
| 12.278&lt;br /&gt;
| 17739&lt;br /&gt;
| 0.692&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:13&lt;br /&gt;
|-&lt;br /&gt;
|[[WRKY]]&lt;br /&gt;
| 12.226&lt;br /&gt;
| 12233&lt;br /&gt;
| 0.999&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/5/31 12:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0286400]]&lt;br /&gt;
| 12.133&lt;br /&gt;
| 24113&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0536100]]&lt;br /&gt;
| 11.96&lt;br /&gt;
| 19080&lt;br /&gt;
| 0.627&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0725900]]&lt;br /&gt;
| 11.949&lt;br /&gt;
| 11949&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0725900]]&lt;br /&gt;
| 11.931&lt;br /&gt;
| 16469&lt;br /&gt;
| 0.724&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Waxy_gene]]&lt;br /&gt;
| 11.92&lt;br /&gt;
| 11920&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 21:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0626400]]&lt;br /&gt;
| 11.902&lt;br /&gt;
| 18881&lt;br /&gt;
| 0.63&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0726400]]&lt;br /&gt;
| 11.891&lt;br /&gt;
| 17625&lt;br /&gt;
| 0.675&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0422500]]&lt;br /&gt;
| 11.747&lt;br /&gt;
| 23511&lt;br /&gt;
| 0.5&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0250700]]&lt;br /&gt;
| 11.742&lt;br /&gt;
| 15681&lt;br /&gt;
| 0.749&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0701300]]&lt;br /&gt;
| 11.604&lt;br /&gt;
| 15691&lt;br /&gt;
| 0.74&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0126400]]&lt;br /&gt;
| 11.6&lt;br /&gt;
| 22962&lt;br /&gt;
| 0.505&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0570100]]&lt;br /&gt;
| 11.586&lt;br /&gt;
| 15710&lt;br /&gt;
| 0.737&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0793500]]&lt;br /&gt;
| 11.531&lt;br /&gt;
| 15843&lt;br /&gt;
| 0.728&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0536000]]&lt;br /&gt;
| 11.52&lt;br /&gt;
| 15150&lt;br /&gt;
| 0.76&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0848700]]&lt;br /&gt;
| 11.486&lt;br /&gt;
| 21573&lt;br /&gt;
| 0.532&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/15 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0907900]]&lt;br /&gt;
| 11.483&lt;br /&gt;
| 11485&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/2 17:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0130100]]&lt;br /&gt;
| 11.48&lt;br /&gt;
| 22964&lt;br /&gt;
| 0.5&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0666900]]&lt;br /&gt;
| 11.455&lt;br /&gt;
| 21522&lt;br /&gt;
| 0.532&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0459200]]&lt;br /&gt;
| 11.449&lt;br /&gt;
| 15381&lt;br /&gt;
| 0.744&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0102300]]&lt;br /&gt;
| 11.423&lt;br /&gt;
| 22326&lt;br /&gt;
| 0.512&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0186200]]&lt;br /&gt;
| 11.413&lt;br /&gt;
| 20165&lt;br /&gt;
| 0.566&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0226800]]&lt;br /&gt;
| 11.245&lt;br /&gt;
| 21415&lt;br /&gt;
| 0.525&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0114200]]&lt;br /&gt;
| 11.137&lt;br /&gt;
| 17754&lt;br /&gt;
| 0.627&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0596300]]&lt;br /&gt;
| 11.085&lt;br /&gt;
| 15490&lt;br /&gt;
| 0.716&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0178800]]&lt;br /&gt;
| 11.079&lt;br /&gt;
| 14720&lt;br /&gt;
| 0.753&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0811100]]&lt;br /&gt;
| 11.068&lt;br /&gt;
| 14957&lt;br /&gt;
| 0.74&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0395300]]&lt;br /&gt;
| 11.063&lt;br /&gt;
| 16461&lt;br /&gt;
| 0.672&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g03150]]&lt;br /&gt;
| 10.972&lt;br /&gt;
| 10972&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 12:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0189500]]&lt;br /&gt;
| 10.931&lt;br /&gt;
| 20645&lt;br /&gt;
| 0.529&lt;br /&gt;
| 7&lt;br /&gt;
| 7&lt;br /&gt;
| 2015/6/13 17:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0211200]]&lt;br /&gt;
| 10.925&lt;br /&gt;
| 19995&lt;br /&gt;
| 0.546&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 16:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0100200]]&lt;br /&gt;
| 10.917&lt;br /&gt;
| 21797&lt;br /&gt;
| 0.501&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:17&lt;br /&gt;
|-&lt;br /&gt;
|[[BHLH]]&lt;br /&gt;
| 10.829&lt;br /&gt;
| 10829&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/21 20:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0703900]]&lt;br /&gt;
| 10.813&lt;br /&gt;
| 10898&lt;br /&gt;
| 0.992&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2014/6/9 23:54&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g44260]]&lt;br /&gt;
| 10.787&lt;br /&gt;
| 10787&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 21:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0405500]]&lt;br /&gt;
| 10.742&lt;br /&gt;
| 10877&lt;br /&gt;
| 0.988&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/8 23:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0815100]]&lt;br /&gt;
| 10.722&lt;br /&gt;
| 15783&lt;br /&gt;
| 0.679&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0561400]]&lt;br /&gt;
| 10.656&lt;br /&gt;
| 22236&lt;br /&gt;
| 0.479&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[NAC]]&lt;br /&gt;
| 10.646&lt;br /&gt;
| 10646&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/15 8:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0523800]]&lt;br /&gt;
| 10.633&lt;br /&gt;
| 21943&lt;br /&gt;
| 0.485&lt;br /&gt;
| 6&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/13 17:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0540400]]&lt;br /&gt;
| 10.561&lt;br /&gt;
| 19732&lt;br /&gt;
| 0.535&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0257200]]&lt;br /&gt;
| 10.556&lt;br /&gt;
| 10556&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 16:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0661100]]&lt;br /&gt;
| 10.544&lt;br /&gt;
| 18837&lt;br /&gt;
| 0.56&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0164000]]&lt;br /&gt;
| 10.534&lt;br /&gt;
| 11864&lt;br /&gt;
| 0.888&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:33&lt;br /&gt;
|-&lt;br /&gt;
|[[AF465255.1]]&lt;br /&gt;
| 10.501&lt;br /&gt;
| 10501&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 20:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0476200]]&lt;br /&gt;
| 10.44&lt;br /&gt;
| 17073&lt;br /&gt;
| 0.611&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0497300]]&lt;br /&gt;
| 10.431&lt;br /&gt;
| 18232&lt;br /&gt;
| 0.572&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0108900]]&lt;br /&gt;
| 10.425&lt;br /&gt;
| 20545&lt;br /&gt;
| 0.507&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/12 16:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0215400]]&lt;br /&gt;
| 10.412&lt;br /&gt;
| 14715&lt;br /&gt;
| 0.708&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0174700]]&lt;br /&gt;
| 10.335&lt;br /&gt;
| 21519&lt;br /&gt;
| 0.48&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:28&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0121700]]&lt;br /&gt;
| 10.278&lt;br /&gt;
| 14300&lt;br /&gt;
| 0.719&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0201700]]&lt;br /&gt;
| 10.276&lt;br /&gt;
| 20440&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:03&lt;br /&gt;
|-&lt;br /&gt;
|[[OsCHR4]]&lt;br /&gt;
| 10.24&lt;br /&gt;
| 10240&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/13 21:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0577600]]&lt;br /&gt;
| 10.16&lt;br /&gt;
| 18081&lt;br /&gt;
| 0.562&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0839100]]&lt;br /&gt;
| 10.128&lt;br /&gt;
| 13298&lt;br /&gt;
| 0.762&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0567200]]&lt;br /&gt;
| 10.127&lt;br /&gt;
| 10127&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0237250]]&lt;br /&gt;
| 10.125&lt;br /&gt;
| 14184&lt;br /&gt;
| 0.714&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0133000]]&lt;br /&gt;
| 10.084&lt;br /&gt;
| 22204&lt;br /&gt;
| 0.454&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0805100]]&lt;br /&gt;
| 10.051&lt;br /&gt;
| 13542&lt;br /&gt;
| 0.742&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0621300]]&lt;br /&gt;
| 10.043&lt;br /&gt;
| 11896&lt;br /&gt;
| 0.844&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:46&lt;br /&gt;
|-&lt;br /&gt;
|[[AB013449]]&lt;br /&gt;
| 10.03&lt;br /&gt;
| 10030&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 22:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0605200]]&lt;br /&gt;
| 10.027&lt;br /&gt;
| 19041&lt;br /&gt;
| 0.527&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0194900]]&lt;br /&gt;
| 10.026&lt;br /&gt;
| 20580&lt;br /&gt;
| 0.487&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0764800]]&lt;br /&gt;
| 10.024&lt;br /&gt;
| 18674&lt;br /&gt;
| 0.537&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0111300]]&lt;br /&gt;
| 10.013&lt;br /&gt;
| 12909&lt;br /&gt;
| 0.776&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 12:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0127900]]&lt;br /&gt;
| 10.013&lt;br /&gt;
| 20618&lt;br /&gt;
| 0.486&lt;br /&gt;
| 4&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/6/13 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0644200]]&lt;br /&gt;
| 10.007&lt;br /&gt;
| 15443&lt;br /&gt;
| 0.648&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0171800]]&lt;br /&gt;
| 9.976&lt;br /&gt;
| 10824&lt;br /&gt;
| 0.922&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0662000]]&lt;br /&gt;
| 9.949&lt;br /&gt;
| 19796&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0254600]]&lt;br /&gt;
| 9.94&lt;br /&gt;
| 12129&lt;br /&gt;
| 0.82&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0330100]]&lt;br /&gt;
| 9.935&lt;br /&gt;
| 18990&lt;br /&gt;
| 0.523&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/12 16:13&lt;br /&gt;
|-&lt;br /&gt;
|[[ORF1]]&lt;br /&gt;
| 9.92&lt;br /&gt;
| 9920&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/30 9:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0471100]]&lt;br /&gt;
| 9.898&lt;br /&gt;
| 19356&lt;br /&gt;
| 0.511&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0603000]]&lt;br /&gt;
| 9.889&lt;br /&gt;
| 9889&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 17:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0535200]]&lt;br /&gt;
| 9.858&lt;br /&gt;
| 18774&lt;br /&gt;
| 0.525&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0281300]]&lt;br /&gt;
| 9.857&lt;br /&gt;
| 21855&lt;br /&gt;
| 0.451&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0919400]]&lt;br /&gt;
| 9.837&lt;br /&gt;
| 9837&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/6 17:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0573900]]&lt;br /&gt;
| 9.818&lt;br /&gt;
| 16399&lt;br /&gt;
| 0.599&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0197100]]&lt;br /&gt;
| 9.81&lt;br /&gt;
| 19279&lt;br /&gt;
| 0.509&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/5/13 14:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0216300]]&lt;br /&gt;
| 9.795&lt;br /&gt;
| 13761&lt;br /&gt;
| 0.712&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0102900]]&lt;br /&gt;
| 9.726&lt;br /&gt;
| 9726&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 14:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0249000]]&lt;br /&gt;
| 9.718&lt;br /&gt;
| 17393&lt;br /&gt;
| 0.559&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0467800]]&lt;br /&gt;
| 9.68&lt;br /&gt;
| 22133&lt;br /&gt;
| 0.437&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/13 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0682200]]&lt;br /&gt;
| 9.577&lt;br /&gt;
| 17192&lt;br /&gt;
| 0.557&lt;br /&gt;
| 3&lt;br /&gt;
| 13&lt;br /&gt;
| 2015/5/14 13:53&lt;br /&gt;
|-&lt;br /&gt;
|[[AB462324]]&lt;br /&gt;
| 9.542&lt;br /&gt;
| 9542&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 10:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0569500]]&lt;br /&gt;
| 9.526&lt;br /&gt;
| 18834&lt;br /&gt;
| 0.506&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0456800]]&lt;br /&gt;
| 9.468&lt;br /&gt;
| 13735&lt;br /&gt;
| 0.689&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0274900]]&lt;br /&gt;
| 9.449&lt;br /&gt;
| 18241&lt;br /&gt;
| 0.518&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0724900]]&lt;br /&gt;
| 9.361&lt;br /&gt;
| 19950&lt;br /&gt;
| 0.469&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0611100]]&lt;br /&gt;
| 9.349&lt;br /&gt;
| 15330&lt;br /&gt;
| 0.61&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0509600]]&lt;br /&gt;
| 9.346&lt;br /&gt;
| 17625&lt;br /&gt;
| 0.53&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 17:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0558000]]&lt;br /&gt;
| 9.337&lt;br /&gt;
| 13289&lt;br /&gt;
| 0.703&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0449000]]&lt;br /&gt;
| 9.33&lt;br /&gt;
| 16966&lt;br /&gt;
| 0.55&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0415000]]&lt;br /&gt;
| 9.31&lt;br /&gt;
| 9310&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 19:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0471000]]&lt;br /&gt;
| 9.278&lt;br /&gt;
| 18586&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0170900]]&lt;br /&gt;
| 9.272&lt;br /&gt;
| 19337&lt;br /&gt;
| 0.479&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0610300]]&lt;br /&gt;
| 9.171&lt;br /&gt;
| 11979&lt;br /&gt;
| 0.766&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0583400]]&lt;br /&gt;
| 9.15&lt;br /&gt;
| 11481&lt;br /&gt;
| 0.797&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0622100]]&lt;br /&gt;
| 9.147&lt;br /&gt;
| 12303&lt;br /&gt;
| 0.743&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0203200]]&lt;br /&gt;
| 9.128&lt;br /&gt;
| 17233&lt;br /&gt;
| 0.53&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 13:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0660200]]&lt;br /&gt;
| 9.119&lt;br /&gt;
| 20530&lt;br /&gt;
| 0.444&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/12 16:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0403000]]&lt;br /&gt;
| 9.104&lt;br /&gt;
| 15463&lt;br /&gt;
| 0.589&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0112700]]&lt;br /&gt;
| 9.094&lt;br /&gt;
| 17122&lt;br /&gt;
| 0.531&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 12:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0799100]]&lt;br /&gt;
| 9.068&lt;br /&gt;
| 16095&lt;br /&gt;
| 0.563&lt;br /&gt;
| 3&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/5/14 14:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0307800]]&lt;br /&gt;
| 9.029&lt;br /&gt;
| 11279&lt;br /&gt;
| 0.801&lt;br /&gt;
| 4&lt;br /&gt;
| 15&lt;br /&gt;
| 2014/6/6 8:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0424500]]&lt;br /&gt;
| 9.021&lt;br /&gt;
| 17768&lt;br /&gt;
| 0.508&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0184900]]&lt;br /&gt;
| 9.016&lt;br /&gt;
| 15182&lt;br /&gt;
| 0.594&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0203700]]&lt;br /&gt;
| 9.003&lt;br /&gt;
| 12324&lt;br /&gt;
| 0.731&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0125000]]&lt;br /&gt;
| 8.97&lt;br /&gt;
| 12695&lt;br /&gt;
| 0.707&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0612800]]&lt;br /&gt;
| 8.934&lt;br /&gt;
| 14002&lt;br /&gt;
| 0.638&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0128700]]&lt;br /&gt;
| 8.928&lt;br /&gt;
| 17882&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0215200]]&lt;br /&gt;
| 8.927&lt;br /&gt;
| 14196&lt;br /&gt;
| 0.629&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 13:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0952800]]&lt;br /&gt;
| 8.922&lt;br /&gt;
| 8922&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 21:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0494100]]&lt;br /&gt;
| 8.906&lt;br /&gt;
| 12742&lt;br /&gt;
| 0.699&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0149100]]&lt;br /&gt;
| 8.897&lt;br /&gt;
| 13456&lt;br /&gt;
| 0.661&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 11:15&lt;br /&gt;
|-&lt;br /&gt;
|[[BZIP]]&lt;br /&gt;
| 8.894&lt;br /&gt;
| 8924&lt;br /&gt;
| 0.997&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/21 21:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0625900]]&lt;br /&gt;
| 8.872&lt;br /&gt;
| 13033&lt;br /&gt;
| 0.681&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0229800]]&lt;br /&gt;
| 8.835&lt;br /&gt;
| 16807&lt;br /&gt;
| 0.526&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0651100]]&lt;br /&gt;
| 8.803&lt;br /&gt;
| 18547&lt;br /&gt;
| 0.475&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:21&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0232900]]&lt;br /&gt;
| 8.79&lt;br /&gt;
| 18004&lt;br /&gt;
| 0.488&lt;br /&gt;
| 3&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/6/12 16:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0129700]]&lt;br /&gt;
| 8.789&lt;br /&gt;
| 18504&lt;br /&gt;
| 0.475&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0641400]]&lt;br /&gt;
| 8.735&lt;br /&gt;
| 8735&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 13:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0137100]]&lt;br /&gt;
| 8.717&lt;br /&gt;
| 8717&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 17:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Htd1]]&lt;br /&gt;
| 8.705&lt;br /&gt;
| 8705&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 14:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0707600]]&lt;br /&gt;
| 8.666&lt;br /&gt;
| 16659&lt;br /&gt;
| 0.52&lt;br /&gt;
| 2&lt;br /&gt;
| 5&lt;br /&gt;
| 2014/5/28 0:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa23]]&lt;br /&gt;
| 8.641&lt;br /&gt;
| 8641&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 21:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0235200]]&lt;br /&gt;
| 8.563&lt;br /&gt;
| 17156&lt;br /&gt;
| 0.499&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0100600]]&lt;br /&gt;
| 8.559&lt;br /&gt;
| 15027&lt;br /&gt;
| 0.57&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0597000]]&lt;br /&gt;
| 8.509&lt;br /&gt;
| 16209&lt;br /&gt;
| 0.525&lt;br /&gt;
| 4&lt;br /&gt;
| 11&lt;br /&gt;
| 2014/5/19 22:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0583700]]&lt;br /&gt;
| 8.489&lt;br /&gt;
| 12862&lt;br /&gt;
| 0.66&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0232100]]&lt;br /&gt;
| 8.485&lt;br /&gt;
| 15567&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0452500]]&lt;br /&gt;
| 8.484&lt;br /&gt;
| 8484&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 16:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0556800]]&lt;br /&gt;
| 8.473&lt;br /&gt;
| 12924&lt;br /&gt;
| 0.656&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0363900]]&lt;br /&gt;
| 8.473&lt;br /&gt;
| 12412&lt;br /&gt;
| 0.683&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0426800]]&lt;br /&gt;
| 8.447&lt;br /&gt;
| 9634&lt;br /&gt;
| 0.877&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0253300]]&lt;br /&gt;
| 8.439&lt;br /&gt;
| 17745&lt;br /&gt;
| 0.476&lt;br /&gt;
| 5&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/5/13 15:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0683400]]&lt;br /&gt;
| 8.438&lt;br /&gt;
| 8438&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 14:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0553300]]&lt;br /&gt;
| 8.403&lt;br /&gt;
| 35721&lt;br /&gt;
| 0.235&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0522000]]&lt;br /&gt;
| 8.335&lt;br /&gt;
| 8335&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 21:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0580300]]&lt;br /&gt;
| 8.329&lt;br /&gt;
| 15752&lt;br /&gt;
| 0.529&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0499300]]&lt;br /&gt;
| 8.324&lt;br /&gt;
| 17032&lt;br /&gt;
| 0.489&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0445700]]&lt;br /&gt;
| 8.317&lt;br /&gt;
| 10922&lt;br /&gt;
| 0.761&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0505700]]&lt;br /&gt;
| 8.312&lt;br /&gt;
| 16220&lt;br /&gt;
| 0.512&lt;br /&gt;
| 5&lt;br /&gt;
| 6&lt;br /&gt;
| 2015/6/13 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0559200]]&lt;br /&gt;
| 8.294&lt;br /&gt;
| 15586&lt;br /&gt;
| 0.532&lt;br /&gt;
| 6&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/13 17:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0179400]]&lt;br /&gt;
| 8.292&lt;br /&gt;
| 14840&lt;br /&gt;
| 0.559&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0553200]]&lt;br /&gt;
| 8.204&lt;br /&gt;
| 8204&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0571300]]&lt;br /&gt;
| 8.184&lt;br /&gt;
| 14946&lt;br /&gt;
| 0.548&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0401100]]&lt;br /&gt;
| 8.183&lt;br /&gt;
| 17216&lt;br /&gt;
| 0.475&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0181300]]&lt;br /&gt;
| 8.174&lt;br /&gt;
| 13252&lt;br /&gt;
| 0.617&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0346200]]&lt;br /&gt;
| 8.14&lt;br /&gt;
| 8233&lt;br /&gt;
| 0.989&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/5 17:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0502100]]&lt;br /&gt;
| 8.139&lt;br /&gt;
| 15501&lt;br /&gt;
| 0.525&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0820300]]&lt;br /&gt;
| 8.137&lt;br /&gt;
| 11604&lt;br /&gt;
| 0.701&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0381100]]&lt;br /&gt;
| 8.133&lt;br /&gt;
| 9672&lt;br /&gt;
| 0.841&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0118800]]&lt;br /&gt;
| 8.097&lt;br /&gt;
| 8097&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0230300]]&lt;br /&gt;
| 8.029&lt;br /&gt;
| 15193&lt;br /&gt;
| 0.528&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0438800]]&lt;br /&gt;
| 8.026&lt;br /&gt;
| 15610&lt;br /&gt;
| 0.514&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0534400]]&lt;br /&gt;
| 7.997&lt;br /&gt;
| 16635&lt;br /&gt;
| 0.481&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0165600]]&lt;br /&gt;
| 7.982&lt;br /&gt;
| 11937&lt;br /&gt;
| 0.669&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0490600]]&lt;br /&gt;
| 7.98&lt;br /&gt;
| 16603&lt;br /&gt;
| 0.481&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0585700]]&lt;br /&gt;
| 7.966&lt;br /&gt;
| 7966&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 23:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0194300]]&lt;br /&gt;
| 7.966&lt;br /&gt;
| 11111&lt;br /&gt;
| 0.717&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0869900]]&lt;br /&gt;
| 7.964&lt;br /&gt;
| 16289&lt;br /&gt;
| 0.489&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0160700]]&lt;br /&gt;
| 7.962&lt;br /&gt;
| 15027&lt;br /&gt;
| 0.53&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0451500]]&lt;br /&gt;
| 7.903&lt;br /&gt;
| 10040&lt;br /&gt;
| 0.787&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0759400]]&lt;br /&gt;
| 7.902&lt;br /&gt;
| 15742&lt;br /&gt;
| 0.502&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0205100]]&lt;br /&gt;
| 7.891&lt;br /&gt;
| 12914&lt;br /&gt;
| 0.611&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0244900]]&lt;br /&gt;
| 7.89&lt;br /&gt;
| 11371&lt;br /&gt;
| 0.694&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:38&lt;br /&gt;
|-&lt;br /&gt;
|[[HTD2]]&lt;br /&gt;
| 7.887&lt;br /&gt;
| 7887&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/4 22:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0482400]]&lt;br /&gt;
| 7.873&lt;br /&gt;
| 11843&lt;br /&gt;
| 0.665&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0478000]]&lt;br /&gt;
| 7.871&lt;br /&gt;
| 12275&lt;br /&gt;
| 0.641&lt;br /&gt;
| 4&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0258400]]&lt;br /&gt;
| 7.866&lt;br /&gt;
| 13708&lt;br /&gt;
| 0.574&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0445400]]&lt;br /&gt;
| 7.848&lt;br /&gt;
| 15652&lt;br /&gt;
| 0.501&lt;br /&gt;
| 6&lt;br /&gt;
| 15&lt;br /&gt;
| 2015/6/13 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0273800]]&lt;br /&gt;
| 7.843&lt;br /&gt;
| 9988&lt;br /&gt;
| 0.785&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0643300]]&lt;br /&gt;
| 7.839&lt;br /&gt;
| 16276&lt;br /&gt;
| 0.482&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 15:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0186000]]&lt;br /&gt;
| 7.817&lt;br /&gt;
| 12275&lt;br /&gt;
| 0.637&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0286700]]&lt;br /&gt;
| 7.816&lt;br /&gt;
| 16653&lt;br /&gt;
| 0.469&lt;br /&gt;
| 6&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/12 16:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0104300]]&lt;br /&gt;
| 7.791&lt;br /&gt;
| 11682&lt;br /&gt;
| 0.667&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0150700]]&lt;br /&gt;
| 7.79&lt;br /&gt;
| 15994&lt;br /&gt;
| 0.487&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0563600]]&lt;br /&gt;
| 7.778&lt;br /&gt;
| 13380&lt;br /&gt;
| 0.581&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0494200]]&lt;br /&gt;
| 7.776&lt;br /&gt;
| 7776&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 23:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0603600]]&lt;br /&gt;
| 7.774&lt;br /&gt;
| 15383&lt;br /&gt;
| 0.505&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0181500]]&lt;br /&gt;
| 7.751&lt;br /&gt;
| 12230&lt;br /&gt;
| 0.634&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 13:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0814200]]&lt;br /&gt;
| 7.743&lt;br /&gt;
| 13379&lt;br /&gt;
| 0.579&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0306400]]&lt;br /&gt;
| 7.71&lt;br /&gt;
| 12551&lt;br /&gt;
| 0.614&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0103800]]&lt;br /&gt;
| 7.686&lt;br /&gt;
| 7686&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 14:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0225100]]&lt;br /&gt;
| 7.669&lt;br /&gt;
| 12296&lt;br /&gt;
| 0.624&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Pi1]]&lt;br /&gt;
| 7.644&lt;br /&gt;
| 7644&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/5 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0307500]]&lt;br /&gt;
| 7.639&lt;br /&gt;
| 7639&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/7 21:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0648000]]&lt;br /&gt;
| 7.638&lt;br /&gt;
| 15767&lt;br /&gt;
| 0.484&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0442400]]&lt;br /&gt;
| 7.638&lt;br /&gt;
| 7638&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Chalk5]]&lt;br /&gt;
| 7.635&lt;br /&gt;
| 7635&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/29 11:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0140300]]&lt;br /&gt;
| 7.633&lt;br /&gt;
| 13769&lt;br /&gt;
| 0.554&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0622900]]&lt;br /&gt;
| 7.632&lt;br /&gt;
| 14288&lt;br /&gt;
| 0.534&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0292200]]&lt;br /&gt;
| 7.626&lt;br /&gt;
| 12859&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0230500]]&lt;br /&gt;
| 7.618&lt;br /&gt;
| 14126&lt;br /&gt;
| 0.539&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0472500]]&lt;br /&gt;
| 7.581&lt;br /&gt;
| 13819&lt;br /&gt;
| 0.549&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[RPA2]]&lt;br /&gt;
| 7.58&lt;br /&gt;
| 7580&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/21 13:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0262900]]&lt;br /&gt;
| 7.571&lt;br /&gt;
| 15719&lt;br /&gt;
| 0.482&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0107700]]&lt;br /&gt;
| 7.533&lt;br /&gt;
| 7533&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/6 9:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g57310]]&lt;br /&gt;
| 7.531&lt;br /&gt;
| 7531&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 14:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0104200]]&lt;br /&gt;
| 7.502&lt;br /&gt;
| 15399&lt;br /&gt;
| 0.487&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0142600]]&lt;br /&gt;
| 7.492&lt;br /&gt;
| 11545&lt;br /&gt;
| 0.649&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0788500]]&lt;br /&gt;
| 7.454&lt;br /&gt;
| 10159&lt;br /&gt;
| 0.734&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0139000]]&lt;br /&gt;
| 7.443&lt;br /&gt;
| 15282&lt;br /&gt;
| 0.487&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0168600]]&lt;br /&gt;
| 7.43&lt;br /&gt;
| 12348&lt;br /&gt;
| 0.602&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0669400]]&lt;br /&gt;
| 7.383&lt;br /&gt;
| 7383&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0117400]]&lt;br /&gt;
| 7.353&lt;br /&gt;
| 11607&lt;br /&gt;
| 0.633&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0223400]]&lt;br /&gt;
| 7.313&lt;br /&gt;
| 14417&lt;br /&gt;
| 0.507&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 13:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0731200]]&lt;br /&gt;
| 7.311&lt;br /&gt;
| 14927&lt;br /&gt;
| 0.49&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g02650]]&lt;br /&gt;
| 7.302&lt;br /&gt;
| 7302&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 19:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0859300]]&lt;br /&gt;
| 7.265&lt;br /&gt;
| 12246&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0105000]]&lt;br /&gt;
| 7.237&lt;br /&gt;
| 15311&lt;br /&gt;
| 0.473&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 17:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0110800]]&lt;br /&gt;
| 7.203&lt;br /&gt;
| 14838&lt;br /&gt;
| 0.485&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0367100]]&lt;br /&gt;
| 7.2&lt;br /&gt;
| 12561&lt;br /&gt;
| 0.573&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/9 9:53&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0191600]]&lt;br /&gt;
| 7.2&lt;br /&gt;
| 13785&lt;br /&gt;
| 0.522&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0137250]]&lt;br /&gt;
| 7.185&lt;br /&gt;
| 14660&lt;br /&gt;
| 0.49&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0220400]]&lt;br /&gt;
| 7.158&lt;br /&gt;
| 17791&lt;br /&gt;
| 0.402&lt;br /&gt;
| 6&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/5/14 13:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0404500]]&lt;br /&gt;
| 7.151&lt;br /&gt;
| 7164&lt;br /&gt;
| 0.998&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/7 23:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0177200]]&lt;br /&gt;
| 7.15&lt;br /&gt;
| 9017&lt;br /&gt;
| 0.793&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0504700]]&lt;br /&gt;
| 7.149&lt;br /&gt;
| 10763&lt;br /&gt;
| 0.664&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0496900]]&lt;br /&gt;
| 7.143&lt;br /&gt;
| 14022&lt;br /&gt;
| 0.509&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0313400]]&lt;br /&gt;
| 7.12&lt;br /&gt;
| 14554&lt;br /&gt;
| 0.489&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0117000]]&lt;br /&gt;
| 7.092&lt;br /&gt;
| 8202&lt;br /&gt;
| 0.865&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0127600]]&lt;br /&gt;
| 7.065&lt;br /&gt;
| 12576&lt;br /&gt;
| 0.562&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0531700]]&lt;br /&gt;
| 7.054&lt;br /&gt;
| 13276&lt;br /&gt;
| 0.531&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0499500]]&lt;br /&gt;
| 7.051&lt;br /&gt;
| 12958&lt;br /&gt;
| 0.544&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0188400]]&lt;br /&gt;
| 7.05&lt;br /&gt;
| 12067&lt;br /&gt;
| 0.584&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0649900]]&lt;br /&gt;
| 7.031&lt;br /&gt;
| 12503&lt;br /&gt;
| 0.562&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0442700]]&lt;br /&gt;
| 7.028&lt;br /&gt;
| 10589&lt;br /&gt;
| 0.664&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0438600]]&lt;br /&gt;
| 7.022&lt;br /&gt;
| 14835&lt;br /&gt;
| 0.473&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0124700]]&lt;br /&gt;
| 6.998&lt;br /&gt;
| 14469&lt;br /&gt;
| 0.484&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0126100]]&lt;br /&gt;
| 6.985&lt;br /&gt;
| 6985&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0662200]]&lt;br /&gt;
| 6.942&lt;br /&gt;
| 12388&lt;br /&gt;
| 0.56&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0639100]]&lt;br /&gt;
| 6.934&lt;br /&gt;
| 11269&lt;br /&gt;
| 0.615&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0167800]]&lt;br /&gt;
| 6.92&lt;br /&gt;
| 10521&lt;br /&gt;
| 0.658&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0615050]]&lt;br /&gt;
| 6.92&lt;br /&gt;
| 9869&lt;br /&gt;
| 0.701&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0610200]]&lt;br /&gt;
| 6.911&lt;br /&gt;
| 12604&lt;br /&gt;
| 0.548&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0587400]]&lt;br /&gt;
| 6.901&lt;br /&gt;
| 8826&lt;br /&gt;
| 0.782&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0123300]]&lt;br /&gt;
| 6.87&lt;br /&gt;
| 15272&lt;br /&gt;
| 0.45&lt;br /&gt;
| 4&lt;br /&gt;
| 8&lt;br /&gt;
| 2015/6/12 13:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0727200]]&lt;br /&gt;
| 6.864&lt;br /&gt;
| 13184&lt;br /&gt;
| 0.521&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0682800]]&lt;br /&gt;
| 6.853&lt;br /&gt;
| 13550&lt;br /&gt;
| 0.506&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0446000]]&lt;br /&gt;
| 6.838&lt;br /&gt;
| 13942&lt;br /&gt;
| 0.49&lt;br /&gt;
| 5&lt;br /&gt;
| 5&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0182900]]&lt;br /&gt;
| 6.821&lt;br /&gt;
| 13295&lt;br /&gt;
| 0.513&lt;br /&gt;
| 5&lt;br /&gt;
| 11&lt;br /&gt;
| 2015/6/12 16:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0205700]]&lt;br /&gt;
| 6.813&lt;br /&gt;
| 12490&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0333200]]&lt;br /&gt;
| 6.778&lt;br /&gt;
| 8703&lt;br /&gt;
| 0.779&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/9 9:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0167600]]&lt;br /&gt;
| 6.756&lt;br /&gt;
| 14570&lt;br /&gt;
| 0.464&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0227800]]&lt;br /&gt;
| 6.744&lt;br /&gt;
| 10826&lt;br /&gt;
| 0.623&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0567400]]&lt;br /&gt;
| 6.732&lt;br /&gt;
| 13437&lt;br /&gt;
| 0.501&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:58&lt;br /&gt;
|-&lt;br /&gt;
|[[DEP2]]&lt;br /&gt;
| 6.724&lt;br /&gt;
| 6763&lt;br /&gt;
| 0.994&lt;br /&gt;
| 3&lt;br /&gt;
| 7&lt;br /&gt;
| 2014/6/10 22:30&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0592600]]&lt;br /&gt;
| 6.72&lt;br /&gt;
| 15320&lt;br /&gt;
| 0.439&lt;br /&gt;
| 5&lt;br /&gt;
| 11&lt;br /&gt;
| 2015/6/12 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0323700]]&lt;br /&gt;
| 6.709&lt;br /&gt;
| 11315&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:29&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0126900]]&lt;br /&gt;
| 6.705&lt;br /&gt;
| 6705&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 12:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0561600]]&lt;br /&gt;
| 6.699&lt;br /&gt;
| 11352&lt;br /&gt;
| 0.59&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/13 16:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Sub1A]]&lt;br /&gt;
| 6.679&lt;br /&gt;
| 6679&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/4 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0126300]]&lt;br /&gt;
| 6.658&lt;br /&gt;
| 13730&lt;br /&gt;
| 0.485&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0472000]]&lt;br /&gt;
| 6.592&lt;br /&gt;
| 12098&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0117400]]&lt;br /&gt;
| 6.569&lt;br /&gt;
| 6850&lt;br /&gt;
| 0.959&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0533600]]&lt;br /&gt;
| 6.522&lt;br /&gt;
| 8207&lt;br /&gt;
| 0.795&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0397400]]&lt;br /&gt;
| 6.52&lt;br /&gt;
| 11105&lt;br /&gt;
| 0.587&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0712700]]&lt;br /&gt;
| 6.51&lt;br /&gt;
| 7624&lt;br /&gt;
| 0.854&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/9 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0237000]]&lt;br /&gt;
| 6.46&lt;br /&gt;
| 6460&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 18:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0811000]]&lt;br /&gt;
| 6.453&lt;br /&gt;
| 11487&lt;br /&gt;
| 0.562&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0505200]]&lt;br /&gt;
| 6.444&lt;br /&gt;
| 6444&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/13 9:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0247300]]&lt;br /&gt;
| 6.442&lt;br /&gt;
| 13081&lt;br /&gt;
| 0.492&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0687700]]&lt;br /&gt;
| 6.434&lt;br /&gt;
| 7690&lt;br /&gt;
| 0.837&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0569700]]&lt;br /&gt;
| 6.412&lt;br /&gt;
| 13859&lt;br /&gt;
| 0.463&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[AY986492]]&lt;br /&gt;
| 6.408&lt;br /&gt;
| 6408&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/10 21:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0700700]]&lt;br /&gt;
| 6.404&lt;br /&gt;
| 6404&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 20:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0771400]]&lt;br /&gt;
| 6.399&lt;br /&gt;
| 6702&lt;br /&gt;
| 0.955&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/5/12 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0127800]]&lt;br /&gt;
| 6.393&lt;br /&gt;
| 10797&lt;br /&gt;
| 0.592&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0120500]]&lt;br /&gt;
| 6.372&lt;br /&gt;
| 6372&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/5/14 13:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0854500]]&lt;br /&gt;
| 6.367&lt;br /&gt;
| 10086&lt;br /&gt;
| 0.631&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/15 13:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0275000]]&lt;br /&gt;
| 6.307&lt;br /&gt;
| 11994&lt;br /&gt;
| 0.526&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0561000]]&lt;br /&gt;
| 6.249&lt;br /&gt;
| 12468&lt;br /&gt;
| 0.501&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0759800]]&lt;br /&gt;
| 6.249&lt;br /&gt;
| 12883&lt;br /&gt;
| 0.485&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0101000]]&lt;br /&gt;
| 6.239&lt;br /&gt;
| 10862&lt;br /&gt;
| 0.574&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0456200]]&lt;br /&gt;
| 6.23&lt;br /&gt;
| 10901&lt;br /&gt;
| 0.572&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0101600]]&lt;br /&gt;
| 6.221&lt;br /&gt;
| 35095&lt;br /&gt;
| 0.177&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/5/31 21:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0695800]]&lt;br /&gt;
| 6.213&lt;br /&gt;
| 8582&lt;br /&gt;
| 0.724&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[LOC_Os08g30910]]&lt;br /&gt;
| 6.211&lt;br /&gt;
| 6211&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 22:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0606700]]&lt;br /&gt;
| 6.198&lt;br /&gt;
| 12432&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0210300]]&lt;br /&gt;
| 6.196&lt;br /&gt;
| 12384&lt;br /&gt;
| 0.5&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0736400]]&lt;br /&gt;
| 6.183&lt;br /&gt;
| 11839&lt;br /&gt;
| 0.522&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0549100]]&lt;br /&gt;
| 6.175&lt;br /&gt;
| 10093&lt;br /&gt;
| 0.612&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0452200]]&lt;br /&gt;
| 6.171&lt;br /&gt;
| 11987&lt;br /&gt;
| 0.515&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0170300]]&lt;br /&gt;
| 6.166&lt;br /&gt;
| 12582&lt;br /&gt;
| 0.49&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/14 13:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0224700]]&lt;br /&gt;
| 6.166&lt;br /&gt;
| 11925&lt;br /&gt;
| 0.517&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 13:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0508500]]&lt;br /&gt;
| 6.13&lt;br /&gt;
| 7194&lt;br /&gt;
| 0.852&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0558500]]&lt;br /&gt;
| 6.078&lt;br /&gt;
| 12744&lt;br /&gt;
| 0.477&lt;br /&gt;
| 5&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/12 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0511000]]&lt;br /&gt;
| 6.076&lt;br /&gt;
| 12097&lt;br /&gt;
| 0.502&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:35&lt;br /&gt;
|-&lt;br /&gt;
|[[OsWRKY13]]&lt;br /&gt;
| 6.069&lt;br /&gt;
| 6101&lt;br /&gt;
| 0.995&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/4 20:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0308100]]&lt;br /&gt;
| 6.062&lt;br /&gt;
| 12455&lt;br /&gt;
| 0.487&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0113700]]&lt;br /&gt;
| 5.961&lt;br /&gt;
| 12261&lt;br /&gt;
| 0.486&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0113100]]&lt;br /&gt;
| 5.915&lt;br /&gt;
| 5915&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0656600]]&lt;br /&gt;
| 5.915&lt;br /&gt;
| 10022&lt;br /&gt;
| 0.59&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0600400]]&lt;br /&gt;
| 5.902&lt;br /&gt;
| 7925&lt;br /&gt;
| 0.745&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0733200]]&lt;br /&gt;
| 5.889&lt;br /&gt;
| 5889&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 11:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0785400]]&lt;br /&gt;
| 5.864&lt;br /&gt;
| 10600&lt;br /&gt;
| 0.553&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:34&lt;br /&gt;
|-&lt;br /&gt;
|[[Os04g0541700]]&lt;br /&gt;
| 5.857&lt;br /&gt;
| 6037&lt;br /&gt;
| 0.97&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/8 16:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0140500]]&lt;br /&gt;
| 5.829&lt;br /&gt;
| 11343&lt;br /&gt;
| 0.514&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:26&lt;br /&gt;
|-&lt;br /&gt;
|[[IPK1]]&lt;br /&gt;
| 5.803&lt;br /&gt;
| 5803&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 16:55&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0434200]]&lt;br /&gt;
| 5.792&lt;br /&gt;
| 11879&lt;br /&gt;
| 0.488&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0522100]]&lt;br /&gt;
| 5.713&lt;br /&gt;
| 9270&lt;br /&gt;
| 0.616&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0417600]]&lt;br /&gt;
| 5.713&lt;br /&gt;
| 10209&lt;br /&gt;
| 0.56&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0177900]]&lt;br /&gt;
| 5.693&lt;br /&gt;
| 11327&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0149800]]&lt;br /&gt;
| 5.681&lt;br /&gt;
| 11452&lt;br /&gt;
| 0.496&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0831000]]&lt;br /&gt;
| 5.68&lt;br /&gt;
| 9517&lt;br /&gt;
| 0.597&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0103900]]&lt;br /&gt;
| 5.674&lt;br /&gt;
| 5674&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 16:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0580500]]&lt;br /&gt;
| 5.66&lt;br /&gt;
| 5660&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/23 11:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0693800]]&lt;br /&gt;
| 5.613&lt;br /&gt;
| 11290&lt;br /&gt;
| 0.497&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[OsCERK1]]&lt;br /&gt;
| 5.61&lt;br /&gt;
| 5610&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 18:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0586100]]&lt;br /&gt;
| 5.609&lt;br /&gt;
| 6240&lt;br /&gt;
| 0.899&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0116200]]&lt;br /&gt;
| 5.602&lt;br /&gt;
| 7206&lt;br /&gt;
| 0.777&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0678600]]&lt;br /&gt;
| 5.575&lt;br /&gt;
| 11240&lt;br /&gt;
| 0.496&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0567800]]&lt;br /&gt;
| 5.558&lt;br /&gt;
| 5558&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 16:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0610350]]&lt;br /&gt;
| 5.547&lt;br /&gt;
| 5547&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2016/6/12 13:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0657000]]&lt;br /&gt;
| 5.536&lt;br /&gt;
| 9210&lt;br /&gt;
| 0.601&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Wbph8]]&lt;br /&gt;
| 5.531&lt;br /&gt;
| 5531&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 18:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0563300]]&lt;br /&gt;
| 5.487&lt;br /&gt;
| 11105&lt;br /&gt;
| 0.494&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0701700]]&lt;br /&gt;
| 5.432&lt;br /&gt;
| 8295&lt;br /&gt;
| 0.655&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:26&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0419200]]&lt;br /&gt;
| 5.432&lt;br /&gt;
| 9118&lt;br /&gt;
| 0.596&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[OsCEBiP]]&lt;br /&gt;
| 5.419&lt;br /&gt;
| 5419&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 12:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa10]]&lt;br /&gt;
| 5.416&lt;br /&gt;
| 5416&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 16:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0272300]]&lt;br /&gt;
| 5.41&lt;br /&gt;
| 9862&lt;br /&gt;
| 0.549&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0117900]]&lt;br /&gt;
| 5.381&lt;br /&gt;
| 8815&lt;br /&gt;
| 0.61&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:59&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0528300]]&lt;br /&gt;
| 5.364&lt;br /&gt;
| 9566&lt;br /&gt;
| 0.561&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Badh2]]&lt;br /&gt;
| 5.363&lt;br /&gt;
| 5363&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 19:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0233900]]&lt;br /&gt;
| 5.348&lt;br /&gt;
| 9011&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa21]]&lt;br /&gt;
| 5.345&lt;br /&gt;
| 5345&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/1 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Bls1]]&lt;br /&gt;
| 5.308&lt;br /&gt;
| 5308&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 15:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0157700]]&lt;br /&gt;
| 5.304&lt;br /&gt;
| 10277&lt;br /&gt;
| 0.516&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0260200]]&lt;br /&gt;
| 5.302&lt;br /&gt;
| 7745&lt;br /&gt;
| 0.685&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0232600]]&lt;br /&gt;
| 5.249&lt;br /&gt;
| 10595&lt;br /&gt;
| 0.495&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0125100]]&lt;br /&gt;
| 5.183&lt;br /&gt;
| 10331&lt;br /&gt;
| 0.502&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0212900]]&lt;br /&gt;
| 5.175&lt;br /&gt;
| 6651&lt;br /&gt;
| 0.778&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0491300]]&lt;br /&gt;
| 5.166&lt;br /&gt;
| 10047&lt;br /&gt;
| 0.514&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0470500]]&lt;br /&gt;
| 5.144&lt;br /&gt;
| 9661&lt;br /&gt;
| 0.532&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0439800]]&lt;br /&gt;
| 5.122&lt;br /&gt;
| 8022&lt;br /&gt;
| 0.638&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 17:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0555500]]&lt;br /&gt;
| 5.108&lt;br /&gt;
| 8929&lt;br /&gt;
| 0.572&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0129200]]&lt;br /&gt;
| 5.081&lt;br /&gt;
| 5081&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0508600]]&lt;br /&gt;
| 5.066&lt;br /&gt;
| 7754&lt;br /&gt;
| 0.653&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0174500]]&lt;br /&gt;
| 5.017&lt;br /&gt;
| 9397&lt;br /&gt;
| 0.534&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:28&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0267200]]&lt;br /&gt;
| 5.008&lt;br /&gt;
| 7991&lt;br /&gt;
| 0.627&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:39&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0622700]]&lt;br /&gt;
| 5&lt;br /&gt;
| 9868&lt;br /&gt;
| 0.507&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[SBP]]&lt;br /&gt;
| 4.997&lt;br /&gt;
| 4997&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/21 18:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0465800]]&lt;br /&gt;
| 4.939&lt;br /&gt;
| 4939&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 16:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0491000]]&lt;br /&gt;
| 4.912&lt;br /&gt;
| 8991&lt;br /&gt;
| 0.546&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:47&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0206700]]&lt;br /&gt;
| 4.909&lt;br /&gt;
| 9664&lt;br /&gt;
| 0.508&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:05&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0132100]]&lt;br /&gt;
| 4.9&lt;br /&gt;
| 4900&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0643300]]&lt;br /&gt;
| 4.869&lt;br /&gt;
| 7953&lt;br /&gt;
| 0.612&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0180800]]&lt;br /&gt;
| 4.859&lt;br /&gt;
| 8158&lt;br /&gt;
| 0.596&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:04&lt;br /&gt;
|-&lt;br /&gt;
|[[BPH_gene]]&lt;br /&gt;
| 4.857&lt;br /&gt;
| 4857&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/11 11:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0805600]]&lt;br /&gt;
| 4.842&lt;br /&gt;
| 4842&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/5 18:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0701600]]&lt;br /&gt;
| 4.831&lt;br /&gt;
| 7482&lt;br /&gt;
| 0.646&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0531600]]&lt;br /&gt;
| 4.818&lt;br /&gt;
| 4825&lt;br /&gt;
| 0.999&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/5/27 23:11&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0139000]]&lt;br /&gt;
| 4.811&lt;br /&gt;
| 9008&lt;br /&gt;
| 0.534&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:25&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0254700]]&lt;br /&gt;
| 4.802&lt;br /&gt;
| 7514&lt;br /&gt;
| 0.639&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0615100]]&lt;br /&gt;
| 4.794&lt;br /&gt;
| 7379&lt;br /&gt;
| 0.65&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:19&lt;br /&gt;
|-&lt;br /&gt;
|[[HSF]]&lt;br /&gt;
| 4.772&lt;br /&gt;
| 4781&lt;br /&gt;
| 0.998&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/21 20:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0125800]]&lt;br /&gt;
| 4.629&lt;br /&gt;
| 9410&lt;br /&gt;
| 0.492&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0628500]]&lt;br /&gt;
| 4.606&lt;br /&gt;
| 8573&lt;br /&gt;
| 0.537&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:48&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0433500]]&lt;br /&gt;
| 4.582&lt;br /&gt;
| 4582&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0694700]]&lt;br /&gt;
| 4.569&lt;br /&gt;
| 8480&lt;br /&gt;
| 0.539&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0293100]]&lt;br /&gt;
| 4.568&lt;br /&gt;
| 8480&lt;br /&gt;
| 0.539&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:12&lt;br /&gt;
|-&lt;br /&gt;
|[[Rl14]]&lt;br /&gt;
| 4.564&lt;br /&gt;
| 4764&lt;br /&gt;
| 0.958&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/10 11:19&lt;br /&gt;
|-&lt;br /&gt;
|[[OsRPA2]]&lt;br /&gt;
| 4.552&lt;br /&gt;
| 4552&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 9:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0604000]]&lt;br /&gt;
| 4.53&lt;br /&gt;
| 8229&lt;br /&gt;
| 0.55&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0192000]]&lt;br /&gt;
| 4.527&lt;br /&gt;
| 4527&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/7/30 23:13&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0922800]]&lt;br /&gt;
| 4.506&lt;br /&gt;
| 4506&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/24 18:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0787300]]&lt;br /&gt;
| 4.483&lt;br /&gt;
| 6886&lt;br /&gt;
| 0.651&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 14:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0439200]]&lt;br /&gt;
| 4.477&lt;br /&gt;
| 8745&lt;br /&gt;
| 0.512&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:42&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0580800]]&lt;br /&gt;
| 4.463&lt;br /&gt;
| 4463&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:00&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0822900]]&lt;br /&gt;
| 4.447&lt;br /&gt;
| 7550&lt;br /&gt;
| 0.589&lt;br /&gt;
| 3&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/5/13 15:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0167500]]&lt;br /&gt;
| 4.432&lt;br /&gt;
| 8906&lt;br /&gt;
| 0.498&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:27&lt;br /&gt;
|-&lt;br /&gt;
|[[Sucrose_synthase]]&lt;br /&gt;
| 4.428&lt;br /&gt;
| 4436&lt;br /&gt;
| 0.998&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2013/7/18 11:20&lt;br /&gt;
|-&lt;br /&gt;
|[[CL971152]]&lt;br /&gt;
| 4.417&lt;br /&gt;
| 4472&lt;br /&gt;
| 0.988&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/10 21:51&lt;br /&gt;
|-&lt;br /&gt;
|[[GID1]]&lt;br /&gt;
| 4.384&lt;br /&gt;
| 4384&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 21:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0603700]]&lt;br /&gt;
| 4.375&lt;br /&gt;
| 9322&lt;br /&gt;
| 0.469&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[GS3]]&lt;br /&gt;
| 4.372&lt;br /&gt;
| 4372&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/10 20:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0618400]]&lt;br /&gt;
| 4.347&lt;br /&gt;
| 8707&lt;br /&gt;
| 0.499&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:45&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0182800]]&lt;br /&gt;
| 4.322&lt;br /&gt;
| 6519&lt;br /&gt;
| 0.663&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:05&lt;br /&gt;
|-&lt;br /&gt;
|[[ARF]]&lt;br /&gt;
| 4.308&lt;br /&gt;
| 4308&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2013/7/21 20:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0183000]]&lt;br /&gt;
| 4.286&lt;br /&gt;
| 4286&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 20:10&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0654700]]&lt;br /&gt;
| 4.285&lt;br /&gt;
| 8306&lt;br /&gt;
| 0.516&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0466400]]&lt;br /&gt;
| 4.265&lt;br /&gt;
| 8095&lt;br /&gt;
| 0.527&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0103300]]&lt;br /&gt;
| 4.188&lt;br /&gt;
| 7457&lt;br /&gt;
| 0.562&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 12:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0100150]]&lt;br /&gt;
| 4.188&lt;br /&gt;
| 4188&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:22&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0111500]]&lt;br /&gt;
| 4.119&lt;br /&gt;
| 4375&lt;br /&gt;
| 0.941&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:15&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0834400]]&lt;br /&gt;
| 4.109&lt;br /&gt;
| 4109&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 19:19&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0512200]]&lt;br /&gt;
| 4.095&lt;br /&gt;
| 7690&lt;br /&gt;
| 0.533&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/12 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Bph9]]&lt;br /&gt;
| 4.084&lt;br /&gt;
| 4084&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 12:23&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0181700]]&lt;br /&gt;
| 4.083&lt;br /&gt;
| 7433&lt;br /&gt;
| 0.549&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0222600]]&lt;br /&gt;
| 4.023&lt;br /&gt;
| 6741&lt;br /&gt;
| 0.597&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0157500]]&lt;br /&gt;
| 4.013&lt;br /&gt;
| 7888&lt;br /&gt;
| 0.509&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:06&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0537700]]&lt;br /&gt;
| 3.992&lt;br /&gt;
| 6731&lt;br /&gt;
| 0.593&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 22:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0610500]]&lt;br /&gt;
| 3.946&lt;br /&gt;
| 3946&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/20 11:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0529600]]&lt;br /&gt;
| 3.915&lt;br /&gt;
| 6908&lt;br /&gt;
| 0.567&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[LTN1]]&lt;br /&gt;
| 3.869&lt;br /&gt;
| 3869&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/5 23:56&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0106700]]&lt;br /&gt;
| 3.845&lt;br /&gt;
| 6498&lt;br /&gt;
| 0.592&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0568700]]&lt;br /&gt;
| 3.845&lt;br /&gt;
| 6600&lt;br /&gt;
| 0.583&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0123700]]&lt;br /&gt;
| 3.826&lt;br /&gt;
| 6076&lt;br /&gt;
| 0.63&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 17:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0441100]]&lt;br /&gt;
| 3.819&lt;br /&gt;
| 7418&lt;br /&gt;
| 0.515&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:31&lt;br /&gt;
|-&lt;br /&gt;
|[[Pik-p]]&lt;br /&gt;
| 3.816&lt;br /&gt;
| 3816&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 10:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0493100]]&lt;br /&gt;
| 3.804&lt;br /&gt;
| 7241&lt;br /&gt;
| 0.525&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:14&lt;br /&gt;
|-&lt;br /&gt;
|[[Os02g0552700]]&lt;br /&gt;
| 3.779&lt;br /&gt;
| 6604&lt;br /&gt;
| 0.572&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/14 13:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0100500]]&lt;br /&gt;
| 3.729&lt;br /&gt;
| 5669&lt;br /&gt;
| 0.658&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0129200]]&lt;br /&gt;
| 3.716&lt;br /&gt;
| 6629&lt;br /&gt;
| 0.561&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:32&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0558900]]&lt;br /&gt;
| 3.699&lt;br /&gt;
| 7398&lt;br /&gt;
| 0.5&lt;br /&gt;
| 5&lt;br /&gt;
| 9&lt;br /&gt;
| 2015/6/13 16:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0177400]]&lt;br /&gt;
| 3.693&lt;br /&gt;
| 6293&lt;br /&gt;
| 0.587&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/5/13 14:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0380200]]&lt;br /&gt;
| 3.69&lt;br /&gt;
| 6890&lt;br /&gt;
| 0.536&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 17:40&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0163400]]&lt;br /&gt;
| 3.662&lt;br /&gt;
| 3662&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 20:52&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0665800]]&lt;br /&gt;
| 3.593&lt;br /&gt;
| 3593&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/2 15:50&lt;br /&gt;
|-&lt;br /&gt;
|[[QGL3]]&lt;br /&gt;
| 3.57&lt;br /&gt;
| 3570&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/20 23:16&lt;br /&gt;
|-&lt;br /&gt;
|[[Qsw5]]&lt;br /&gt;
| 3.512&lt;br /&gt;
| 3512&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/7 22:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0225300]]&lt;br /&gt;
| 3.493&lt;br /&gt;
| 4174&lt;br /&gt;
| 0.837&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:37&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0112400]]&lt;br /&gt;
| 3.44&lt;br /&gt;
| 6824&lt;br /&gt;
| 0.504&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 14:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0396900]]&lt;br /&gt;
| 3.437&lt;br /&gt;
| 6527&lt;br /&gt;
| 0.527&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0633300]]&lt;br /&gt;
| 3.406&lt;br /&gt;
| 4141&lt;br /&gt;
| 0.823&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0786400]]&lt;br /&gt;
| 3.372&lt;br /&gt;
| 3372&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/20 0:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Bhp-3]]&lt;br /&gt;
| 3.33&lt;br /&gt;
| 3330&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/31 23:33&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0513200]]&lt;br /&gt;
| 3.31&lt;br /&gt;
| 34126&lt;br /&gt;
| 0.097&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0133700]]&lt;br /&gt;
| 3.237&lt;br /&gt;
| 3237&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/6/12 17:24&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0641200]]&lt;br /&gt;
| 3.212&lt;br /&gt;
| 6389&lt;br /&gt;
| 0.503&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:49&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0549600]]&lt;br /&gt;
| 3.204&lt;br /&gt;
| 5875&lt;br /&gt;
| 0.545&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Bph27]]&lt;br /&gt;
| 3.194&lt;br /&gt;
| 3194&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 15:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0573450]]&lt;br /&gt;
| 3.13&lt;br /&gt;
| 3130&lt;br /&gt;
| 1&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0582500]]&lt;br /&gt;
| 3.13&lt;br /&gt;
| 5666&lt;br /&gt;
| 0.552&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:09&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0135700]]&lt;br /&gt;
| 3.126&lt;br /&gt;
| 3126&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/7 0:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0459200]]&lt;br /&gt;
| 3.094&lt;br /&gt;
| 5090&lt;br /&gt;
| 0.608&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:46&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0523700]]&lt;br /&gt;
| 3.071&lt;br /&gt;
| 3079&lt;br /&gt;
| 0.997&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/3 13:41&lt;br /&gt;
|-&lt;br /&gt;
|[[Os09g0522200]]&lt;br /&gt;
| 3.031&lt;br /&gt;
| 5920&lt;br /&gt;
| 0.512&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 22:36&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0127100]]&lt;br /&gt;
| 3.015&lt;br /&gt;
| 5846&lt;br /&gt;
| 0.516&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/12 16:02&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0573400]]&lt;br /&gt;
| 3.009&lt;br /&gt;
| 6148&lt;br /&gt;
| 0.489&lt;br /&gt;
| 4&lt;br /&gt;
| 4&lt;br /&gt;
| 2015/6/13 16:58&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0282000]]&lt;br /&gt;
| 2.99&lt;br /&gt;
| 4364&lt;br /&gt;
| 0.685&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:17&lt;br /&gt;
|-&lt;br /&gt;
|[[OsDPR]]&lt;br /&gt;
| 2.951&lt;br /&gt;
| 2951&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/11 9:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os06g0118800]]&lt;br /&gt;
| 2.824&lt;br /&gt;
| 2824&lt;br /&gt;
| 1&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:01&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0422100]]&lt;br /&gt;
| 2.806&lt;br /&gt;
| 3394&lt;br /&gt;
| 0.827&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 16:38&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0274800]]&lt;br /&gt;
| 2.805&lt;br /&gt;
| 2805&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/28 21:34&lt;br /&gt;
|-&lt;br /&gt;
|[[BGIOSGA033504]]&lt;br /&gt;
| 2.803&lt;br /&gt;
| 2818&lt;br /&gt;
| 0.995&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2014/6/3 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0454000]]&lt;br /&gt;
| 2.786&lt;br /&gt;
| 5342&lt;br /&gt;
| 0.522&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Ygl1]]&lt;br /&gt;
| 2.729&lt;br /&gt;
| 2729&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/3 22:57&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0148000]]&lt;br /&gt;
| 2.697&lt;br /&gt;
| 5106&lt;br /&gt;
| 0.528&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:44&lt;br /&gt;
|-&lt;br /&gt;
|[[Os08g0566600]]&lt;br /&gt;
| 2.632&lt;br /&gt;
| 4314&lt;br /&gt;
| 0.61&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 17:35&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0150200]]&lt;br /&gt;
| 2.621&lt;br /&gt;
| 5115&lt;br /&gt;
| 0.512&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/6/12 13:03&lt;br /&gt;
|-&lt;br /&gt;
|[[SCM2]]&lt;br /&gt;
| 2.618&lt;br /&gt;
| 2618&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 14:17&lt;br /&gt;
|-&lt;br /&gt;
|[[Os05g0341600]]&lt;br /&gt;
| 2.592&lt;br /&gt;
| 2640&lt;br /&gt;
| 0.982&lt;br /&gt;
| 2&lt;br /&gt;
| 3&lt;br /&gt;
| 2014/6/1 17:02&lt;br /&gt;
|-&lt;br /&gt;
|[[STR2]]&lt;br /&gt;
| 2.541&lt;br /&gt;
| 2541&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/11 19:08&lt;br /&gt;
|-&lt;br /&gt;
|[[Os01g0248900]]&lt;br /&gt;
| 2.537&lt;br /&gt;
| 5733&lt;br /&gt;
| 0.443&lt;br /&gt;
| 2&lt;br /&gt;
| 2&lt;br /&gt;
| 2015/5/13 15:07&lt;br /&gt;
|-&lt;br /&gt;
|[[Os10g0100200]]&lt;br /&gt;
| 2.251&lt;br /&gt;
| 2918&lt;br /&gt;
| 0.771&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 16:43&lt;br /&gt;
|-&lt;br /&gt;
|[[Xa33(t)]]&lt;br /&gt;
| 2.219&lt;br /&gt;
| 2219&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/12 23:54&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g47210]]&lt;br /&gt;
| 2.152&lt;br /&gt;
| 2152&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/8 17:23&lt;br /&gt;
|-&lt;br /&gt;
|[[TestTemplate]]&lt;br /&gt;
| 2.146&lt;br /&gt;
| 2146&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2015/5/7 11:04&lt;br /&gt;
|-&lt;br /&gt;
|[[Os12g0568500]]&lt;br /&gt;
| 2.145&lt;br /&gt;
| 2832&lt;br /&gt;
| 0.757&lt;br /&gt;
| 3&lt;br /&gt;
| 3&lt;br /&gt;
| 2015/6/13 17:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Du-1]]&lt;br /&gt;
| 2.102&lt;br /&gt;
| 2102&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/14 15:22&lt;br /&gt;
|-&lt;br /&gt;
|[[OS08G0523000]]&lt;br /&gt;
| 2.006&lt;br /&gt;
| 2006&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/26 22:50&lt;br /&gt;
|-&lt;br /&gt;
|[[Os07g0492000]]&lt;br /&gt;
| 1.777&lt;br /&gt;
| 1777&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 23:45&lt;br /&gt;
|-&lt;br /&gt;
|[[AU030811]]&lt;br /&gt;
| 1.776&lt;br /&gt;
| 1776&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/6 21:33&lt;br /&gt;
|-&lt;br /&gt;
|[[GS6]]&lt;br /&gt;
| 1.7&lt;br /&gt;
| 1700&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/15 20:56&lt;br /&gt;
|-&lt;br /&gt;
|[[AY643716]]&lt;br /&gt;
| 1.609&lt;br /&gt;
| 1609&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/7 13:20&lt;br /&gt;
|-&lt;br /&gt;
|[[Brown_planthopper_resistance-1]]&lt;br /&gt;
| 1.584&lt;br /&gt;
| 1584&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 14:51&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0741100]]&lt;br /&gt;
| 1.578&lt;br /&gt;
| 1578&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/19 3:18&lt;br /&gt;
|-&lt;br /&gt;
|[[Os11g0102100]]&lt;br /&gt;
| 1.347&lt;br /&gt;
| 1347&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/6/9 19:03&lt;br /&gt;
|-&lt;br /&gt;
|[[Os03g0401300]]&lt;br /&gt;
| 1.308&lt;br /&gt;
| 1308&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 1&lt;br /&gt;
| 2014/5/14 14:15&lt;br /&gt;
|}&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0542100&amp;diff=270800</id>
		<title>Os10g0542100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0542100&amp;diff=270800"/>
				<updated>2016-06-23T16:02:23Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os10g0542100''''' was  first identified as '''''OsMT-II-1a''''' in 2005 by the researchers from Tsinghua University &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
  This genomic fragment encoding a characteristic metallothionein (MT) protein, and its full-length cDNA was isolated from rice developing seeds by RT-PCR. This cDNA, designated OsMT-II-1a, contains an open reading frame of 264 bp encoding a protein of 87 amino acid residues. The predicted amino acid sequence was shown to have structural features characteristic of plant class II MT proteins. Accumulation of OsMT-II-1a mRNA is specifically abundant in developing seeds and 2-day glumes after pollination, and OsMT-II-1a transcription can markedly be induced by H2O2, paraquat, SNP, ethephon, ABA and SA, but barely by metal ions or other exogenous abiotic factors such as low temperature and PEG. The processes of pollination and seed development might be mediated, at least in part, by expression of the OsMT-II-1a gene that is regulated by several abiotic factors.&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
Plant MTs have been suggested to play important roles in maintaining the homoeostasis of essential transition metals, detoxification of toxic metals, and protecting against intercellular oxidative stress. Moreover, the diverse expression patterns of MT genes suggest that MT-like protein isoforms may differ in sequence, as well as in the functions that these perform in specific tissues. A number of investigations demonstrated these to have distinct but overlapping functions in the multigene family in single species. Recently, several studies indicated that plant MT-like proteins, especially the characterized plant class II MT-like proteins, are also involved in important developmental processes showed that the 50-flanking genomic DNA for the wheat EcMT gene contains a core sequence in the 50-flanking region known to be an ABA-responsive element (ABARE), but does not contain metal-responsive elements seen in animal MT genes. Consistent with this, accumulation of the EcMT mRNA is strongly induced during development of immature embryos but not during germination of mature wheat embryos unless ABA is added to the germination medium. Also, supplementation of the medium with zinc does not induce accumulation of EcMT mRNA in germination embryos.&lt;br /&gt;
Accumulation of OsMT-II-1a mRNA is specifically abundant in developing seeds and 2-day glumes after pollination. However, embryogenesis is a complex process regulated by the developmental program and aimed at the formation of viable seeds able to germinate under appropriate environmental conditions. ABA and active oxygen species are postulated to play an important role in many processes of embryogenesis. Also, a hallmark of MT gene regulation is their inducibility by different endogenous and exogenous factors acting directly or indirectly on multiple cis-acting motifs in the regulatory regions of MT genes. Therefore, to investigate whether embryogenesis-related signal molecules (such as ABA and active oxygen species) or other exogenous factors (such as PEG, SA, ethylene, heat shock, low temperature, wounding and etiolation) are involved in the regulation of the OsMT-II-1a gene, rice seedlings treated with the above stress factors were harvested, and the transcriptional levels of OsMT-II-1a gene were determined by northern analysis. The effects of ABA, paraquat, SA and SNP were most dramatic in roots, whereas the transcript levels of OsMT-II-1a were low after treatments of H2O2, ethephon, heat shock and etiolation. In shoots, OsMT-II-1a mRNA levels were elevated markedly by treatments with H2O2, ethephon, ABA and SA, but were only slightly induced by treatments with SNP, paraquat, heat shock, low temperature and etiolation. Interestingly, the expression of OsMT-II-1a can be induced, markedly by embryogenesis-related signal molecules (e.g. H2O2 and ABA) or related reagents (e.g. SNP and paraquat), slightly by heat shock, low temperature and etiolation, but hardly by other exogenous factors (e.g. PEG and wounding). These results suggest that the OsMT-II-1a protein may play a role during embryogenesis, but not in response to environmental stresses. On the basis of the above results and previous studies, we further propose that the OsMT-II-1a protein not only shares similar roles with wheat EcMT protein in storing metal ions that are required during germination, but might also be involved in providing metal ions to maturing pollen grains since some metals, such as Cu, Zn and Fe, are essential micronutrient elements required for a variety of processes in cellular metabolism and serve as structural and catalytic components of proteins and enzymes. The latter proposal is further supported by results showing that the transcript abundance of OsMT-II-1a can be detected by treatment with ethephon, but it is barely detectable in the rachises, stems, sheaths, leaves and roots.&lt;br /&gt;
It should be noted that ethylene can also modulate the expression of OsMT-II-1a. What is the relationship between metal ions, OsMT-II-1a expression and ethylene during embryogenesis? Results from recent studies indicated that metal ions are involved in ethylene perception and signal transduction by binding to the receptor. In our opinion, it is possible that application of exogenous ethephon may result in an increased usage of metal ions, thereby lowering the cellular metal ion pool. This in turn increases OsMT-II-1a expression and enhances the transport of metal ions that is required during germination and maturation of pollen grains. On the other hand, ethylene can enhance the production of active oxygen species, which in turn can induce the OsMT-II-1a gene expression. Whether ethylene modulates the expression of OsMT-II-1a alone or in conjunction with other signaling molecules such as active oxygen species remains to be further investigated.&lt;br /&gt;
Furthermore, a variety of oxidants such as H2O2, SNP and paraquat are involved in the regulation of MT gene expression by inducing disulfide formation. Comparison with the presence of putative ARE in the 50-flanking region raises the question of whether oxidants induce the expression of OsMT-II-1a by oxidizing MT cysteines, by ARE, or by both of them together. Further analysis is required to evaluate the relationship between oxidants and OsMT-II-1a expression. Additionally, SA treatments can markedly enhance H2O2 production, which suggests that SA-mediated H2O2 production may result in OsMT-II-1a expression. Previous studies indicated that accumulation of EcMT mRNA can be induced strongly by ABA. Our results presented here are in line with their findings, showing that in both roots and shoots, the transcription of OsMT-II-1a gene is markedly induced by ABA. Taken together and comparing with the presence of two putative ABARE (ACGTGCCC), one putative ARE (GCCAAGTCACC) and one putative GCC-box (GCCGCC) found in many pathogen-responsive genes as ethylene-responsive elements in the 50-flanking region of OsMT-II-1a gene, it might be probable that the predicted cis-elements may be involved in the regulation of OsMT-II-1a expression.&lt;br /&gt;
On the other hand, metal ions have been shown to up-regulate class I MT-like gene expression in plants, and it has also been observed that wheat EcMT protein provides a mechanism for storing zinc that is required during germination. We are interested in whether the expression of class II MT gene is affected by metal ions. To test the effects of metal ions on the gene, OsMT-II-1a transcript accumulation was investigated in shoots of 10-day-old rice seedling exposed to different metal ions at different concentrations. six metal ions, including Fe, Cu, Al, Pb, Cd and Zn, failed to induce distinctly the accumulation of OsMT-II-1a mRNA in shoots, as well as in roots (data not shown). These results coincide with the prediction of existing regulatory cis-elements in its 50-flanking region, indicating that the expression of OsMT-II-1a might not be appreciably induced by metal ions, which is different from class I MT-like genes. On the basis of the above results, it would appear that the involvement of OsMT-II-1a protein in a general process of metal detoxification or tolerance in developing seeds and 2-day glumes after pollination cannot be attributed, unlike Arabidopsis metallothioneins with the function of metal detoxification, since it is more probable that this kind of mechanism would be accomplished in other parts of rice (e.g. in the leaves or roots) treated with metal ions.&lt;br /&gt;
In this study, we described and characterized a rice class II MT-like gene OsMT-II-1a; its putative regulatory elements may be present to support its roles in transcriptional regulation processing. Northern blot analysis clearly showed that accumulation of OsMT-II-1a mRNA may occur at specific stages of development (e.g. pollination), in specific tissues (e.g. developing seeds) and under treatments with embryogenesis-related signal molecules (e.g. ABA and H2O2, etc.). These results suggest that the processes of pollination and seed development might be mediated, at least in part, by the expression of the OsMT-II-1a gene that is regulated by ABA and H2O2, etc. Therefore, our results here will provide a framework for continued studies on the transduction pathway linking the environmental signals known to affect pollen embryogenesis, the gene regulated by these signals, and the developmental response of pollination and seed development. It is expected that this work will shed some light on the comprehension of the physiological role of class II MT in plants.&lt;br /&gt;
[[File:function-1.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Reynolds and Crawford further showed that ABA biosynthesis is accompanied by increased expression of the EcMT gene transcript concommitant with the differentiation of pollen embryoids in wheat anther cultures, and suggested that the EcMT gene plays an important role in pollen embryogenesis. To date, however, it is not known if different class II MT genes have specific functions in different organs, or at different developmental stages besides embryogenesis. Also their response to the different exogenous factors except zinc remain unclear. Therefore, we were very interested in the relationship between expression of plant class II MT genes and various developmental or environmental signals.&lt;br /&gt;
The expression of class I MT-like genes has been characterized in many kinds of tissues. These reports suggest that class I MT-like genes are different in structure and are likely to play diverse roles and functions in plants in order to cope with complex developmental and environmental cues. To date, however, the expression pattern of class II MT genes has only been reported during wheat embryogenesis and in the developing seeds of Arabidopsis. To investigate the expression pattern of the OsMTII-&lt;br /&gt;
1a gene in different organs and at different developmental stages, a more detailed analysis of OsMT-II-1a mRNA accumulation in mature plants was carried out. Total RNA from tissues of roots, stems, rachises, glumes before pollination, 2-day glumes after pollination, developing seeds, young leaves, mature leaves, old leaves, young sheaths, mature sheaths and old sheaths were subjected to Northern blot analysis. Our results here show that the transcripts of OsMT-II-1a were specifically abundant not only in developing seeds but also in glumes, whereas the highest expression was detected only in 2-day glumes after pollination, in which levels were 2 times higher than in developing seeds. In addition, the hybridization signal was barely detected in roots, old leaves, mature sheaths and old sheaths, but a very weak hybridization signal was detected in glumes before pollination, young leaves, mature leaves, old leaves and young sheaths. These results further support the fact that expression of OsMT-II-1a is only restricted to a particular developmental stage (e.g. pollination) and specific tissue (e.g. developing seeds). Taken together, the special expression pattern of OsMT-II-1a is consistent with the presence of the predicted embryogenesis-related cis-elements in the 50-flanking region of OsMT-II-1a, which suggests that these cis-elements might be involved in the regulation of OsMT-II-1a during pollination and seed development.&lt;br /&gt;
[[File:Expression-1.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The coding region of OsMT-II-1a, when translated, is demonstrated to contain 17 cysteine residues arranged into three groups of 6, 6 and 5 cysteines, which are separated by two interdomain regions of 13 and 15 cysteine-free amino acid residues, respectively. The abundance (about 15%) and the distribution of cysteines in OsMT-II-1a were shown to have structural features characteristic of the class II MT-like proteins. An alignment of the deduced OsMT-II-1a protein with all known class II MT-like proteins is shown in Fig. It has high homology with the plant class II MT-like proteins, with the overall sequence similarity varying substantially from 82% to 49%. We discovered that, unlike class I MT-like genes with several members, the members of class II MT-like genes are no more than 2 in a single species, and the arrangement patterns of cysteines are the same in each member. These results imply that this class of proteins might be conserved in structure and may play a special role in plants. Compared to those proteins from dicots, class II proteins from monocots lack 8–13 amino acids in the N-terminal domain before the first cysteine residue, but have a few additional amino acids in the C-terminal domain, thus maintaining the similar size of class II proteins between monocots and dicots. A phylogenetic tree of all known plant class II MT-like proteins was constructed, which showed two distinct groups corresponding to monocots and dicots. Thus, the differences in the structures of class II MT-like proteins may suggest specific functions for monocots and dicots.&lt;br /&gt;
Several DNA motifs were identified in the promoter of OsMT-II-1a that are homologous to various previously reported regulated elements, which might be important in the transcriptional regulation of this gene. Two putative ABA responsive elements (ABARE) were found (one in a forward orientation and the other in reverse), which were also found in the wheat Em gene and rice rab21 gene. One putative ethylene-responsive element identified was the GCC box, GCCGCC, which was found in many ethylene inducible pathogenesis-related genes. An antioxidant response element (ARE), four low-temperature responsive elements (LTRE), four ABARE-like sequences and four CCAAT boxes were also found in the promoter of OsMT-II-1a. In a word, the presence of these homologous sequences may be related with the effects of various stress treatments on the expression of OsMT-II-1a. Also, unlike animal and most plant class I MT genes containing the metal-responsive element TGCRCNC (in which N is not A, and R is A or G) and/or copper-responsive element CTGCCA, the promoter of OsMT-II-1a did not contain any known metal-responsive elements or metal regulatory motifs. These findings suggested that the expression of OsMT-II-1a gene might not be modulated by metal ions. Additionally, we also found many cis-elements related with embryo-, pollen- and endosperm-specific gene transcription such as legumin box, ACGT motif, AGAAA motif and (CA)n element. These data hint that OsMT-II-1a protein might play some important role during embryogenesis. In addition, one 86-bp length intron divided the coding sequence of OsMT-II- 1a into two fragments with sizes of 59 and 205 bp. The sequences bordering the inton/exon conform to the GT/AG but not AT/AC rule for splice junctions, which is consistent with other MT-like gene sequences in rice (personal communication).&lt;br /&gt;
[[File:evolution-1.jpg]]&lt;br /&gt;
[[File:evolution-2.jpg]]&lt;br /&gt;
[[File:table.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
* Laboratory of Molecular Biology and MOE Laboratory of Protein Science； Department of Biological Sciences and Biotechnology, Tsinghua University&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Zhou, Gong-Ke, Yu-Feng Xu, and Jin-Yuan Liu. &amp;quot;Characterization of a rice class II metallothionein gene: tissue expression patterns and induction in response to abiotic factors.&amp;quot; Journal of plant physiology 162.6 (2005): 686-696.&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 10]]&lt;br /&gt;
[[Category:Chromosome 10]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0542100&amp;diff=270799</id>
		<title>Os10g0542100</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os10g0542100&amp;diff=270799"/>
				<updated>2016-06-23T15:59:58Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os10g0542100''''' was  first identified as '''''OsMT-II-1a''''' in 2005 by the researchers from Tsinghua University &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
  This genomic fragment encoding a characteristic metallothionein (MT) protein, and its full-length cDNA was isolated from rice developing seeds by RT-PCR. This cDNA, designated OsMT-II-1a, contains an open reading frame of 264 bp encoding a protein of 87 amino acid residues. The predicted amino acid sequence was shown to have structural features characteristic of plant class II MT proteins. Accumulation of OsMT-II-1a mRNA is specifically abundant in developing seeds and 2-day glumes after pollination, and OsMT-II-1a transcription can markedly be induced by H2O2, paraquat, SNP, ethephon, ABA and SA, but barely by metal ions or other exogenous abiotic factors such as low temperature and PEG. The processes of pollination and seed development might be mediated, at least in part, by expression of the OsMT-II-1a gene that is regulated by several abiotic factors.&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
Plant MTs have been suggested to play important roles in maintaining the homoeostasis of essential transition metals, detoxification of toxic metals, and protecting against intercellular oxidative stress. Moreover, the diverse expression patterns of MT genes suggest that MT-like protein isoforms may differ in sequence, as well as in the functions that these perform in specific tissues. A number of investigations demonstrated these to have distinct but overlapping functions in the multigene family in single species. Recently, several studies indicated that plant MT-like proteins, especially the characterized plant class II MT-like proteins, are also involved in important developmental processes showed that the 50-flanking genomic DNA for the wheat EcMT gene contains a core sequence in the 50-flanking region known to be an ABA-responsive element (ABARE), but does not contain metal-responsive elements seen in animal MT genes. Consistent with this, accumulation of the EcMT mRNA is strongly induced during development of immature embryos but not during germination of mature wheat embryos unless ABA is added to the germination medium. Also, supplementation of the medium with zinc does not induce accumulation of EcMT mRNA in germination embryos.&lt;br /&gt;
Accumulation of OsMT-II-1a mRNA is specifically abundant in developing seeds and 2-day glumes after pollination. However, embryogenesis is a complex process regulated by the developmental program and aimed at the formation of viable seeds able to germinate under appropriate environmental conditions. ABA and active oxygen species are postulated to play an important role in many processes of embryogenesis. Also, a hallmark of MT gene regulation is their inducibility by different endogenous and exogenous factors acting directly or indirectly on multiple cis-acting motifs in the regulatory regions of MT genes. Therefore, to investigate whether embryogenesis-related signal molecules (such as ABA and active oxygen species) or other exogenous factors (such as PEG, SA, ethylene, heat shock, low temperature, wounding and etiolation) are involved in the regulation of the OsMT-II-1a gene, rice seedlings treated with the above stress factors were harvested, and the transcriptional levels of OsMT-II-1a gene were determined by northern analysis. The effects of ABA, paraquat, SA and SNP were most dramatic in roots, whereas the transcript levels of OsMT-II-1a were low after treatments of H2O2, ethephon, heat shock and etiolation. In shoots, OsMT-II-1a mRNA levels were elevated markedly by treatments with H2O2, ethephon, ABA and SA, but were only slightly induced by treatments with SNP, paraquat, heat shock, low temperature and etiolation. Interestingly, the expression of OsMT-II-1a can be induced, markedly by embryogenesis-related signal molecules (e.g. H2O2 and ABA) or related reagents (e.g. SNP and paraquat), slightly by heat shock, low temperature and etiolation, but hardly by other exogenous factors (e.g. PEG and wounding). These results suggest that the OsMT-II-1a protein may play a role during embryogenesis, but not in response to environmental stresses. On the basis of the above results and previous studies, we further propose that the OsMT-II-1a protein not only shares similar roles with wheat EcMT protein in storing metal ions that are required during germination, but might also be involved in providing metal ions to maturing pollen grains since some metals, such as Cu, Zn and Fe, are essential micronutrient elements required for a variety of processes in cellular metabolism and serve as structural and catalytic components of proteins and enzymes. The latter proposal is further supported by results showing that the transcript abundance of OsMT-II-1a can be detected by treatment with ethephon, but it is barely detectable in the rachises, stems, sheaths, leaves and roots.&lt;br /&gt;
It should be noted that ethylene can also modulate the expression of OsMT-II-1a. What is the relationship between metal ions, OsMT-II-1a expression and ethylene during embryogenesis? Results from recent studies indicated that metal ions are involved in ethylene perception and signal transduction by binding to the receptor. In our opinion, it is possible that application of exogenous ethephon may result in an increased usage of metal ions, thereby lowering the cellular metal ion pool. This in turn increases OsMT-II-1a expression and enhances the transport of metal ions that is required during germination and maturation of pollen grains. On the other hand, ethylene can enhance the production of active oxygen species, which in turn can induce the OsMT-II-1a gene expression. Whether ethylene modulates the expression of OsMT-II-1a alone or in conjunction with other signaling molecules such as active oxygen species remains to be further investigated.&lt;br /&gt;
Furthermore, a variety of oxidants such as H2O2, SNP and paraquat are involved in the regulation of MT gene expression by inducing disulfide formation. Comparison with the presence of putative ARE in the 50-flanking region raises the question of whether oxidants induce the expression of OsMT-II-1a by oxidizing MT cysteines, by ARE, or by both of them together. Further analysis is required to evaluate the relationship between oxidants and OsMT-II-1a expression. Additionally, SA treatments can markedly enhance H2O2 production, which suggests that SA-mediated H2O2 production may result in OsMT-II-1a expression. Previous studies indicated that accumulation of EcMT mRNA can be induced strongly by ABA. Our results presented here are in line with their findings, showing that in both roots and shoots, the transcription of OsMT-II-1a gene is markedly induced by ABA. Taken together and comparing with the presence of two putative ABARE (ACGTGCCC), one putative ARE (GCCAAGTCACC) and one putative GCC-box (GCCGCC) found in many pathogen-responsive genes as ethylene-responsive elements in the 50-flanking region of OsMT-II-1a gene, it might be probable that the predicted cis-elements may be involved in the regulation of OsMT-II-1a expression.&lt;br /&gt;
On the other hand, metal ions have been shown to up-regulate class I MT-like gene expression in plants, and it has also been observed that wheat EcMT protein provides a mechanism for storing zinc that is required during germination. We are interested in whether the expression of class II MT gene is affected by metal ions. To test the effects of metal ions on the gene, OsMT-II-1a transcript accumulation was investigated in shoots of 10-day-old rice seedling exposed to different metal ions at different concentrations. six metal ions, including Fe, Cu, Al, Pb, Cd and Zn, failed to induce distinctly the accumulation of OsMT-II-1a mRNA in shoots, as well as in roots (data not shown). These results coincide with the prediction of existing regulatory cis-elements in its 50-flanking region, indicating that the expression of OsMT-II-1a might not be appreciably induced by metal ions, which is different from class I MT-like genes. On the basis of the above results, it would appear that the involvement of OsMT-II-1a protein in a general process of metal detoxification or tolerance in developing seeds and 2-day glumes after pollination cannot be attributed, unlike Arabidopsis metallothioneins with the function of metal detoxification, since it is more probable that this kind of mechanism would be accomplished in other parts of rice (e.g. in the leaves or roots) treated with metal ions.&lt;br /&gt;
In this study, we described and characterized a rice class II MT-like gene OsMT-II-1a; its putative regulatory elements may be present to support its roles in transcriptional regulation processing. Northern blot analysis clearly showed that accumulation of OsMT-II-1a mRNA may occur at specific stages of development (e.g. pollination), in specific tissues (e.g. developing seeds) and under treatments with embryogenesis-related signal molecules (e.g. ABA and H2O2, etc.). These results suggest that the processes of pollination and seed development might be mediated, at least in part, by the expression of the OsMT-II-1a gene that is regulated by ABA and H2O2, etc. Therefore, our results here will provide a framework for continued studies on the transduction pathway linking the environmental signals known to affect pollen embryogenesis, the gene regulated by these signals, and the developmental response of pollination and seed development. It is expected that this work will shed some light on the comprehension of the physiological role of class II MT in plants.&lt;br /&gt;
[[File:function-1.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Reynolds and Crawford further showed that ABA biosynthesis is accompanied by increased expression of the EcMT gene transcript concommitant with the differentiation of pollen embryoids in wheat anther cultures, and suggested that the EcMT gene plays an important role in pollen embryogenesis. To date, however, it is not known if different class II MT genes have specific functions in different organs, or at different developmental stages besides embryogenesis. Also their response to the different exogenous factors except zinc remain unclear. Therefore, we were very interested in the relationship between expression of plant class II MT genes and various developmental or environmental signals.&lt;br /&gt;
The expression of class I MT-like genes has been characterized in many kinds of tissues. These reports suggest that class I MT-like genes are different in structure and are likely to play diverse roles and functions in plants in order to cope with complex developmental and environmental cues. To date, however, the expression pattern of class II MT genes has only been reported during wheat embryogenesis and in the developing seeds of Arabidopsis. To investigate the expression pattern of the OsMTII-&lt;br /&gt;
1a gene in different organs and at different developmental stages, a more detailed analysis of OsMT-II-1a mRNA accumulation in mature plants was carried out. Total RNA from tissues of roots, stems, rachises, glumes before pollination, 2-day glumes after pollination, developing seeds, young leaves, mature leaves, old leaves, young sheaths, mature sheaths and old sheaths were subjected to Northern blot analysis. Our results here show that the transcripts of OsMT-II-1a were specifically abundant not only in developing seeds but also in glumes, whereas the highest expression was detected only in 2-day glumes after pollination, in which levels were 2 times higher than in developing seeds. In addition, the hybridization signal was barely detected in roots, old leaves, mature sheaths and old sheaths, but a very weak hybridization signal was detected in glumes before pollination, young leaves, mature leaves, old leaves and young sheaths. These results further support the fact that expression of OsMT-II-1a is only restricted to a particular developmental stage (e.g. pollination) and specific tissue (e.g. developing seeds). Taken together, the special expression pattern of OsMT-II-1a is consistent with the presence of the predicted embryogenesis-related cis-elements in the 50-flanking region of OsMT-II-1a, which suggests that these cis-elements might be involved in the regulation of OsMT-II-1a during pollination and seed development.&lt;br /&gt;
[[File:Expression-1.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
The coding region of OsMT-II-1a, when translated, is demonstrated to contain 17 cysteine residues arranged into three groups of 6, 6 and 5 cysteines, which are separated by two interdomain regions of 13 and 15 cysteine-free amino acid residues, respectively. The abundance (about 15%) and the distribution of cysteines in OsMT-II-1a were shown to have structural features characteristic of the class II MT-like proteins. An alignment of the deduced OsMT-II-1a protein with all known class II MT-like proteins is shown in Fig. It has high homology with the plant class II MT-like proteins, with the overall sequence similarity varying substantially from 82% to 49%. We discovered that, unlike class I MT-like genes with several members, the members of class II MT-like genes are no more than 2 in a single species, and the arrangement patterns of cysteines are the same in each member. These results imply that this class of proteins might be conserved in structure and may play a special role in plants. Compared to those proteins from dicots, class II proteins from monocots lack 8–13 amino acids in the N-terminal domain before the first cysteine residue, but have a few additional amino acids in the C-terminal domain, thus maintaining the similar size of class II proteins between monocots and dicots. A phylogenetic tree of all known plant class II MT-like proteins was constructed, which showed two distinct groups corresponding to monocots and dicots. Thus, the differences in the structures of class II MT-like proteins may suggest specific functions for monocots and dicots.&lt;br /&gt;
Several DNA motifs were identified in the promoter of OsMT-II-1a that are homologous to various previously reported regulated elements, which might be important in the transcriptional regulation of this gene. Two putative ABA responsive elements (ABARE) were found (one in a forward orientation and the other in reverse), which were also found in the wheat Em gene and rice rab21 gene. One putative ethylene-responsive element identified was the GCC box, GCCGCC, which was found in many ethylene inducible pathogenesis-related genes. An antioxidant response element (ARE), four low-temperature responsive elements (LTRE), four ABARE-like sequences and four CCAAT boxes were also found in the promoter of OsMT-II-1a. In a word, the presence of these homologous sequences may be related with the effects of various stress treatments on the expression of OsMT-II-1a. Also, unlike animal and most plant class I MT genes containing the metal-responsive element TGCRCNC (in which N is not A, and R is A or G) and/or copper-responsive element CTGCCA, the promoter of OsMT-II-1a did not contain any known metal-responsive elements or metal regulatory motifs. These findings suggested that the expression of OsMT-II-1a gene might not be modulated by metal ions. Additionally, we also found many cis-elements related with embryo-, pollen- and endosperm-specific gene transcription such as legumin box, ACGT motif, AGAAA motif and (CA)n element. These data hint that OsMT-II-1a protein might play some important role during embryogenesis. In addition, one 86-bp length intron divided the coding sequence of OsMT-II- 1a into two fragments with sizes of 59 and 205 bp. The sequences bordering the inton/exon conform to the GT/AG but not AT/AC rule for splice junctions, which is consistent with other MT-like gene sequences in rice (personal communication).&lt;br /&gt;
[[File:evolution-1.jpg]]&lt;br /&gt;
[[File:evolution-2.jpg]]&lt;br /&gt;
[[File:table.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Laboratory of Molecular Biology and MOE Laboratory of Protein Science；&lt;br /&gt;
Department of Biological Sciences and Biotechnology, Tsinghua University&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Zhou, Gong-Ke, Yu-Feng Xu, and Jin-Yuan Liu. &amp;quot;Characterization of a rice class II metallothionein gene: tissue expression patterns and induction in response to abiotic factors.&amp;quot; Journal of plant physiology 162.6 (2005): 686-696.&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 10]]&lt;br /&gt;
[[Category:Chromosome 10]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0771200&amp;diff=270798</id>
		<title>Os01g0771200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0771200&amp;diff=270798"/>
				<updated>2016-06-23T14:01:18Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os01g0771200''''' was  first identified as '''''XB24''''' in 2010 by the researchers from University of Cambridge&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Bcakground===&lt;br /&gt;
&lt;br /&gt;
*Cell-surface pattern recognition receptors (PRRs) are key components of the innate immune response in animals and plants. These receptors typically carry or associate with non-RD kinases to control early events of innate immunity signaling. Despite their importance, the mode of regulation of PRRs is largely unknown. Here we show that the rice PRR, XA21(Activator of XA21-mediated immunity), interacts with XA21 binding protein 24 (XB24), a previously undescribed ATPase. To date, three XA21 binding (XB) proteins—XB3 (an E3 ubiquitinligase), XB10 (OsWRKY62), and XB15 (a PP2C phosphatase)—have been shown to regulate XA21-mediated immunity. XB24 associates with XA21 in vivo and modulates XA21 function. XB24 belongs to a large class of broadly conserved ATPases of unknown function. The association between XB24 and XA21 is compromised upon inoculation of the Xanthomonas oryzae pv.&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
*'''XB24 ATPase Enhances Autophosphorylation of XA21K668.''' The author tested whether XB24 is a substrate of XA21 or affects XA21 kinase autophosphorylation. Purified His-XB24 and GST-XA21K668 were co-incubated in the presence of [32P]ATP for kinase analysis. For a control, the purified His-XB24 was co-incubated with GST-XA21K668K736E, a catalytically inactive mutant&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. As ( '''Fig. 2B''' ) shows, the GST-XA21K668 autophosphorylates as expected, whereas His-XB24 does not autophosphorylate or become transphosphorylated by GST-XA21K668. The phosphorylation of GSTXA21K668 is highly enhanced in the presence ofHis-XB24 protein.No phosphorylation of GST-XA21K668K736E can be detected in reactions carried out in the presence of absence of His-XB24. These results demonstrate that XB24 promotes XA21K668 autophosphorylation.To test whether XB24 promotes autophosphorylation of intact, native XA21 protein, the immunoprecipitated ProAXA21 protein from rice tissue described above (0, 1, or 2 days post-PXO99 inoculation) was co-incubated with the purified His-XB24 for kinase autophosphorylation analyses.These results demonstrate that XB24 promotes autophosphorylation of the native XA21 protein. Furthermore, XB24 is not transphosphorylated by the XA21 protein with or without PXO99 inoculation. To test whether the ATPase activity of XB24 is required for promoting XA21K668 autophosphorylation, the purified Ntap-XB24 and NtapXB24S154A were incubated with GST-taggedXA21K668 in the presence of [32P]ATP for kinase analyses. Autophosphorylation of GST-XA21K668 is enhanced in the presence of rice-expressed Ntap-XB24 but not Ntap-XB24S154A ('''Fig. 2C'''). Autophosphorylation of the GST-XA21K668 fusion protein is also enhanced in the presence of the His-XB24 protein but not His-XB24S154A. These results demonstrate that XB24 enhances XA21 autophosphorylation and that itsATPase activity is required for this function&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Silencing of Xb24 Enhances Xa21-Mediated Resistance.''' To investigate the biological function of XB24, they used the RNA interference(RNAi) approach&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot;/&amp;gt; to silence the Xb24 gene and monitored its effects on disease resistance. They developed two independent lines, Xb24RNAi-3 and Xb24RNAi-9, each containing a single-locus insertion, using the rice cultivar Kitaake as the transgene recipient.RT-PCR analysis revealed that Xb24 transcript levels were significantly reduced in these two lines. Both lines show similar disease lesion lengths compared to the control line Kitaake after challenge with PXO99, indicating that silencing of Xb24 does not affect the susceptibility of Kitaake to Xoo. To explore the role of XB24 in XA21-mediated signaling, they crossed Xb24RNAi-3 and Xb24RNAi-9 with Xa21 lines and obtained one progeny form the Xa21/Xb24RNAi-3 cross and three from the Xa21/Xb24RNAi-9 cross. Our initial results indicated that silencing of Xb24 enhanced resistance. To confirm these results, they developed an F4 line (A176) from one of the F1 plants.TheA176 line carries homozygous Xa21 and homozygous Xb24RNAi-9. They then inoculated 3-week-old A176 plants.As shown in （'''Fig. 3A'''）, these plants developed much shorter lesion lengths (3 ± 0.9 cm) than the wildtype Xa21 plants (6.8±1.2 cm), which show only partial resistance at the 3-weeks-old (tilling) stage&amp;lt;ref name=&amp;quot;ref5&amp;quot;/&amp;gt;. At test gave a P value of 8.62 ×10−13, showing a highly significant difference. Rice line Xb24RNAi-9 showed similar disease lesion lengths (16 ± 2.5 cm) as Kitaake (P =0.56). Bacterial growth curve analysis revealed that Xa21/Xb24RNAi-9 lines harbor 3.2-fold less Xoo bacteria (1.48 × 107 ±1.2 × 106) in their leaves than the Xa21 lines (4.8 × 107±4.4 × 106) at 12 days postinoculation ('''Fig. 3B'''), consistent with the leaf lesion length measurements described above. This experiment was repeated three times, and similar results were obtained each time. These results demonstrate that silencing of Xb24 expression enhances XA21-mediated disease resistance&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Overexpression of XB24 Compromises XA21-Mediated Resistance.''' To investigate the involvement of XB24 in the XA21-mediated signaling, the author created construct Ubi-Xb24 to overexpress XB24 using the maize Ubi-1 promoter. They introduced the Ubi-Xb24 construct directly into an Xa21 (in the TP309 genetic background)line by Agrobacterium-mediated transformation using mannose selection&amp;lt;ref name=&amp;quot;ref6&amp;quot;/&amp;gt; and generated five independent T0 plants. After PCR-based genotyping and RT-PCR-based transcripts expression analyses to confirm that Xb24 is overexpressed, they challenged 6-week-old Xa21 lines with PXO99.They found that all of the five lines have longer disease lesion lengths compared with the wild-type Xa21 plants. Two homozygous lines (Xa21/Xb24ox-1 and -2) fromtwo of these five independent lines were then developed. Overexpression of XB24 (XB24ox) in the progeny from these homozygous lines was confirmed by protein gel blotting analysis('''Fig. 4A'''). Six-week-old plants were challenged with PXO99. Disease lesion lengths on both the Xa21/Xb24ox-1 and -2 lines (7.3 ± 0.5 cmfor line 1 and 6.0 ± 0.5 cmfor line 2) were longer than those observed on Xa21 lines (1.3 ±0.4 cm) ('''Fig. 4 A and B'''). The low P values (5.02 × 10−21 for Xa21/Xb24ox-1 and 2.06 × 10−23 for Xa21/Xb24ox-2) indicate that these differences are statistically significant. At 12 days postinoculation,the accumulation of bacterial populations, as measured by bacterial growth curve analysis, in the two Xa21/Xb24ox lines (1.23 × 108 ±1.88 × 107 for Xa21/Xb24ox-1 and 1.08 × 108 ± 1.97 × 107 for Xa21/Xb24ox-2)was clearly higher (&amp;gt;2-fold) than in theXa21 lines (5.20×107 ± 8.9 × 105) ('''Fig. 4C'''). Again, the low P values (8.27 × 10−4 forXa21/Xb24ox-1 and 2.72 × 10−3 for Xa21/Xb24ox-2) of bacterial accumulation at 12 days postinoculation indicate that these differences are statistically significant. Rice lines overexpressing Xb24 display similar levels of susceptibility as control lines lacking overexpressed Xb24 in three independent biological replicates.These results demonstrate that overexpression of XB24 compromises XA21-mediated resistance&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Overexpression of Xb24 Causes XA21 Instability Following Ax21 Recognition.''' To gain insight into the mechanism of XB24-mediated regulation of XA21 function, they tested whether XB24 affects the amount of the XA21 protein after Xoo inoculation. As shown in '''Fig. 6 A and B''', without Xoo inoculation (Mock treatment).   Overexpression of XB24(Xa21/Ntap-Xb24) caused no significant decrease in the ProA-XA21 protein level compared to overexpression of Ntap (Xa21/Ntap) alone. In contrast, after inoculation with PXO99, the Xa21/Xb24ox line showed a sharp decrease in the ProA-XA21 protein level. The Xa21/Ntap control line showed amarked increase. When inoculated with the Xoo strain PXO99ΔraxST, the Xa21/Xb24ox sample showed an increase in the ProA-XA21 level similar to that of the Xa21/Ntap control. Similar results were obtained from three biological repeats of this experiment.These results indicate that the sharp decrease in the XA21 protein level is Ax21-specific&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
[[File:1HF1.jpg|frame|Fig. 1. Association of XB24 with XA21 in yeast and in rice plants. (A) Interaction&lt;br /&gt;
of XB24 with XA21K668 in yeast. K668, truncated XA21 (XA21K668)&lt;br /&gt;
containing the entire JM and kinase domains (23); K668K736E, kinase catalytically&lt;br /&gt;
inactive mutant XA21K668K736E; XB24(1-146), truncated XB24 containing&lt;br /&gt;
amino acids 1–146; XB24(146-198), truncated XB24 containing amino acids&lt;br /&gt;
146–198 including the ATPase motif. Blue, positive interaction. Expression&lt;br /&gt;
proteins were detected using antibodies as indicated in Western blotting. (B)&lt;br /&gt;
Detection of XA21 and XB24 in immunoprecipitates of ProA-XA21 from rice&lt;br /&gt;
tissues using the Peroxidase Anti-Peroxidase (PAP) probe and anti-XB24,&lt;br /&gt;
respectively. *, Cleaved form of ProA-XA21 (23, 24). (C) Analysis of XB24&lt;br /&gt;
protein levels in plants before and after PXO99 inoculation using anti-XB24 in&lt;br /&gt;
Western blot analysis. A duplicate protein gel was stained with Coomassie&lt;br /&gt;
brilliant blue (CBB) as loading control. (D) Dissociation of XB24 from XA21 in&lt;br /&gt;
response to PXO99 inoculation. Detection of ProA-XA21 and XB24 in the&lt;br /&gt;
immunoprecipitates of ProA-XA21 from rice leaf tissues not treated or treated&lt;br /&gt;
(1 or 2 days) with Xoo strains as indicated. IP, immunoprecipitate.]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 2B.png|frame|Figure 2.An ATPase activity is associated with XB24 and effects XA21 auto-&lt;br /&gt;
phosphorylation. (A) ATPase activity assay on purified Ntap-XB24 and Ntap-&lt;br /&gt;
XB24S154Aprotein from transgenic plants. The same amount of proteins was&lt;br /&gt;
used. (Left) Representative autoradiogram. (Right) Quantitative results of&lt;br /&gt;
three independent experiments. ATP hydrolysis was quantified based on&lt;br /&gt;
radioactivity of the reaction product Pi. Error bars indicate SDs. (B) Effects of&lt;br /&gt;
XB24 on XA21 autophosphorylation. In vitro autophosphorylation assays&lt;br /&gt;
were performed on GST-XA21K668 and GST-XA21K668K736E, respectively, in&lt;br /&gt;
the presence of the purified His-XB24 protein. (C) Effects of XB24 ATPase on&lt;br /&gt;
XA21 autophosphorylation. An in vitro autophosphorylation assay was&lt;br /&gt;
performed on GST-XA21K668 in the presence of the same amount of rice-&lt;br /&gt;
expressed Ntap-XB24 or Ntap-XB24S154A. (Upper) Representative auto-&lt;br /&gt;
radiogram. (Lower) Quantitative results (mean + SD) from three independ-&lt;br /&gt;
ent experiments. CK, control provided using autophosphorylation assay on&lt;br /&gt;
GST-XA21K668 in the absence of XB24. The autophosphorylation level from&lt;br /&gt;
CK was arbitrarily set as “1.”|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 3.png|frame|Figure 3.Effects of reduced expression of Xb24 on Xa21-mediated resistance.&lt;br /&gt;
(A) Quantitative lesion length measurements of rice leaves at 14 days after&lt;br /&gt;
PXO99 inoculation. The means ± SD of each sample was calculated from 24&lt;br /&gt;
infected leaves of 8 plants. (B) Bacterial growth curves after PXO99 inoculation. Error bars indicate SDs.|right]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 4.png|frame|Figure 4.Effects of overexpression of Xb24 on Xa21-mediated resistance. (A)&lt;br /&gt;
Photograph of rice leaves 14 days after inoculation with PXO99 (Top). The&lt;br /&gt;
disease lesions are indicated from the top of the leaf cuts to the arrows. The&lt;br /&gt;
XB24 protein was detected by anti-XB24 (Middle). A duplicate protein gel&lt;br /&gt;
was stained with CBB as control (Bottom). (B) Quantitative lesion length&lt;br /&gt;
measurements of rice leaves at 14 days after Xoo inoculation. The average of&lt;br /&gt;
each sample was calculated from 40 infected leaves of 10 plants. (C) Growth&lt;br /&gt;
curves of Xoo postinoculation. Error bars in B and C indicate SDs.|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF5.jpg|frame|Fig. 5. Requirement of XB24 ATPase activity for regulation of XA21-mediated&lt;br /&gt;
immunity. (A) Lesion lengths were measured for Xa21, Kitaake, Xa21/Xb24ox, and&lt;br /&gt;
Xa21/Xb24S154Aox at 14 days after PXO99 inoculation. The mean and SD of each&lt;br /&gt;
sample were determined using 32 infected leaves from 8 plants. (B) Bacterial&lt;br /&gt;
growth curve analysis after PXO99 inoculation. Error bars indicate SDs.|right]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF6.jpg|frame|Fig. 6. Effects of excess XB24 on XA21 protein stability. (A) Protein immunodetection&lt;br /&gt;
after SDS/PAGE separation. Protein samples were prepared&lt;br /&gt;
from ProA-Xa21 transgenic rice plants overexpressing Ntap-Xb24 (labeled&lt;br /&gt;
Xa21/Ntap-Xb24) or Ntap (labeled Xa21/Ntap) before or after inoculation (1&lt;br /&gt;
day) with PXO99 or PXO99ΔRaxST (lacking Ax21 activity). Protein accumulation&lt;br /&gt;
detected by the PAP probe is shown in (Top) (for ProA-XA21) and&lt;br /&gt;
(Middle) (for Ntap-XB24 or Ntap), respectively. (Bottom) CBB-stained gel as a&lt;br /&gt;
loading control. (B) Quantification of XA21 protein levels. The average and&lt;br /&gt;
SD are calculated from three biological replicate experiments of (A).|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF7.jpg|frame|Fig. 7. A model for XB24-mediated regulation of XA21 function. Before&lt;br /&gt;
Ax21 recognition (left), XB24 physically associates with XA21 and uses ATP to&lt;br /&gt;
promote phosphorylation of certain Ser/Thr sites on XA21, keeping the XA21&lt;br /&gt;
protein in an inactive state. Upon recognition of Ax21 (center), Xb24 dissociates&lt;br /&gt;
from Xa21 leading to activation of the XA21 kinase, resulting in&lt;br /&gt;
resistance. Once the signal has been relayed, XA21 binds the XB15 phosphatase&lt;br /&gt;
(right), which attenuates the immune response, likely by dephosphorylation&lt;br /&gt;
of amino acids required for XA21 function.|right]]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*The XB24 cDNAis expressed from a unique rice gene, Os01g56470, and encodes a 198-aa protein. The predicted secondarystructure has no significant motifs except for a C-terminal ATP synthase α-and β-subunits signature (ATPase) motif with the sequence PSINERESSS.Although 38 human proteins, 43 Arabidopsis proteins, and 67 additional rice proteins are annotated to contain a conserved ATPase motif, none share similarity beyond the ATPase motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases.The only conserved structure in XB24 is the region composed of 10 amino acids PSINERES154SS that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}-S).&lt;br /&gt;
&lt;br /&gt;
*Silencing of Xb24 Enhances Xa21-Mediated Resistance. &lt;br /&gt;
&lt;br /&gt;
*overexpression of XB24 Compromises XA21-Mediated Resistance.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
XB24 ATPase enzyme activity is required for XB24 function. XA21 is degraded in the presence of the pathogen-associated molecular pattern Ax21 when XB24 is overexpressed. These results demonstrate a function for this large class of broadly conserved ATPases in PRR-mediated immunity.XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice lines silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice lines overexpressing XB24 are compromised for immunity.&lt;br /&gt;
&lt;br /&gt;
== Other associations with XA21 ==&lt;br /&gt;
&lt;br /&gt;
The association between XB24 and XA21 is compromised upon inoculation of the Xanthomonas oryzae pv. oryzae (Xoo) strain PXO99, which secretes the Ax21 PAMP &amp;lt;ref name=&amp;quot;ref7&amp;quot;/&amp;gt;. XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice plants silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice plants overexpressing XB24 are compromised for immunity. XA21 is degraded in the presence of Ax21 when XB24 is overexpressed. These findings reveal that XB24 negatively regulates XA21 PRR function.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Physically Associates with XA21 in Vivo.''' The author isolated XB24 as an XA21 interacting protein through yeast two-hybrid screening. The XB24 cDNAis expressed froma unique rice gene,Os01g56470, and encodes a 198-aa protein. The predicted secondary structure has no significant motifs except for a C-terminal ATP synthase α- and β-subunits signature (ATPase) motif with the sequence PSINERESSS. Although 38 human proteins, 43 Arabidopsis proteins, and 67 additional rice proteins are annotated to contain a conserved ATPase motif, none share similarity beyond the ATPase motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases. To confirm the specificity of the XB24-XA21interaction, they performed yeast two-hybrid analysis and foundthatXB24 associates with XA21K668 (containing the entire juxtamembrane and the kinase domains of XA21) but not with XA21K668K736E , a catalytically inactive mutant of XA21K668 (Fig. 1A Left). These results indicate that the association between XB24 and XA21 requires XA21 kinase activity. The ATPase motif of XB24 is not required for the XB24-XA21 interaction in yeast because XB24(1-146), lacking the ATPase motif, retains the ability to interact with XA21, whereas XB24(146-198), containing the ATPase motif, is incapable of interacting with XA21 '''(Fig. 1A Right)'''.To determine whether XB24 physically associates with XA21 in vivo, we created transgenic plants that express a protein A domaintagged XA21 (ProA-XA21) under control of the native Xa21 promoter in the rice cultivar Kitaake. They established a homozygous line, A114, with a single transgene insertion and demonstrated that it confers full resistance to Xoo strain PXO99. A complex associated with ProA-XA21 was immunoprecipitated from total extracts from A114 leaves. Ntap (N-terminal tandem affinity purification, which contains the same protein A domain) transgenic plants, under control of the maizeUbi-1 promoter, were used as the control. The immunoprecipitateswere separated on anSDS/PAGEgel and analyzed by Western blotting using the PAP antibody to probe ProA-XA21 and Ntap, and anti-XB24 antibody for XB24, separately. The PAP probe detected full-length ProA-XA21 and a cleaved XA21 product (marked by an asterisk in Fig. 1B) in the ProA-XA21 immunoprecipitate.Aclear band of endogenousXB24 was detected from the immunoprecipitate of ProA-XA21 but not from the precipitates of Ntap '''(Fig. 1B)'''.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Dissociates from XA21 in Response to PXO99 Inoculation.'''To determine whether XB24 is degraded in response to Xoo strain PXO99  inoculation, they performed a Western blot analysis to detect the XB24 protein before and after inoculation. They found that a similar amount of XB24 protein was detected in Xa21 and Kitaake plants before inoculation and 1 day or 2 days after inoculation. This result shows that XB24 is not degraded in response to Ax21. They next investigated whether Ax21 recognition affects the interaction of XA21 and XB24. We performed coimmunoprecipitation experiments withPAP(targeting ProA-XA21)using rice leaf tissues fromtheXa21line inoculated with Xoo strain PXO99 or Xoo strain PXO99ΔraxST, which lacks Ax21 activity due to a knockout of the raxST gene. They then carried out immunoblotting to detect XB24. A similar coimmunoprecipitation was performed using Kitaake rice leaves as a control. As shown in '''Fig. 1D''', they observed a sharp decrease in the amount of XB24 associated with ProA-XA21 post-PXO99 inoculation, whereas, no decrease in the amount of XB24 associated with ProA-XA21 was observed after PXO99ΔraxST inoculation. These results clearly indicate that the physical interaction between XB24 and XA21 disassociates specifically in response to Xoo strains expressing Ax21 activity.&lt;br /&gt;
&lt;br /&gt;
'''ATPase Activity Is Essential for XB24-Mediated Regulation of XA21 Function.''' The author tested whether XB24 ATPase activity was required for XB24 to regulate XA21 function. They developed Xa21/Xb24ox and Xa21/Xb24S154Aox plants using NtapXb24ox and NtapXb24S154Aox plants, respectively, to cross with ProAXa21 plants, and inoculated these plantswith PXO99.As shown in Fig. 5A, all Xa21/Xb24ox plants display compromised resistance, whereas Xa21/Xb24S154Aox plants show similar disease lesion lengths compared to Xa21 plants. The lesion length difference between Xa21 and Xa21/Xb24ox is highly significant (P = 1.40 × 10−10),whereas the difference between Xa21 and Xa21/Xb24S154Aox is not (P = 0.12). Bacterial growth curve analysis revealed that the amount of Xoo bacteria accumulation in Xa21/Xb24ox plants(2.65 × 108 ± 5.74 × 107) is higher (∼2.45-fold) than that of Xa21 plants (1.08 × 108 ± 6.55 × 106) at 12 days postinoculation'''(Fig. 5B)'''. The amount of Xoo bacterial accumulation in Xa21/Xb24S154Aox plants (0.91 × 108 ± 1.65 × 107) is similar to that measured in Xa21 plants '''(Fig. 5B)'''. The low P values of bacteria accumulation at 12 days postinoculation in Xb24ox plants (0.033against Xa21 and 0.028 against Xa21/Xb24S154Aox, respectively)indicate that these differences are statistically significant. This experiment was repeated two times and similar results were obtained each time. Because ProA-XA21 was expressed to similar levels in Xa21/Xb24ox, Xa21/Xb24S154Aox, and Xa21 plants, these results demonstrate that XB24 requires S154 to repress XA21 function. Thus, we conclude that the ATPase activity of XB24 is essential for XB24 to regulate XA21-mediated defense response.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Represents a Previously Undescribed Class of ATPases'''. ATPases are abundant in most species. ATPases have been classified into four superfamilies, F-, V-, A-, and P-ATPases, based on their structures (33–36). There are some other proteins that cannot be classified into these subfamilies but have ATPase activity, such as heat shock proteins(HSPs), includingHSP60 (33),HSP70 (34), and HSP72 (35). XB24 does not belong to any of these previously&lt;br /&gt;
described superfamilies of ATPases or HSPs. The only conserved structure in XB24 is the region composed of 10 amino acids PSINERES154SS&lt;br /&gt;
that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}-S).The ATPasemotif in the F1,V1, and A1complexes of F-, V-, and AATPases is also essential for ATPase activities, whereas the PATPases and theHSPs do not contain thismotif.However,whether this motif is enough for the ATPase activity of proteins is unclear. Here, They show that XB24, a protein with an ATPase motif but no other motifs or domains, functions as anATPase. Proteins with this conserved motif that cannot be classified into the previously identified ATPases exist in many species, including bacteria, fungi,human, Arabidopsis, and rice. However, none of these have previously been functionally characterized. Thus, our results demonstrating that XB24 is an ATPase with an important function in XA21-mediated immunity will facilitate functional studies of XB24-type ATPases in other species.&lt;br /&gt;
&lt;br /&gt;
'''A Model for XB24-Mediated Regulation of XA21.''' Here, they show that XA21 function is enhanced when XB24 expression is reduced and that XA21 function is compromised when XB24 is overexpressed.XB24 regulation on XA21 is tightly associated with its ATPase activity. Thus, they conclude that XB24 regulates XA21&lt;br /&gt;
function via its ATPase activity.In '''Fig. 7''', they present a model to summarize these results. They hypothesize that the XA21 protein is present on the plasma membrane [after transit from theER(30)], where it recognizes the Ax21PAMP. XB24 physically associates with XA21 and uses ATP to promote phosphorylation of certain Ser/Thr sites onXA21, keeping theXA21 protein in an inactive state.Upon recognition ofAx21, the XA21 kinase becomes activated, triggering downstream defense responses. The mechanism(s) for XA21 activation following perception of Ax21 likely requires dissociation of XA21 from XB24 and/or removal of theXB24-promoted autophosphorylation. In this model, XA21 autophosphorylation occurs on multiple residues,some of which stimulate XA21 function and others of which inhibit XA21 function. For example, autophosphorylation of the JM residues,Ser-686, Thr-688, and Ser-689, is required forXA21-mediated resistance. Autophosphorylation of Thr-705 is also needed for XA21 function. Multisite phosphorylation has been previously demonstrated for the function of insulin receptor substrate 1 (IRS1) in human. In this case, the activation of protein kinase B in response to insulin propagates insulin signaling and promotes the phosphorylation of IRS1 on serine residues, generating a positivefeedback loop for insulin action. Insulin also activates other kinases that induce the phosphorylation of IRS1 on specific sites and inhibit its functions. There is thus a delicate balance existing between positive IRS1 tyrosine/serine phosphorylation and negative IRS1 serine phosphorylation, which can regulate the IRS1.When XB24 is overexpressed (a nonphysiological state), the XA21 protein may not dissociate from XB24 readily or the XB24-promoted phosphorylation may not be easily removed. In this case,binding of Ax21 to XA21 may lead to a conformational change in XA21, exposing the XA21 protein to degradation by endogenous proteases. Alternatively, a protease activity could be induced by Ax21/XA21 binding. In either case, overexpressed XB24 would result in degradation of XA21 when challenged by Ax21. They have previously reported that XB15, a PP2C phosphatase,dephosphorylates autophosphorylated XA21 and negatively regulates the XA21-mediated innate immune responses. Our findings that XB24 promotes XA21 autophosphorylation and inhibits XA21-mediated immune response to the Ax21 PAMP further demonstrate that the phosphorylation state of XA21 is critical for XA21-mediated signaling. Phosphorylation of certain residues on XA21 negatively regulates XA21 function, whereas phosphorylation on other residues may be required for activation of XA21 function. These latter residues are likely dephosphorylated by XB15 to down-regulate XA21 activity. Together with our results that the association between XB24 and XA21 is compromised but the association between XB15 and XA21 is enhanced upon PXO99 inoculation, our model suggests that the regulation by XB24 occurs before Ax21 recognition but that regulation by XB15 occurs after Ax21 recognition.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*College of Life Science, Zhejiang Sci-Tech University, Hangzhou 310018, China. &lt;br /&gt;
&lt;br /&gt;
*Department of Plant Pathology, University of California, Davis, CA 95616,USA.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Xuewei Chen, Mawsheng Chern, Patrick E. Canlas, Deling Ruan, Caiying Jiang, and Pamela C. Ronald(2010) An ATPase promotes autophosphorylation of the pattern recognition receptor XA21 and inhibits XA21-mediated immunity. Proc Natl Acad Sci USA 107: 8029–8034.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Liu GZ, Pi LY, Walker JC, Ronald PC, Song WY (2002) Biochemical characterization of the kinase domain of the rice disease resistance receptor-like kinase XA21. J Biol Chem 277:20264–20269.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Fire A, et al. (1998) Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans. Nature 391:806–811.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Mourrain P, et al. (2000) Arabidopsis SGS2 and SGS3 genes are required for posttranscriptional gene silencing and natural virus resistance. Cell 101:533–542.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Century KS, et al. (1999) Developmental control of Xa21-mediated disease resistance in rice. Plant J 20:231–236.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Lucca P, Ye X, Potrykus I (2001) Effective selection and regeneration of transgenic rice plants with mannose as selective agent. Mol Breed 7:43–49.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Lee SW, Han SW, Bartley LE, Ronald PC (2006) Unique characteristics of Xanthomonas oryzae pv. oryzae AvrXa21 and implications for plant innate immunity. Proc Natl Acad Sci USA 103:18395–18400.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 1]]&lt;br /&gt;
[[Category:Chromosome 1]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0771200&amp;diff=270797</id>
		<title>Os01g0771200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0771200&amp;diff=270797"/>
				<updated>2016-06-23T13:59:35Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os01g0771200''''' was  first identified as '''''OsXB24''''' in 2010 by the researchers from University of Cambridge&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Bcakground===&lt;br /&gt;
&lt;br /&gt;
*Cell-surface pattern recognition receptors (PRRs) are key components of the innate immune response in animals and plants. These receptors typically carry or associate with non-RD kinases to control early events of innate immunity signaling. Despite their importance, the mode of regulation of PRRs is largely unknown. Here we show that the rice PRR, XA21(Activator of XA21-mediated immunity), interacts with XA21 binding protein 24 (XB24), a previously undescribed ATPase. To date, three XA21 binding (XB) proteins—XB3 (an E3 ubiquitinligase), XB10 (OsWRKY62), and XB15 (a PP2C phosphatase)—have been shown to regulate XA21-mediated immunity. XB24 associates with XA21 in vivo and modulates XA21 function. XB24 belongs to a large class of broadly conserved ATPases of unknown function. The association between XB24 and XA21 is compromised upon inoculation of the Xanthomonas oryzae pv.&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
*'''XB24 ATPase Enhances Autophosphorylation of XA21K668.''' The author tested whether XB24 is a substrate of XA21 or affects XA21 kinase autophosphorylation. Purified His-XB24 and GST-XA21K668 were co-incubated in the presence of [32P]ATP for kinase analysis. For a control, the purified His-XB24 was co-incubated with GST-XA21K668K736E, a catalytically inactive mutant&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. As ( '''Fig. 2B''' ) shows, the GST-XA21K668 autophosphorylates as expected, whereas His-XB24 does not autophosphorylate or become transphosphorylated by GST-XA21K668. The phosphorylation of GSTXA21K668 is highly enhanced in the presence ofHis-XB24 protein.No phosphorylation of GST-XA21K668K736E can be detected in reactions carried out in the presence of absence of His-XB24. These results demonstrate that XB24 promotes XA21K668 autophosphorylation.To test whether XB24 promotes autophosphorylation of intact, native XA21 protein, the immunoprecipitated ProAXA21 protein from rice tissue described above (0, 1, or 2 days post-PXO99 inoculation) was co-incubated with the purified His-XB24 for kinase autophosphorylation analyses.These results demonstrate that XB24 promotes autophosphorylation of the native XA21 protein. Furthermore, XB24 is not transphosphorylated by the XA21 protein with or without PXO99 inoculation. To test whether the ATPase activity of XB24 is required for promoting XA21K668 autophosphorylation, the purified Ntap-XB24 and NtapXB24S154A were incubated with GST-taggedXA21K668 in the presence of [32P]ATP for kinase analyses. Autophosphorylation of GST-XA21K668 is enhanced in the presence of rice-expressed Ntap-XB24 but not Ntap-XB24S154A ('''Fig. 2C'''). Autophosphorylation of the GST-XA21K668 fusion protein is also enhanced in the presence of the His-XB24 protein but not His-XB24S154A. These results demonstrate that XB24 enhances XA21 autophosphorylation and that itsATPase activity is required for this function&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Silencing of Xb24 Enhances Xa21-Mediated Resistance.''' To investigate the biological function of XB24, they used the RNA interference(RNAi) approach&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot;/&amp;gt; to silence the Xb24 gene and monitored its effects on disease resistance. They developed two independent lines, Xb24RNAi-3 and Xb24RNAi-9, each containing a single-locus insertion, using the rice cultivar Kitaake as the transgene recipient.RT-PCR analysis revealed that Xb24 transcript levels were significantly reduced in these two lines. Both lines show similar disease lesion lengths compared to the control line Kitaake after challenge with PXO99, indicating that silencing of Xb24 does not affect the susceptibility of Kitaake to Xoo. To explore the role of XB24 in XA21-mediated signaling, they crossed Xb24RNAi-3 and Xb24RNAi-9 with Xa21 lines and obtained one progeny form the Xa21/Xb24RNAi-3 cross and three from the Xa21/Xb24RNAi-9 cross. Our initial results indicated that silencing of Xb24 enhanced resistance. To confirm these results, they developed an F4 line (A176) from one of the F1 plants.TheA176 line carries homozygous Xa21 and homozygous Xb24RNAi-9. They then inoculated 3-week-old A176 plants.As shown in （'''Fig. 3A'''）, these plants developed much shorter lesion lengths (3 ± 0.9 cm) than the wildtype Xa21 plants (6.8±1.2 cm), which show only partial resistance at the 3-weeks-old (tilling) stage&amp;lt;ref name=&amp;quot;ref5&amp;quot;/&amp;gt;. At test gave a P value of 8.62 ×10−13, showing a highly significant difference. Rice line Xb24RNAi-9 showed similar disease lesion lengths (16 ± 2.5 cm) as Kitaake (P =0.56). Bacterial growth curve analysis revealed that Xa21/Xb24RNAi-9 lines harbor 3.2-fold less Xoo bacteria (1.48 × 107 ±1.2 × 106) in their leaves than the Xa21 lines (4.8 × 107±4.4 × 106) at 12 days postinoculation ('''Fig. 3B'''), consistent with the leaf lesion length measurements described above. This experiment was repeated three times, and similar results were obtained each time. These results demonstrate that silencing of Xb24 expression enhances XA21-mediated disease resistance&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Overexpression of XB24 Compromises XA21-Mediated Resistance.''' To investigate the involvement of XB24 in the XA21-mediated signaling, the author created construct Ubi-Xb24 to overexpress XB24 using the maize Ubi-1 promoter. They introduced the Ubi-Xb24 construct directly into an Xa21 (in the TP309 genetic background)line by Agrobacterium-mediated transformation using mannose selection&amp;lt;ref name=&amp;quot;ref6&amp;quot;/&amp;gt; and generated five independent T0 plants. After PCR-based genotyping and RT-PCR-based transcripts expression analyses to confirm that Xb24 is overexpressed, they challenged 6-week-old Xa21 lines with PXO99.They found that all of the five lines have longer disease lesion lengths compared with the wild-type Xa21 plants. Two homozygous lines (Xa21/Xb24ox-1 and -2) fromtwo of these five independent lines were then developed. Overexpression of XB24 (XB24ox) in the progeny from these homozygous lines was confirmed by protein gel blotting analysis('''Fig. 4A'''). Six-week-old plants were challenged with PXO99. Disease lesion lengths on both the Xa21/Xb24ox-1 and -2 lines (7.3 ± 0.5 cmfor line 1 and 6.0 ± 0.5 cmfor line 2) were longer than those observed on Xa21 lines (1.3 ±0.4 cm) ('''Fig. 4 A and B'''). The low P values (5.02 × 10−21 for Xa21/Xb24ox-1 and 2.06 × 10−23 for Xa21/Xb24ox-2) indicate that these differences are statistically significant. At 12 days postinoculation,the accumulation of bacterial populations, as measured by bacterial growth curve analysis, in the two Xa21/Xb24ox lines (1.23 × 108 ±1.88 × 107 for Xa21/Xb24ox-1 and 1.08 × 108 ± 1.97 × 107 for Xa21/Xb24ox-2)was clearly higher (&amp;gt;2-fold) than in theXa21 lines (5.20×107 ± 8.9 × 105) ('''Fig. 4C'''). Again, the low P values (8.27 × 10−4 forXa21/Xb24ox-1 and 2.72 × 10−3 for Xa21/Xb24ox-2) of bacterial accumulation at 12 days postinoculation indicate that these differences are statistically significant. Rice lines overexpressing Xb24 display similar levels of susceptibility as control lines lacking overexpressed Xb24 in three independent biological replicates.These results demonstrate that overexpression of XB24 compromises XA21-mediated resistance&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Overexpression of Xb24 Causes XA21 Instability Following Ax21 Recognition.''' To gain insight into the mechanism of XB24-mediated regulation of XA21 function, they tested whether XB24 affects the amount of the XA21 protein after Xoo inoculation. As shown in '''Fig. 6 A and B''', without Xoo inoculation (Mock treatment).   Overexpression of XB24(Xa21/Ntap-Xb24) caused no significant decrease in the ProA-XA21 protein level compared to overexpression of Ntap (Xa21/Ntap) alone. In contrast, after inoculation with PXO99, the Xa21/Xb24ox line showed a sharp decrease in the ProA-XA21 protein level. The Xa21/Ntap control line showed amarked increase. When inoculated with the Xoo strain PXO99ΔraxST, the Xa21/Xb24ox sample showed an increase in the ProA-XA21 level similar to that of the Xa21/Ntap control. Similar results were obtained from three biological repeats of this experiment.These results indicate that the sharp decrease in the XA21 protein level is Ax21-specific&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
[[File:1HF1.jpg|frame|Fig. 1. Association of XB24 with XA21 in yeast and in rice plants. (A) Interaction&lt;br /&gt;
of XB24 with XA21K668 in yeast. K668, truncated XA21 (XA21K668)&lt;br /&gt;
containing the entire JM and kinase domains (23); K668K736E, kinase catalytically&lt;br /&gt;
inactive mutant XA21K668K736E; XB24(1-146), truncated XB24 containing&lt;br /&gt;
amino acids 1–146; XB24(146-198), truncated XB24 containing amino acids&lt;br /&gt;
146–198 including the ATPase motif. Blue, positive interaction. Expression&lt;br /&gt;
proteins were detected using antibodies as indicated in Western blotting. (B)&lt;br /&gt;
Detection of XA21 and XB24 in immunoprecipitates of ProA-XA21 from rice&lt;br /&gt;
tissues using the Peroxidase Anti-Peroxidase (PAP) probe and anti-XB24,&lt;br /&gt;
respectively. *, Cleaved form of ProA-XA21 (23, 24). (C) Analysis of XB24&lt;br /&gt;
protein levels in plants before and after PXO99 inoculation using anti-XB24 in&lt;br /&gt;
Western blot analysis. A duplicate protein gel was stained with Coomassie&lt;br /&gt;
brilliant blue (CBB) as loading control. (D) Dissociation of XB24 from XA21 in&lt;br /&gt;
response to PXO99 inoculation. Detection of ProA-XA21 and XB24 in the&lt;br /&gt;
immunoprecipitates of ProA-XA21 from rice leaf tissues not treated or treated&lt;br /&gt;
(1 or 2 days) with Xoo strains as indicated. IP, immunoprecipitate.]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 2B.png|frame|Figure 2.An ATPase activity is associated with XB24 and effects XA21 auto-&lt;br /&gt;
phosphorylation. (A) ATPase activity assay on purified Ntap-XB24 and Ntap-&lt;br /&gt;
XB24S154Aprotein from transgenic plants. The same amount of proteins was&lt;br /&gt;
used. (Left) Representative autoradiogram. (Right) Quantitative results of&lt;br /&gt;
three independent experiments. ATP hydrolysis was quantified based on&lt;br /&gt;
radioactivity of the reaction product Pi. Error bars indicate SDs. (B) Effects of&lt;br /&gt;
XB24 on XA21 autophosphorylation. In vitro autophosphorylation assays&lt;br /&gt;
were performed on GST-XA21K668 and GST-XA21K668K736E, respectively, in&lt;br /&gt;
the presence of the purified His-XB24 protein. (C) Effects of XB24 ATPase on&lt;br /&gt;
XA21 autophosphorylation. An in vitro autophosphorylation assay was&lt;br /&gt;
performed on GST-XA21K668 in the presence of the same amount of rice-&lt;br /&gt;
expressed Ntap-XB24 or Ntap-XB24S154A. (Upper) Representative auto-&lt;br /&gt;
radiogram. (Lower) Quantitative results (mean + SD) from three independ-&lt;br /&gt;
ent experiments. CK, control provided using autophosphorylation assay on&lt;br /&gt;
GST-XA21K668 in the absence of XB24. The autophosphorylation level from&lt;br /&gt;
CK was arbitrarily set as “1.”|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 3.png|frame|Figure 3.Effects of reduced expression of Xb24 on Xa21-mediated resistance.&lt;br /&gt;
(A) Quantitative lesion length measurements of rice leaves at 14 days after&lt;br /&gt;
PXO99 inoculation. The means ± SD of each sample was calculated from 24&lt;br /&gt;
infected leaves of 8 plants. (B) Bacterial growth curves after PXO99 inoculation. Error bars indicate SDs.|right]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 4.png|frame|Figure 4.Effects of overexpression of Xb24 on Xa21-mediated resistance. (A)&lt;br /&gt;
Photograph of rice leaves 14 days after inoculation with PXO99 (Top). The&lt;br /&gt;
disease lesions are indicated from the top of the leaf cuts to the arrows. The&lt;br /&gt;
XB24 protein was detected by anti-XB24 (Middle). A duplicate protein gel&lt;br /&gt;
was stained with CBB as control (Bottom). (B) Quantitative lesion length&lt;br /&gt;
measurements of rice leaves at 14 days after Xoo inoculation. The average of&lt;br /&gt;
each sample was calculated from 40 infected leaves of 10 plants. (C) Growth&lt;br /&gt;
curves of Xoo postinoculation. Error bars in B and C indicate SDs.|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF5.jpg|frame|Fig. 5. Requirement of XB24 ATPase activity for regulation of XA21-mediated&lt;br /&gt;
immunity. (A) Lesion lengths were measured for Xa21, Kitaake, Xa21/Xb24ox, and&lt;br /&gt;
Xa21/Xb24S154Aox at 14 days after PXO99 inoculation. The mean and SD of each&lt;br /&gt;
sample were determined using 32 infected leaves from 8 plants. (B) Bacterial&lt;br /&gt;
growth curve analysis after PXO99 inoculation. Error bars indicate SDs.|right]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF6.jpg|frame|Fig. 6. Effects of excess XB24 on XA21 protein stability. (A) Protein immunodetection&lt;br /&gt;
after SDS/PAGE separation. Protein samples were prepared&lt;br /&gt;
from ProA-Xa21 transgenic rice plants overexpressing Ntap-Xb24 (labeled&lt;br /&gt;
Xa21/Ntap-Xb24) or Ntap (labeled Xa21/Ntap) before or after inoculation (1&lt;br /&gt;
day) with PXO99 or PXO99ΔRaxST (lacking Ax21 activity). Protein accumulation&lt;br /&gt;
detected by the PAP probe is shown in (Top) (for ProA-XA21) and&lt;br /&gt;
(Middle) (for Ntap-XB24 or Ntap), respectively. (Bottom) CBB-stained gel as a&lt;br /&gt;
loading control. (B) Quantification of XA21 protein levels. The average and&lt;br /&gt;
SD are calculated from three biological replicate experiments of (A).|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF7.jpg|frame|Fig. 7. A model for XB24-mediated regulation of XA21 function. Before&lt;br /&gt;
Ax21 recognition (left), XB24 physically associates with XA21 and uses ATP to&lt;br /&gt;
promote phosphorylation of certain Ser/Thr sites on XA21, keeping the XA21&lt;br /&gt;
protein in an inactive state. Upon recognition of Ax21 (center), Xb24 dissociates&lt;br /&gt;
from Xa21 leading to activation of the XA21 kinase, resulting in&lt;br /&gt;
resistance. Once the signal has been relayed, XA21 binds the XB15 phosphatase&lt;br /&gt;
(right), which attenuates the immune response, likely by dephosphorylation&lt;br /&gt;
of amino acids required for XA21 function.|right]]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*The XB24 cDNAis expressed from a unique rice gene, Os01g56470, and encodes a 198-aa protein. The predicted secondarystructure has no significant motifs except for a C-terminal ATP synthase α-and β-subunits signature (ATPase) motif with the sequence PSINERESSS.Although 38 human proteins, 43 Arabidopsis proteins, and 67 additional rice proteins are annotated to contain a conserved ATPase motif, none share similarity beyond the ATPase motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases.The only conserved structure in XB24 is the region composed of 10 amino acids PSINERES154SS that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}-S).&lt;br /&gt;
&lt;br /&gt;
*Silencing of Xb24 Enhances Xa21-Mediated Resistance. &lt;br /&gt;
&lt;br /&gt;
*overexpression of XB24 Compromises XA21-Mediated Resistance.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
XB24 ATPase enzyme activity is required for XB24 function. XA21 is degraded in the presence of the pathogen-associated molecular pattern Ax21 when XB24 is overexpressed. These results demonstrate a function for this large class of broadly conserved ATPases in PRR-mediated immunity.XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice lines silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice lines overexpressing XB24 are compromised for immunity.&lt;br /&gt;
&lt;br /&gt;
== Other associations with XA21 ==&lt;br /&gt;
&lt;br /&gt;
The association between XB24 and XA21 is compromised upon inoculation of the Xanthomonas oryzae pv. oryzae (Xoo) strain PXO99, which secretes the Ax21 PAMP &amp;lt;ref name=&amp;quot;ref7&amp;quot;/&amp;gt;. XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice plants silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice plants overexpressing XB24 are compromised for immunity. XA21 is degraded in the presence of Ax21 when XB24 is overexpressed. These findings reveal that XB24 negatively regulates XA21 PRR function.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Physically Associates with XA21 in Vivo.''' The author isolated XB24 as an XA21 interacting protein through yeast two-hybrid screening. The XB24 cDNAis expressed froma unique rice gene,Os01g56470, and encodes a 198-aa protein. The predicted secondary structure has no significant motifs except for a C-terminal ATP synthase α- and β-subunits signature (ATPase) motif with the sequence PSINERESSS. Although 38 human proteins, 43 Arabidopsis proteins, and 67 additional rice proteins are annotated to contain a conserved ATPase motif, none share similarity beyond the ATPase motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases. To confirm the specificity of the XB24-XA21interaction, they performed yeast two-hybrid analysis and foundthatXB24 associates with XA21K668 (containing the entire juxtamembrane and the kinase domains of XA21) but not with XA21K668K736E , a catalytically inactive mutant of XA21K668 (Fig. 1A Left). These results indicate that the association between XB24 and XA21 requires XA21 kinase activity. The ATPase motif of XB24 is not required for the XB24-XA21 interaction in yeast because XB24(1-146), lacking the ATPase motif, retains the ability to interact with XA21, whereas XB24(146-198), containing the ATPase motif, is incapable of interacting with XA21 '''(Fig. 1A Right)'''.To determine whether XB24 physically associates with XA21 in vivo, we created transgenic plants that express a protein A domaintagged XA21 (ProA-XA21) under control of the native Xa21 promoter in the rice cultivar Kitaake. They established a homozygous line, A114, with a single transgene insertion and demonstrated that it confers full resistance to Xoo strain PXO99. A complex associated with ProA-XA21 was immunoprecipitated from total extracts from A114 leaves. Ntap (N-terminal tandem affinity purification, which contains the same protein A domain) transgenic plants, under control of the maizeUbi-1 promoter, were used as the control. The immunoprecipitateswere separated on anSDS/PAGEgel and analyzed by Western blotting using the PAP antibody to probe ProA-XA21 and Ntap, and anti-XB24 antibody for XB24, separately. The PAP probe detected full-length ProA-XA21 and a cleaved XA21 product (marked by an asterisk in Fig. 1B) in the ProA-XA21 immunoprecipitate.Aclear band of endogenousXB24 was detected from the immunoprecipitate of ProA-XA21 but not from the precipitates of Ntap '''(Fig. 1B)'''.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Dissociates from XA21 in Response to PXO99 Inoculation.'''To determine whether XB24 is degraded in response to Xoo strain PXO99  inoculation, they performed a Western blot analysis to detect the XB24 protein before and after inoculation. They found that a similar amount of XB24 protein was detected in Xa21 and Kitaake plants before inoculation and 1 day or 2 days after inoculation. This result shows that XB24 is not degraded in response to Ax21. They next investigated whether Ax21 recognition affects the interaction of XA21 and XB24. We performed coimmunoprecipitation experiments withPAP(targeting ProA-XA21)using rice leaf tissues fromtheXa21line inoculated with Xoo strain PXO99 or Xoo strain PXO99ΔraxST, which lacks Ax21 activity due to a knockout of the raxST gene. They then carried out immunoblotting to detect XB24. A similar coimmunoprecipitation was performed using Kitaake rice leaves as a control. As shown in '''Fig. 1D''', they observed a sharp decrease in the amount of XB24 associated with ProA-XA21 post-PXO99 inoculation, whereas, no decrease in the amount of XB24 associated with ProA-XA21 was observed after PXO99ΔraxST inoculation. These results clearly indicate that the physical interaction between XB24 and XA21 disassociates specifically in response to Xoo strains expressing Ax21 activity.&lt;br /&gt;
&lt;br /&gt;
'''ATPase Activity Is Essential for XB24-Mediated Regulation of XA21 Function.''' The author tested whether XB24 ATPase activity was required for XB24 to regulate XA21 function. They developed Xa21/Xb24ox and Xa21/Xb24S154Aox plants using NtapXb24ox and NtapXb24S154Aox plants, respectively, to cross with ProAXa21 plants, and inoculated these plantswith PXO99.As shown in Fig. 5A, all Xa21/Xb24ox plants display compromised resistance, whereas Xa21/Xb24S154Aox plants show similar disease lesion lengths compared to Xa21 plants. The lesion length difference between Xa21 and Xa21/Xb24ox is highly significant (P = 1.40 × 10−10),whereas the difference between Xa21 and Xa21/Xb24S154Aox is not (P = 0.12). Bacterial growth curve analysis revealed that the amount of Xoo bacteria accumulation in Xa21/Xb24ox plants(2.65 × 108 ± 5.74 × 107) is higher (∼2.45-fold) than that of Xa21 plants (1.08 × 108 ± 6.55 × 106) at 12 days postinoculation'''(Fig. 5B)'''. The amount of Xoo bacterial accumulation in Xa21/Xb24S154Aox plants (0.91 × 108 ± 1.65 × 107) is similar to that measured in Xa21 plants '''(Fig. 5B)'''. The low P values of bacteria accumulation at 12 days postinoculation in Xb24ox plants (0.033against Xa21 and 0.028 against Xa21/Xb24S154Aox, respectively)indicate that these differences are statistically significant. This experiment was repeated two times and similar results were obtained each time. Because ProA-XA21 was expressed to similar levels in Xa21/Xb24ox, Xa21/Xb24S154Aox, and Xa21 plants, these results demonstrate that XB24 requires S154 to repress XA21 function. Thus, we conclude that the ATPase activity of XB24 is essential for XB24 to regulate XA21-mediated defense response.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Represents a Previously Undescribed Class of ATPases'''. ATPases are abundant in most species. ATPases have been classified into four superfamilies, F-, V-, A-, and P-ATPases, based on their structures (33–36). There are some other proteins that cannot be classified into these subfamilies but have ATPase activity, such as heat shock proteins(HSPs), includingHSP60 (33),HSP70 (34), and HSP72 (35). XB24 does not belong to any of these previously&lt;br /&gt;
described superfamilies of ATPases or HSPs. The only conserved structure in XB24 is the region composed of 10 amino acids PSINERES154SS&lt;br /&gt;
that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}-S).The ATPasemotif in the F1,V1, and A1complexes of F-, V-, and AATPases is also essential for ATPase activities, whereas the PATPases and theHSPs do not contain thismotif.However,whether this motif is enough for the ATPase activity of proteins is unclear. Here, They show that XB24, a protein with an ATPase motif but no other motifs or domains, functions as anATPase. Proteins with this conserved motif that cannot be classified into the previously identified ATPases exist in many species, including bacteria, fungi,human, Arabidopsis, and rice. However, none of these have previously been functionally characterized. Thus, our results demonstrating that XB24 is an ATPase with an important function in XA21-mediated immunity will facilitate functional studies of XB24-type ATPases in other species.&lt;br /&gt;
&lt;br /&gt;
'''A Model for XB24-Mediated Regulation of XA21.''' Here, they show that XA21 function is enhanced when XB24 expression is reduced and that XA21 function is compromised when XB24 is overexpressed.XB24 regulation on XA21 is tightly associated with its ATPase activity. Thus, they conclude that XB24 regulates XA21&lt;br /&gt;
function via its ATPase activity.In '''Fig. 7''', they present a model to summarize these results. They hypothesize that the XA21 protein is present on the plasma membrane [after transit from theER(30)], where it recognizes the Ax21PAMP. XB24 physically associates with XA21 and uses ATP to promote phosphorylation of certain Ser/Thr sites onXA21, keeping theXA21 protein in an inactive state.Upon recognition ofAx21, the XA21 kinase becomes activated, triggering downstream defense responses. The mechanism(s) for XA21 activation following perception of Ax21 likely requires dissociation of XA21 from XB24 and/or removal of theXB24-promoted autophosphorylation. In this model, XA21 autophosphorylation occurs on multiple residues,some of which stimulate XA21 function and others of which inhibit XA21 function. For example, autophosphorylation of the JM residues,Ser-686, Thr-688, and Ser-689, is required forXA21-mediated resistance. Autophosphorylation of Thr-705 is also needed for XA21 function. Multisite phosphorylation has been previously demonstrated for the function of insulin receptor substrate 1 (IRS1) in human. In this case, the activation of protein kinase B in response to insulin propagates insulin signaling and promotes the phosphorylation of IRS1 on serine residues, generating a positivefeedback loop for insulin action. Insulin also activates other kinases that induce the phosphorylation of IRS1 on specific sites and inhibit its functions. There is thus a delicate balance existing between positive IRS1 tyrosine/serine phosphorylation and negative IRS1 serine phosphorylation, which can regulate the IRS1.When XB24 is overexpressed (a nonphysiological state), the XA21 protein may not dissociate from XB24 readily or the XB24-promoted phosphorylation may not be easily removed. In this case,binding of Ax21 to XA21 may lead to a conformational change in XA21, exposing the XA21 protein to degradation by endogenous proteases. Alternatively, a protease activity could be induced by Ax21/XA21 binding. In either case, overexpressed XB24 would result in degradation of XA21 when challenged by Ax21. They have previously reported that XB15, a PP2C phosphatase,dephosphorylates autophosphorylated XA21 and negatively regulates the XA21-mediated innate immune responses. Our findings that XB24 promotes XA21 autophosphorylation and inhibits XA21-mediated immune response to the Ax21 PAMP further demonstrate that the phosphorylation state of XA21 is critical for XA21-mediated signaling. Phosphorylation of certain residues on XA21 negatively regulates XA21 function, whereas phosphorylation on other residues may be required for activation of XA21 function. These latter residues are likely dephosphorylated by XB15 to down-regulate XA21 activity. Together with our results that the association between XB24 and XA21 is compromised but the association between XB15 and XA21 is enhanced upon PXO99 inoculation, our model suggests that the regulation by XB24 occurs before Ax21 recognition but that regulation by XB15 occurs after Ax21 recognition.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*College of Life Science, Zhejiang Sci-Tech University, Hangzhou 310018, China. &lt;br /&gt;
&lt;br /&gt;
*Department of Plant Pathology, University of California, Davis, CA 95616,USA.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Xuewei Chen, Mawsheng Chern, Patrick E. Canlas, Deling Ruan, Caiying Jiang, and Pamela C. Ronald(2010) An ATPase promotes autophosphorylation of the pattern recognition receptor XA21 and inhibits XA21-mediated immunity. Proc Natl Acad Sci USA 107: 8029–8034.&lt;br /&gt;
&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;&lt;br /&gt;
Liu GZ, Pi LY, Walker JC, Ronald PC, Song WY (2002) Biochemical characterization of the kinase domain of the rice disease resistance receptor-like kinase XA21. J Biol Chem 277:20264–20269.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Fire A, et al. (1998) Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans. Nature 391:806–811.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Mourrain P, et al. (2000) Arabidopsis SGS2 and SGS3 genes are required for posttranscriptional gene silencing and natural virus resistance. Cell 101:533–542.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Century KS, et al. (1999) Developmental control of Xa21-mediated disease resistance in rice. Plant J 20:231–236.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Lucca P, Ye X, Potrykus I (2001) Effective selection and regeneration of transgenic rice plants with mannose as selective agent. Mol Breed 7:43–49.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Lee SW, Han SW, Bartley LE, Ronald PC (2006) Unique characteristics of Xanthomonas oryzae pv. oryzae AvrXa21 and implications for plant innate immunity. Proc Natl Acad Sci USA 103:18395–18400.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 1]]&lt;br /&gt;
[[Category:Chromosome 1]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0771200&amp;diff=270796</id>
		<title>Os01g0771200</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0771200&amp;diff=270796"/>
				<updated>2016-06-23T13:58:19Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os01g0771200''''' was  first identified as '''''OsXB24''''' in 2010 by the researchers from University of Cambridge&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Bcakground===&lt;br /&gt;
&lt;br /&gt;
*Cell-surface pattern recognition receptors (PRRs) are key components of the innate immune response in animals and plants. These receptors typically carry or associate with non-RD kinases to control early events of innate immunity signaling. Despite their importance, the mode of regulation of PRRs is largely unknown. Here we show that the rice PRR, XA21(Activator of XA21-mediated immunity), interacts with XA21 binding protein 24 (XB24), a previously undescribed ATPase. To date, three XA21 binding (XB) proteins—XB3 (an E3 ubiquitinligase), XB10 (OsWRKY62), and XB15 (a PP2C phosphatase)—have been shown to regulate XA21-mediated immunity. XB24 associates with XA21 in vivo and modulates XA21 function. XB24 belongs to a large class of broadly conserved ATPases of unknown function. The association between XB24 and XA21 is compromised upon inoculation of the Xanthomonas oryzae pv.&lt;br /&gt;
&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
*'''XB24 ATPase Enhances Autophosphorylation of XA21K668.''' The author tested whether XB24 is a substrate of XA21 or affects XA21 kinase autophosphorylation. Purified His-XB24 and GST-XA21K668 were co-incubated in the presence of [32P]ATP for kinase analysis. For a control, the purified His-XB24 was co-incubated with GST-XA21K668K736E, a catalytically inactive mutant&amp;lt;ref name=&amp;quot;ref1&amp;quot;/&amp;gt;. As ( '''Fig. 2B''' ) shows, the GST-XA21K668 autophosphorylates as expected, whereas His-XB24 does not autophosphorylate or become transphosphorylated by GST-XA21K668. The phosphorylation of GSTXA21K668 is highly enhanced in the presence ofHis-XB24 protein.No phosphorylation of GST-XA21K668K736E can be detected in reactions carried out in the presence of absence of His-XB24. These results demonstrate that XB24 promotes XA21K668 autophosphorylation.To test whether XB24 promotes autophosphorylation of intact, native XA21 protein, the immunoprecipitated ProAXA21 protein from rice tissue described above (0, 1, or 2 days post-PXO99 inoculation) was co-incubated with the purified His-XB24 for kinase autophosphorylation analyses.These results demonstrate that XB24 promotes autophosphorylation of the native XA21 protein. Furthermore, XB24 is not transphosphorylated by the XA21 protein with or without PXO99 inoculation. To test whether the ATPase activity of XB24 is required for promoting XA21K668 autophosphorylation, the purified Ntap-XB24 and NtapXB24S154A were incubated with GST-taggedXA21K668 in the presence of [32P]ATP for kinase analyses. Autophosphorylation of GST-XA21K668 is enhanced in the presence of rice-expressed Ntap-XB24 but not Ntap-XB24S154A ('''Fig. 2C'''). Autophosphorylation of the GST-XA21K668 fusion protein is also enhanced in the presence of the His-XB24 protein but not His-XB24S154A. These results demonstrate that XB24 enhances XA21 autophosphorylation and that itsATPase activity is required for this function&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Silencing of Xb24 Enhances Xa21-Mediated Resistance.''' To investigate the biological function of XB24, they used the RNA interference(RNAi) approach&amp;lt;ref name=&amp;quot;ref3&amp;quot;/&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot;/&amp;gt; to silence the Xb24 gene and monitored its effects on disease resistance. They developed two independent lines, Xb24RNAi-3 and Xb24RNAi-9, each containing a single-locus insertion, using the rice cultivar Kitaake as the transgene recipient.RT-PCR analysis revealed that Xb24 transcript levels were significantly reduced in these two lines. Both lines show similar disease lesion lengths compared to the control line Kitaake after challenge with PXO99, indicating that silencing of Xb24 does not affect the susceptibility of Kitaake to Xoo. To explore the role of XB24 in XA21-mediated signaling, they crossed Xb24RNAi-3 and Xb24RNAi-9 with Xa21 lines and obtained one progeny form the Xa21/Xb24RNAi-3 cross and three from the Xa21/Xb24RNAi-9 cross. Our initial results indicated that silencing of Xb24 enhanced resistance. To confirm these results, they developed an F4 line (A176) from one of the F1 plants.TheA176 line carries homozygous Xa21 and homozygous Xb24RNAi-9. They then inoculated 3-week-old A176 plants.As shown in （'''Fig. 3A'''）, these plants developed much shorter lesion lengths (3 ± 0.9 cm) than the wildtype Xa21 plants (6.8±1.2 cm), which show only partial resistance at the 3-weeks-old (tilling) stage&amp;lt;ref name=&amp;quot;ref5&amp;quot;/&amp;gt;. At test gave a P value of 8.62 ×10−13, showing a highly significant difference. Rice line Xb24RNAi-9 showed similar disease lesion lengths (16 ± 2.5 cm) as Kitaake (P =0.56). Bacterial growth curve analysis revealed that Xa21/Xb24RNAi-9 lines harbor 3.2-fold less Xoo bacteria (1.48 × 107 ±1.2 × 106) in their leaves than the Xa21 lines (4.8 × 107±4.4 × 106) at 12 days postinoculation ('''Fig. 3B'''), consistent with the leaf lesion length measurements described above. This experiment was repeated three times, and similar results were obtained each time. These results demonstrate that silencing of Xb24 expression enhances XA21-mediated disease resistance&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Overexpression of XB24 Compromises XA21-Mediated Resistance.''' To investigate the involvement of XB24 in the XA21-mediated signaling, the author created construct Ubi-Xb24 to overexpress XB24 using the maize Ubi-1 promoter. They introduced the Ubi-Xb24 construct directly into an Xa21 (in the TP309 genetic background)line by Agrobacterium-mediated transformation using mannose selection&amp;lt;ref name=&amp;quot;ref6&amp;quot;/&amp;gt; and generated five independent T0 plants. After PCR-based genotyping and RT-PCR-based transcripts expression analyses to confirm that Xb24 is overexpressed, they challenged 6-week-old Xa21 lines with PXO99.They found that all of the five lines have longer disease lesion lengths compared with the wild-type Xa21 plants. Two homozygous lines (Xa21/Xb24ox-1 and -2) fromtwo of these five independent lines were then developed. Overexpression of XB24 (XB24ox) in the progeny from these homozygous lines was confirmed by protein gel blotting analysis('''Fig. 4A'''). Six-week-old plants were challenged with PXO99. Disease lesion lengths on both the Xa21/Xb24ox-1 and -2 lines (7.3 ± 0.5 cmfor line 1 and 6.0 ± 0.5 cmfor line 2) were longer than those observed on Xa21 lines (1.3 ±0.4 cm) ('''Fig. 4 A and B'''). The low P values (5.02 × 10−21 for Xa21/Xb24ox-1 and 2.06 × 10−23 for Xa21/Xb24ox-2) indicate that these differences are statistically significant. At 12 days postinoculation,the accumulation of bacterial populations, as measured by bacterial growth curve analysis, in the two Xa21/Xb24ox lines (1.23 × 108 ±1.88 × 107 for Xa21/Xb24ox-1 and 1.08 × 108 ± 1.97 × 107 for Xa21/Xb24ox-2)was clearly higher (&amp;gt;2-fold) than in theXa21 lines (5.20×107 ± 8.9 × 105) ('''Fig. 4C'''). Again, the low P values (8.27 × 10−4 forXa21/Xb24ox-1 and 2.72 × 10−3 for Xa21/Xb24ox-2) of bacterial accumulation at 12 days postinoculation indicate that these differences are statistically significant. Rice lines overexpressing Xb24 display similar levels of susceptibility as control lines lacking overexpressed Xb24 in three independent biological replicates.These results demonstrate that overexpression of XB24 compromises XA21-mediated resistance&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
*'''Overexpression of Xb24 Causes XA21 Instability Following Ax21 Recognition.''' To gain insight into the mechanism of XB24-mediated regulation of XA21 function, they tested whether XB24 affects the amount of the XA21 protein after Xoo inoculation. As shown in '''Fig. 6 A and B''', without Xoo inoculation (Mock treatment).   Overexpression of XB24(Xa21/Ntap-Xb24) caused no significant decrease in the ProA-XA21 protein level compared to overexpression of Ntap (Xa21/Ntap) alone. In contrast, after inoculation with PXO99, the Xa21/Xb24ox line showed a sharp decrease in the ProA-XA21 protein level. The Xa21/Ntap control line showed amarked increase. When inoculated with the Xoo strain PXO99ΔraxST, the Xa21/Xb24ox sample showed an increase in the ProA-XA21 level similar to that of the Xa21/Ntap control. Similar results were obtained from three biological repeats of this experiment.These results indicate that the sharp decrease in the XA21 protein level is Ax21-specific&amp;lt;ref name=&amp;quot;ref2&amp;quot;/&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
[[File:1HF1.jpg|frame|Fig. 1. Association of XB24 with XA21 in yeast and in rice plants. (A) Interaction&lt;br /&gt;
of XB24 with XA21K668 in yeast. K668, truncated XA21 (XA21K668)&lt;br /&gt;
containing the entire JM and kinase domains (23); K668K736E, kinase catalytically&lt;br /&gt;
inactive mutant XA21K668K736E; XB24(1-146), truncated XB24 containing&lt;br /&gt;
amino acids 1–146; XB24(146-198), truncated XB24 containing amino acids&lt;br /&gt;
146–198 including the ATPase motif. Blue, positive interaction. Expression&lt;br /&gt;
proteins were detected using antibodies as indicated in Western blotting. (B)&lt;br /&gt;
Detection of XA21 and XB24 in immunoprecipitates of ProA-XA21 from rice&lt;br /&gt;
tissues using the Peroxidase Anti-Peroxidase (PAP) probe and anti-XB24,&lt;br /&gt;
respectively. *, Cleaved form of ProA-XA21 (23, 24). (C) Analysis of XB24&lt;br /&gt;
protein levels in plants before and after PXO99 inoculation using anti-XB24 in&lt;br /&gt;
Western blot analysis. A duplicate protein gel was stained with Coomassie&lt;br /&gt;
brilliant blue (CBB) as loading control. (D) Dissociation of XB24 from XA21 in&lt;br /&gt;
response to PXO99 inoculation. Detection of ProA-XA21 and XB24 in the&lt;br /&gt;
immunoprecipitates of ProA-XA21 from rice leaf tissues not treated or treated&lt;br /&gt;
(1 or 2 days) with Xoo strains as indicated. IP, immunoprecipitate.]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 2B.png|frame|Figure 2.An ATPase activity is associated with XB24 and effects XA21 auto-&lt;br /&gt;
phosphorylation. (A) ATPase activity assay on purified Ntap-XB24 and Ntap-&lt;br /&gt;
XB24S154Aprotein from transgenic plants. The same amount of proteins was&lt;br /&gt;
used. (Left) Representative autoradiogram. (Right) Quantitative results of&lt;br /&gt;
three independent experiments. ATP hydrolysis was quantified based on&lt;br /&gt;
radioactivity of the reaction product Pi. Error bars indicate SDs. (B) Effects of&lt;br /&gt;
XB24 on XA21 autophosphorylation. In vitro autophosphorylation assays&lt;br /&gt;
were performed on GST-XA21K668 and GST-XA21K668K736E, respectively, in&lt;br /&gt;
the presence of the purified His-XB24 protein. (C) Effects of XB24 ATPase on&lt;br /&gt;
XA21 autophosphorylation. An in vitro autophosphorylation assay was&lt;br /&gt;
performed on GST-XA21K668 in the presence of the same amount of rice-&lt;br /&gt;
expressed Ntap-XB24 or Ntap-XB24S154A. (Upper) Representative auto-&lt;br /&gt;
radiogram. (Lower) Quantitative results (mean + SD) from three independ-&lt;br /&gt;
ent experiments. CK, control provided using autophosphorylation assay on&lt;br /&gt;
GST-XA21K668 in the absence of XB24. The autophosphorylation level from&lt;br /&gt;
CK was arbitrarily set as “1.”|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 3.png|frame|Figure 3.Effects of reduced expression of Xb24 on Xa21-mediated resistance.&lt;br /&gt;
(A) Quantitative lesion length measurements of rice leaves at 14 days after&lt;br /&gt;
PXO99 inoculation. The means ± SD of each sample was calculated from 24&lt;br /&gt;
infected leaves of 8 plants. (B) Bacterial growth curves after PXO99 inoculation. Error bars indicate SDs.|right]]&lt;br /&gt;
&lt;br /&gt;
[[File:Fig. 4.png|frame|Figure 4.Effects of overexpression of Xb24 on Xa21-mediated resistance. (A)&lt;br /&gt;
Photograph of rice leaves 14 days after inoculation with PXO99 (Top). The&lt;br /&gt;
disease lesions are indicated from the top of the leaf cuts to the arrows. The&lt;br /&gt;
XB24 protein was detected by anti-XB24 (Middle). A duplicate protein gel&lt;br /&gt;
was stained with CBB as control (Bottom). (B) Quantitative lesion length&lt;br /&gt;
measurements of rice leaves at 14 days after Xoo inoculation. The average of&lt;br /&gt;
each sample was calculated from 40 infected leaves of 10 plants. (C) Growth&lt;br /&gt;
curves of Xoo postinoculation. Error bars in B and C indicate SDs.|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF5.jpg|frame|Fig. 5. Requirement of XB24 ATPase activity for regulation of XA21-mediated&lt;br /&gt;
immunity. (A) Lesion lengths were measured for Xa21, Kitaake, Xa21/Xb24ox, and&lt;br /&gt;
Xa21/Xb24S154Aox at 14 days after PXO99 inoculation. The mean and SD of each&lt;br /&gt;
sample were determined using 32 infected leaves from 8 plants. (B) Bacterial&lt;br /&gt;
growth curve analysis after PXO99 inoculation. Error bars indicate SDs.|right]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF6.jpg|frame|Fig. 6. Effects of excess XB24 on XA21 protein stability. (A) Protein immunodetection&lt;br /&gt;
after SDS/PAGE separation. Protein samples were prepared&lt;br /&gt;
from ProA-Xa21 transgenic rice plants overexpressing Ntap-Xb24 (labeled&lt;br /&gt;
Xa21/Ntap-Xb24) or Ntap (labeled Xa21/Ntap) before or after inoculation (1&lt;br /&gt;
day) with PXO99 or PXO99ΔRaxST (lacking Ax21 activity). Protein accumulation&lt;br /&gt;
detected by the PAP probe is shown in (Top) (for ProA-XA21) and&lt;br /&gt;
(Middle) (for Ntap-XB24 or Ntap), respectively. (Bottom) CBB-stained gel as a&lt;br /&gt;
loading control. (B) Quantification of XA21 protein levels. The average and&lt;br /&gt;
SD are calculated from three biological replicate experiments of (A).|left]]&lt;br /&gt;
&lt;br /&gt;
[[File:1HF7.jpg|frame|Fig. 7. A model for XB24-mediated regulation of XA21 function. Before&lt;br /&gt;
Ax21 recognition (left), XB24 physically associates with XA21 and uses ATP to&lt;br /&gt;
promote phosphorylation of certain Ser/Thr sites on XA21, keeping the XA21&lt;br /&gt;
protein in an inactive state. Upon recognition of Ax21 (center), Xb24 dissociates&lt;br /&gt;
from Xa21 leading to activation of the XA21 kinase, resulting in&lt;br /&gt;
resistance. Once the signal has been relayed, XA21 binds the XB15 phosphatase&lt;br /&gt;
(right), which attenuates the immune response, likely by dephosphorylation&lt;br /&gt;
of amino acids required for XA21 function.|right]]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
*The XB24 cDNAis expressed from a unique rice gene, Os01g56470, and encodes a 198-aa protein. The predicted secondarystructure has no significant motifs except for a C-terminal ATP synthase α-and β-subunits signature (ATPase) motif with the sequence PSINERESSS.Although 38 human proteins, 43 Arabidopsis proteins, and 67 additional rice proteins are annotated to contain a conserved ATPase motif, none share similarity beyond the ATPase motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases.The only conserved structure in XB24 is the region composed of 10 amino acids PSINERES154SS that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}-S).&lt;br /&gt;
&lt;br /&gt;
*Silencing of Xb24 Enhances Xa21-Mediated Resistance. &lt;br /&gt;
&lt;br /&gt;
*overexpression of XB24 Compromises XA21-Mediated Resistance.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
XB24 ATPase enzyme activity is required for XB24 function. XA21 is degraded in the presence of the pathogen-associated molecular pattern Ax21 when XB24 is overexpressed. These results demonstrate a function for this large class of broadly conserved ATPases in PRR-mediated immunity.XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice lines silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice lines overexpressing XB24 are compromised for immunity.&lt;br /&gt;
&lt;br /&gt;
== Other associations with XA21 ==&lt;br /&gt;
&lt;br /&gt;
The association between XB24 and XA21 is compromised upon inoculation of the Xanthomonas oryzae pv. oryzae (Xoo) strain PXO99, which secretes the Ax21 PAMP &amp;lt;ref name=&amp;quot;ref7&amp;quot;/&amp;gt;. XB24 promotes autophosphorylation of XA21 through its ATPase activity. Rice plants silenced for Xb24 display enhanced XA21-mediated immunity, whereas rice plants overexpressing XB24 are compromised for immunity. XA21 is degraded in the presence of Ax21 when XB24 is overexpressed. These findings reveal that XB24 negatively regulates XA21 PRR function.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Physically Associates with XA21 in Vivo.''' The author isolated XB24 as an XA21 interacting protein through yeast two-hybrid screening. The XB24 cDNAis expressed froma unique rice gene,Os01g56470, and encodes a 198-aa protein. The predicted secondary structure has no significant motifs except for a C-terminal ATP synthase α- and β-subunits signature (ATPase) motif with the sequence PSINERESSS. Although 38 human proteins, 43 Arabidopsis proteins, and 67&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
additional rice proteins are annotated to contain a conserved ATPase motif, none share similarity beyond the ATPase motif with XB24 and most are not functionally characterized. Thus, XB24 belongs to a previously uncharacterized class of ATPases. To confirm the specificity of the XB24-XA21interaction, they performed yeast two-hybrid analysis and foundthatXB24 associates with XA21K668 (containing the entire juxtamembrane and the kinase domains of XA21) but not with XA21K668K736E , a catalytically inactive mutant of XA21K668 (Fig. 1A Left). These results indicate that the association between XB24 and XA21 requires XA21 kinase activity. The ATPase motif of XB24 is not required for the XB24-XA21 interaction in yeast because XB24(1-146), lacking the ATPase motif, retains the ability to interact with XA21, whereas XB24(146-198), containing the ATPase motif, is incapable of interacting with XA21 '''(Fig. 1A Right)'''.To determine whether XB24 physically associates with XA21 in vivo, we created transgenic plants that express a protein A domaintagged XA21 (ProA-XA21) under control of the native Xa21 promoter in the rice cultivar Kitaake. They established a homozygous line, A114, with a single transgene insertion and demonstrated that it confers full resistance to Xoo strain PXO99. A complex associated with ProA-XA21 was immunoprecipitated from total extracts from A114 leaves. Ntap (N-terminal tandem affinity purification, which contains the same protein A domain) transgenic plants, under control of the maizeUbi-1 promoter, were used as the control. The immunoprecipitateswere separated on anSDS/PAGEgel and analyzed by Western blotting using the PAP antibody to probe ProA-XA21 and Ntap, and anti-XB24 antibody for XB24, separately. The PAP probe detected full-length ProA-XA21 and a cleaved XA21 product (marked by an asterisk in Fig. 1B) in the ProA-XA21 immunoprecipitate.Aclear band of endogenousXB24 was detected from the immunoprecipitate of ProA-XA21 but not from the precipitates of Ntap '''(Fig. 1B)'''.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Dissociates from XA21 in Response to PXO99 Inoculation.'''To determine whether XB24 is degraded in response to Xoo strain PXO99  inoculation, they performed a Western blot analysis to detect the XB24 protein before and after inoculation. They found that a similar amount of XB24 protein was detected in Xa21 and Kitaake plants before inoculation and 1 day or 2 days after inoculation. This result shows that XB24 is not degraded in response to Ax21. They next investigated whether Ax21 recognition affects the interaction of XA21 and XB24. We performed coimmunoprecipitation experiments withPAP(targeting ProA-XA21)using rice leaf tissues fromtheXa21line inoculated with Xoo strain PXO99 or Xoo strain PXO99ΔraxST, which lacks Ax21 activity due to a knockout of the raxST gene. They then carried out immunoblotting to detect XB24. A similar coimmunoprecipitation was performed using Kitaake rice leaves as a control. As shown in '''Fig. 1D''', they observed a sharp decrease in the amount of XB24 associated with ProA-XA21 post-PXO99 inoculation, whereas, no decrease in the amount of XB24 associated with ProA-XA21 was observed after PXO99ΔraxST inoculation. These results clearly indicate that the physical interaction between XB24 and XA21 disassociates specifically in response to Xoo strains expressing Ax21 activity.&lt;br /&gt;
&lt;br /&gt;
'''ATPase Activity Is Essential for XB24-Mediated Regulation of XA21 Function.''' The author tested whether XB24 ATPase activity was required for XB24 to regulate XA21 function. They developed Xa21/Xb24ox and Xa21/Xb24S154Aox plants using NtapXb24ox and NtapXb24S154Aox plants, respectively, to cross with ProAXa21 plants, and inoculated these plantswith PXO99.As shown in Fig. 5A, all Xa21/Xb24ox plants display compromised resistance, whereas Xa21/Xb24S154Aox plants show similar disease lesion lengths compared to Xa21 plants. The lesion length difference between Xa21 and Xa21/Xb24ox is highly significant (P = 1.40 × 10−10),whereas the difference between Xa21 and Xa21/Xb24S154Aox is not (P = 0.12). Bacterial growth curve analysis revealed that the amount of Xoo bacteria accumulation in Xa21/Xb24ox plants(2.65 × 108 ± 5.74 × 107) is higher (∼2.45-fold) than that of Xa21 plants (1.08 × 108 ± 6.55 × 106) at 12 days postinoculation'''(Fig. 5B)'''. The amount of Xoo bacterial accumulation in Xa21/Xb24S154Aox plants (0.91 × 108 ± 1.65 × 107) is similar to that measured in Xa21 plants '''(Fig. 5B)'''. The low P values of bacteria accumulation at 12 days postinoculation in Xb24ox plants (0.033against Xa21 and 0.028 against Xa21/Xb24S154Aox, respectively)indicate that these differences are statistically significant. This experiment was repeated two times and similar results were obtained each time. Because ProA-XA21 was expressed to similar levels in Xa21/Xb24ox, Xa21/Xb24S154Aox, and Xa21 plants, these results demonstrate that XB24 requires S154 to repress XA21 function. Thus, we conclude that the ATPase activity of XB24 is essential for XB24 to regulate XA21-mediated defense response.&lt;br /&gt;
&lt;br /&gt;
'''XB24 Represents a Previously Undescribed Class of ATPases'''. ATPases are abundant in most species. ATPases have been classified into four superfamilies, F-, V-, A-, and P-ATPases, based on their structures (33–36). There are some other proteins that cannot be classified into these subfamilies but have ATPase activity, such as heat shock proteins(HSPs), includingHSP60 (33),HSP70 (34), and HSP72 (35). XB24 does not belong to any of these previously&lt;br /&gt;
described superfamilies of ATPases or HSPs. The only conserved structure in XB24 is the region composed of 10 amino acids PSINERES154SS&lt;br /&gt;
that is predicted as the ATPase motif, (P-[SAP]-[LIV]-[DNH]-{LKGN}-{F}-{S}-S-{DCPH}-S).The ATPasemotif in the F1,V1, and A1complexes of F-, V-, and AATPases is also essential for ATPase activities, whereas the PATPases and theHSPs do not contain thismotif.However,whether this motif is enough for the ATPase activity of proteins is unclear. Here, They show that XB24, a protein with an ATPase motif but no other motifs or domains, functions as anATPase. Proteins with this conserved motif that cannot be classified into the previously identified ATPases exist in many species, including bacteria, fungi,human, Arabidopsis, and rice. However, none of these have previously been functionally characterized. Thus, our results demonstrating that XB24 is an ATPase with an important function in XA21-mediated immunity will facilitate functional studies of XB24-type ATPases in other species.&lt;br /&gt;
&lt;br /&gt;
'''A Model for XB24-Mediated Regulation of XA21.''' Here, they show that XA21 function is enhanced when XB24 expression is reduced and that XA21 function is compromised when XB24 is overexpressed.XB24 regulation on XA21 is tightly associated with its ATPase activity. Thus, they conclude that XB24 regulates XA21&lt;br /&gt;
function via its ATPase activity.In '''Fig. 7''', they present a model to summarize these results. They hypothesize that the XA21 protein is present on the plasma membrane [after transit from theER(30)], where it recognizes the Ax21PAMP. XB24 physically associates with XA21 and uses ATP to promote phosphorylation of certain Ser/Thr sites onXA21, keeping theXA21 protein in an inactive state.Upon recognition ofAx21, the XA21 kinase becomes activated, triggering downstream defense responses. The mechanism(s) for XA21 activation following perception of Ax21 likely requires dissociation of XA21 from XB24 and/or removal of theXB24-promoted autophosphorylation. In this model, XA21 autophosphorylation occurs on multiple residues,some of which stimulate XA21 function and others of which inhibit XA21 function. For example, autophosphorylation of the JM residues,Ser-686, Thr-688, and Ser-689, is required forXA21-mediated resistance. Autophosphorylation of Thr-705 is also needed for XA21 function. Multisite phosphorylation has been previously demonstrated for the function of insulin receptor substrate 1 (IRS1) in human. In this case, the activation of protein kinase B in response to insulin propagates insulin signaling and promotes the phosphorylation of IRS1 on serine residues, generating a positivefeedback loop for insulin action. Insulin also activates other kinases that induce the phosphorylation of IRS1 on specific sites and inhibit its functions. There is thus a delicate balance existing between positive IRS1 tyrosine/serine phosphorylation and negative IRS1 serine phosphorylation, which can regulate the IRS1.When XB24 is overexpressed (a nonphysiological state), the XA21 protein may not dissociate from XB24 readily or the XB24-promoted phosphorylation may not be easily removed. In this case,binding of Ax21 to XA21 may lead to a conformational change in XA21, exposing the XA21 protein to degradation by endogenous proteases. Alternatively, a protease activity could be induced by Ax21/XA21 binding. In either case, overexpressed XB24 would result in degradation of XA21 when challenged by Ax21. They have previously reported that XB15, a PP2C phosphatase,dephosphorylates autophosphorylated XA21 and negatively regulates the XA21-mediated innate immune responses. Our findings that XB24 promotes XA21 autophosphorylation and inhibits XA21-mediated immune response to the Ax21 PAMP further demonstrate that the phosphorylation state of XA21 is critical for XA21-mediated signaling. Phosphorylation of certain residues on XA21 negatively regulates XA21 function, whereas phosphorylation on other residues may be required for activation of XA21 function. These latter residues are likely dephosphorylated by XB15 to down-regulate XA21 activity. Together with our results that the association between XB24 and XA21 is compromised but the association between XB15 and XA21 is enhanced upon PXO99 inoculation, our model suggests that the regulation by XB24 occurs before Ax21 recognition but that regulation by XB15 occurs after Ax21 recognition.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*College of Life Science, Zhejiang Sci-Tech University, Hangzhou 310018, China. &lt;br /&gt;
&lt;br /&gt;
*Department of Plant Pathology, University of California, Davis, CA 95616,USA.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Liu GZ, Pi LY, Walker JC, Ronald PC, Song WY (2002) Biochemical characterization of the kinase domain of the rice disease resistance receptor-like kinase XA21. J Biol Chem 277:20264–20269.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Xuewei Chen, Mawsheng Chern, Patrick E. Canlas, Deling Ruan, Caiying Jiang, and Pamela C. Ronald(2010) An ATPase promotes autophosphorylation of the pattern recognition receptor XA21 and inhibits XA21-mediated immunity. Proc Natl Acad Sci USA 107: 8029–8034.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Fire A, et al. (1998) Potent and specific genetic interference by double-stranded RNA in Caenorhabditis elegans. Nature 391:806–811.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Mourrain P, et al. (2000) Arabidopsis SGS2 and SGS3 genes are required for posttranscriptional gene silencing and natural virus resistance. Cell 101:533–542.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;Century KS, et al. (1999) Developmental control of Xa21-mediated disease resistance in rice. Plant J 20:231–236.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Lucca P, Ye X, Potrykus I (2001) Effective selection and regeneration of transgenic rice plants with mannose as selective agent. Mol Breed 7:43–49.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Lee SW, Han SW, Bartley LE, Ronald PC (2006) Unique characteristics of Xanthomonas oryzae pv. oryzae AvrXa21 and implications for plant innate immunity. Proc Natl Acad Sci USA 103:18395–18400.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&amp;lt;/references&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 1]]&lt;br /&gt;
[[Category:Chromosome 1]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270795</id>
		<title>Os03g0646900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270795"/>
				<updated>2016-06-23T13:40:19Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;* The rice '''''Os03g0646900''''' was reported as '''''OsGL3.1''''' in 2012 by the researchers from Chinese Academy of Sciences &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. &lt;br /&gt;
== '''One sentence summary''' ==&lt;br /&gt;
* OsGL3.1 encodes a protein phosphatase kelch (PPKL) family — Ser/Thr phosphatase and GL3.1 is a member of the large grain WY3 variety, which is associated with weaker dephosphorylation activity than the small grain FAZ1 variety GL3.1&lt;br /&gt;
&lt;br /&gt;
== '''Annotated Information''' ==&lt;br /&gt;
&lt;br /&gt;
'''2.1 Fine-mapping of a new QTL, GL3.1, which regulates rice grain yield'''&lt;br /&gt;
[[File:fig2.1.jpg|right|thumb|550px|''fig2.1 Map-based cloning of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
* Fengaizhan-1 (FAZ1) and Waiyin-3 (WY3) rice varieties were selected as parents to map the QTLs that affect grain length. FAZ1 is a small grain indica variety (1 000-grain weight: 20.18 ± 0.89 g), whereas WY3 is a larger grain japonica variety (1 000-grain weight: 43.40 ± 0.92 g; Figure 1A). We fine-mapped a new major QTL (GL3.1) for grain length to a 20-kb region between the L012 and L008 markers on chromosome 3 (25 036 192 bp to 25 060 567 bp at chromosome 3) (Figure 1B), which is distinct from other previously reported QTLs [35-38]. This region contains two genes: Os03g44510, which is a predicted transposon that was excluded from further analysis because the transcript was not detected in both parents, and the predicted phosphatase Os03g44500, which was expressed in both parents and considered as the GL3.1 candidate. Based on the mapping results, we developed a nearisogenic line (NIL) from BC4F2 generations that contained a 30-kb WY3 chromosomal region at the GL3.1 locus in a FAZ1 genetic background (Figure 1C; Supplementary information, Figure S1A-S1C). &lt;br /&gt;
* NIL had longer grains (+16.1%) than FAZ1 (10.71 ± 0.13 mm vs 9.22 ± 0.09 mm), but there were no significant differences in grain width or thickness (Figure 1D-1F), plant height or tiller number (Supplementary information, Figure S1DS1E). NIL had a significantly greater 1 000-grain weight than FAZ1 (+43.5%; Figure 1G) and reduced grain number per main panicle (21.3%, Supplementary information, Figure S1F). NIL exhibited an increase in the milk filling rate (Figure 1H-1I) and higher expression of milk filling-related genes (Supplementary information, Figure S1G). The plot grain yield was significantly increased in NIL (+ 11.1%; Figure 1J); however, the grain quality was not affected, as the packing density of starch granules was similar in the mature seeds of NIL and FAZ1 (Supplementary information, Figure S1H-S1I), and the chalky grain percentage and protein and amylose contents were similar between the NIL and FAZ1 grains (Supplementary information, Figure S1J-S1L). &lt;br /&gt;
* We crossed NIL with Huanghuazhan, which is a relatively high-yield elite indica variety that is widely cultivated in Southern China, and subsequently backcrossed the F1 generation with Huanghuazhan to obtain a Huanghuazhan (GL3.1) variety that exhibited a longer and heavier grain (Supplementary information, Figure S2A-S2E) and a higher grain yield than Huanghuazhan under field conditions (Supplementary information, Figure S2F). These findings confirmed that GL3.1 potentially increases grain yield. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''2.2 Confirmation of GL3.1 function'''&lt;br /&gt;
[[File:fig2.2.jpg|right|thumb|150px|''Figure 2.2 Transgenic analysis of GL3.1.(from reference &amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
GL3.1 contains a 3 012-bp open reading frame (ORF) that encodes 21 exons and 20 introns. The FAZ1 GL3.1 allele contains 4-bp differences when compared with the WY3 GL3.1 allele (FAZ1 to WY3: 1092C-A, 1495CT, 2643A-G, 2838T-C), which results in two amino acid substitutions (364 aspartic acid — glutamic acid (364DE), 499 histidine — tyrosine (499H-Y); Figure 2A). We sequenced GL3.1 in several large grain varieties and detected the japonica variety Nanyangzhan with a truncated GL3.1 allele as well as Jizi1560 and Jizi1581, which contained 15 additional amino acids at the C-terminus compared with FAZ1 and WY3. At the positions 364 and 499, Jizi1560 and Jizi1581 exhibited the same amino acid substitutions as WY3 (Supplementary information, Figure S3). Transgenic rice plants were generated to determine whether GL3.1 controls grain length. FAZ1 and WY3 failed to regenerate shoots from the callus, and therefore we used the small-grain japonica variety Zhonghua 11, which was easily regenerated [39]. We generated constructs containing the full-length GL3.1 ORFs from FAZ1 or WY3 under the CaMV 35S promoter. Some of the obtained transgenic lines that overexpressed the WY3 GL3.1 allele showed an increased grain length (GL3.1-WY3), whereas the grain length was not changed in all lines overexpressing the FAZ1 GL3.1 allele (GL3.1-FAZ1; data not shown). Only the GL3.1- WY3 line, which expressed relatively high levels of GL3.1-WY3, exhibited increases in grain length (Figure 2B-2D, Supplementary information, Figure S4A-S4B), which confirms that GL3.1 controls grain length. GL3.1- FAZ1 RNA interference (RNAi) and antisense transgenic plants were generated; however, no phenotypic changes in grain length were observed (data not shown). We also observed that GL3.1 was downregulated but not completely suppressed in these lines; therefore, we hypothesized that these lines retained adequate GL3.1 function, as GL3.1 was abundantly expressed.&lt;br /&gt;
GL3.1 is predicted to encode a Ser/Thr phosphatase of unknown function and with two predicted domains: a Kelch_1 protein interaction domain and a Ser/Thr phosphatase domain (Figure 2A). Transgenic plants were generated to investigate the effect of the GL3.1 point substitutions GL3.1-M1 (364E, 499H) and GL3.1-M2 (364D, 499Y) in FAZ1 and WY3. Both transgenic lines exhibited significant increases in grain length (Supplementary information, Figure S4C-S4H). Similar to the GL3.1-WY3 transgenic lines, only high levels of GL3.1- M1 or GL3.1-M2 overexpression led to enhanced grain length. These results suggest that the 364D-E and 499HY substitutions both influence the function of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.3 GL3.1 functions as a Ser/Thr phosphatase'''&lt;br /&gt;
[[File:fig2.3.jpg|right|thumb|150px|''Figure 3 Expression pattern and molecular function of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
Although some nucleotides were different between the promoters of FAZ1 and WY3, the GL3.1 expression pattern remained similar (Supplementary information, Figure S5). GL3.1 was expressed in all organs and developmental stages tested in FAZ1 and NIL (Supplementary information, Figure S6A-S6C). Notably, expression of GL3.1 was higher in the panicle of NIL at the heading stage than in the panicle of FAZ1 (Figure 3A) and lower in the calluses from FAZ1 and NIL, which primarily con- sist of dividing cells (Supplementary information, Figure S6D). GL3.1 in both parents was detected throughout the entire cell (Figure 3B). Purified GL3.1-FAZ1 and GL3.1- WY3 dephosphorylated myelin basic protein (MyBP; a standard substrate) in vitro, which demonstrates that GL3.1 is a functional Ser/Thr phosphatase (Figure 3C); however, GL3.1-FAZ1 exhibited higher activity than GL3.1-WY3. In addition, GL3.1 from Nanyangzhan (GL3.1-NYZ) did not show dephosphorylation ability (Figure 3C). GL3.1 was insensitive to both okadaic acid (OA) and Inhibitor 2 (Figure 3D), which suggests that GL3.1 may encode a novel type of PPKL, as the PPKL and PP1 enzymes are generally sensitive to Inhibitor 2 [27], whereas the PPKL family member BSU1 is sensitive to OA [32]. Furthermore, we observed that the phosphatase domain of GL3.1 was also not sensitive to these two inhibitors (Supplementary information, Figure S6E). A comparative analysis of phosphatases that are typically sensitive to OA revealed that 929G in GL3.1 conferred resistance to OA (Supplementary information, Figure S7). According to a previous study [40] in rats, PP2Aα is sensitive to OA, but the Y267G mutant of this protein is resistant to OA, which indicates that Y267G is a key mutation for OA resistance. Alignment analysis revealed that 267Y in rat PP2Aα corresponds to 929G in GL3.1, which suggests that GL3.1 harbors a Y to G mutation at this key site that may be responsible for the OA insensitivity of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.4 GL3.1 regulates spikelet hull cell division'''&lt;br /&gt;
[[File:fig2.4.jpg|right|thumb|150px|''Figure 4 GL3.1 alters spikelet hull cell division to regulate grain length. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
We measured the lemma cell length to determine whether GL3.1 regulates grain length. There were no significant differences in cell length at the central point of the lemma in the vertical orientation (Figure 4A-4B, Supplementary information, Figure S6F) and the distance between tubercles at the outer spikelet hull surface (Figure 4C-4D, Supplementary information, Figure S6G), which indicates that cell length is not responsible for the difference in grain length between FAZ1 and NIL. As the FAZ1 and NIL life cycles and heading days are similar, we hypothesized that an increased rate of cell division may be responsible for the longer spikelet hull in NIL. Therefore, we assessed the cell division rate during different developmental stages of the spikelet hull in the two parents. The detection points were set at the stages when the spikelet hull length reached 25%, 50%, 65%, 80% and 100% of the full spikelet hull length in FAZ1 and NIL, and the percentage of cells with 4C DNA content in the spikelet hull as well as the cell lengths at the central zone of the spikelet hull at these points were also recorded (Figure 4E, Supplementary information, Figure S6F). At the five detection points, the cell length in the vertical orientation was not different between FAZ1 and NIL. Notably, at 50% of full spikelet hull length, the percentage of cells with a 4C DNA content was significantly higher in NIL than in FAZ1 (Figure 4E). Consistent with this, the expression of cell cycle-related genes was significantly higher in the NIL than in the FAZ1 spikelet (Figure 4F). Therefore, we propose that rapid cell division occurs in NIL during spikelet hull development. Furthermore, we synchronized cells from FAZ1 and NIL using hydroxycarbamide, which blocks cell division at the G1/S boundary. 8 h after release from hydroxycarbamide, the expression of Histone H4 was maximal in FAZ1 and NIL (Supplementary information, Figure S6H), which suggests that the cells from FAZ1 and NIL had entered the S phase. In addition, a higher percentage of cells with 4C DNA content and a lower percentage of cells in S phase were observed in NIL when compared with FAZ1 (Figure 4G-4I), which implies that more cells from NIL completed DNA duplication. We also observed that the maximal expression of CYCD4;1, which was expressed from early G2 phase to M phase, was earlier in NIL (28 h after release) than in FAZ1 (32 h after release) (Supplementary information, Figure S6I), which implies faster entry into the G2 phase in NIL cells. Furthermore, we synchronized cells from FAZ1 and NIL using nocodazole, which blocks cell division at the G2/M boundary. The expression of CYCD3;1, which is specifically expressed at the G1/S stage, remained the same between FAZ1 and NIL (Supplementary information, Figure S6J), which implies that the transformation from the G2 phase to G1 phase was not different between the two parents. These results suggest that the transformation from G1 to G2 may be accelerated in NIL. Thus, our results collectively demonstrate that the GL3.1-WY3 allele increases the rate of cell division during spikelet hull development compared with the GL3.1-FAZ1 allele, which results in a longer spikelet hull. &lt;br /&gt;
&lt;br /&gt;
'''2.5 GL3.1 interacts with Cyclin-T1;3 to regulate grain length'''&lt;br /&gt;
[[File:fig2.5.jpg|right|thumb|150px|''Figure5 GL3.1 and Cyclin-T13 interact(from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
To determine the mechanism underlying the GL3.1- mediated regulation of grain size, a yeast two-hybrid system was used to screen a cDNA library constructed from Zhonghua 11 spikelets using GL3.1-FAZ1 as bait. We identified 23 interacting proteins, of which Os11g05850, annotated as Cyclin-T1;3, was selected for further analysis (Figure 5A). The expression of Cyclin-T1;3 was localized to the nucleus of Arabidopsis protoplasts (Figure 5B), which was consistent with the expression pattern observed in humans. When GL3.1 was co-expressed with Cyclin-T1;3, increased accumulation of GL3.1 was observed in the nuclei from both parents when compared with expression without Cyclin-T1;3 (Figures 5C and 3B). We confirmed that GL3.1 dephosphorylated Cyclin-T1;3 in vitro. GL3.1-FAZ1 exhibited stronger Cyclin-T1;3 dephosphorylation activity than GL3.1- WY3, GL3.1-M1 and GL3.1-M2 (Figure 5D), which was consistent with the effects observed for the common substrate MyBP (Figure 3C). As the kelch-repeat domain has demonstrated potential for protein interactions [41], we used a bimolecular fluorescence complementation (BiFC) assay to identify such interactions. GL3.1ΔP, which contains a kelch-repeat domain, interacted with Cyclin-T1;3 in the absence of the GL3.1 Ser/Thr phosphatase domain (Figure 5E). In addition, Cyclin-T1;3 was constitutively expressed in various tissues and organs in a pattern similar to that of GL3.1 (Supplementary information, Figure S8A-S8D). These results demonstrate that Cyclin-T1;3 interacts with GL3.1 and is dephosphorylated through GL3.1. &lt;br /&gt;
Real-time PCR was performed to analyze the expression of Cyclin-T1;3 after cell synchronization. In contrast to the high expression levels observed at 16 h and 32 h in FAZ1 cells, Cyclin-T1;3 showed increased expression at 8 h and 28 h in NIL cells (Figure 5F). At these two specific points, the cells were entering the S and G2 phases, respectively, which indicates that Cyclin-T1;3 may be involved in cell cycle control. Moreover, we used transgenic rice plants to determine whether Cyclin-T1;3 influences grain size. No obvious phenotype was observed when we overexpressed Cyclin-T1;3 in Zhonghua 11. However, antisense strands of Cyclin-T1;3 resulted in smaller grain sizes in the transgenic plants as well as reduced expression of CyclinT1;3 (Figure 5G-5I). Thus, our data indicate that Cyclin-T1;3 is involved in the GL3.1-mediated regulation of grain length.&lt;br /&gt;
&lt;br /&gt;
'''2.6 GL3.1 is a widespread gene that influences protein phosphorylation in vivo'''&lt;br /&gt;
[[File:fig2.6.jpg|right|thumb|150px|''Figure 6 GL3.1 influences protein phosphorylation status as a potential model for grain size control. (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
A quantitative proteomic analysis using two-dimensional difference gel electrophoresis (2-D DIGE) indicated that 21 proteins were differentially expressed in FAZ1 and NIL, of which 18 were upregulated in NIL (Supplementary information, Table S1). Mass spectrometry revealed that the 21 proteins were associated with cellular metabolic processes. Interestingly, actin was upregulated in NIL, which is consistent with the observation that GL3.1 influences the rate of cell proliferation. The phosphopeptides from the young spikelets of FAZ1 and NIL were enriched on the TiO2 beads and quantified using iTRAQ, which confirmed that GL3.1 is a phosphatase. 556 phosphopeptides were detected, and 464 of these molecules were quantified. Proteins showing a 1.5- fold difference between FAZ1 and NIL and demonstrating the same trend when quantified using two different labelling systems were chosen for further analysis. At least 130 proteins demonstrated a different phosphorylation status between FAZ1 and NIL during spikelet development (Figure 6A and Supplementary information, Table S2). Gene ontology analysis revealed that these proteins are primarily involved in processes related to nucleic acid metabolism and protein complex assembly (Figure 6B and Supplementary information, Table S3). The molecular functions of these proteins include nucleotide binding and the activities of phosphotransferases, helicases and the RNA polymerase II transcription factor. These results strongly suggest that GL3.1 could influence DNA duplication. Thus, we propose that GL3.1 regulates the expression and phosphorylation of a variety of genes involved in metabolism and cell division. Further phylogenetic analyzes based on genomic BLAST searches demonstrated the widespread existence of GL3.1 in plants (Supplementary information, Figure S9), which suggests that GL3.1 has an important conserved function in plants.&lt;br /&gt;
&lt;br /&gt;
== Knoledge Extension ==&lt;br /&gt;
&lt;br /&gt;
== Labs working on this gene ==&lt;br /&gt;
*Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China&lt;br /&gt;
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China&lt;br /&gt;
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi-110021, India&lt;br /&gt;
*RIKEN Plant Science Center (H.N., K.M., A.D., K.S.) and RIKEN Bioinformatics and Systems Engineering Division (Y.Y., T.T.), Tsurumi-ku, Yokohama 230–0045, Japan&lt;br /&gt;
*Institute for Advanced Biosciences, Keio University, Tsuruoka, Yamagata 997–0017, Japan (N.S., M.T., Y.I.)&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Peng Qi, You-Shun Lin, Xian-Jun Song.et al. The novel quantitative trait locus GL3.1 controls rice grain size and yield by regulating Cyclin-T1; 3. Cell Research (2012) 22:1666-1680.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Xiaojun Zhang, Jianfei Wang, Ji Huang, Hongxia Lan, Cailin Wang, Congfei Yin, Yunyu Wu, Haijuan Tang, Qian Qian, Jiayang Li, Hongsheng Zhang. Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice. Proc Natl Acad Sci (2012)52: 21534–21539..&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Amarjeet Singh, Jitender Giri, Sanjay Kapoor, Akhilesh K Tyagi, Girdhar K Pandey .Protein phosphatase complement in rice: genome-wide identification and transcriptional analysis under abiotic stress conditions and reproductive development. BMC Genomics(2010)11: 435.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Hirofumi Nakagami, Naoyuki Sugiyama, Keiichi Mochida, Arsalan Daudi, Yuko Yoshida, Tetsuro Toyoda, Masaru Tomita, Yasushi Ishihama, Ken Shirasu .Large-Scale Comparative Phosphoproteomics Identifies Conserved Phosphorylation Sites in Plant.Plant Physiol(2010) 153(3): 1161–1174&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270794</id>
		<title>Os03g0646900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270794"/>
				<updated>2016-06-23T13:40:06Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;* The rice '''''Os03g0646900''''' was reported as '''''OsGL3.1''''' [1] in 2012 by the researchers from Chinese Academy of Sciences &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. &lt;br /&gt;
== '''One sentence summary''' ==&lt;br /&gt;
* OsGL3.1 encodes a protein phosphatase kelch (PPKL) family — Ser/Thr phosphatase and GL3.1 is a member of the large grain WY3 variety, which is associated with weaker dephosphorylation activity than the small grain FAZ1 variety GL3.1&lt;br /&gt;
&lt;br /&gt;
== '''Annotated Information''' ==&lt;br /&gt;
&lt;br /&gt;
'''2.1 Fine-mapping of a new QTL, GL3.1, which regulates rice grain yield'''&lt;br /&gt;
[[File:fig2.1.jpg|right|thumb|550px|''fig2.1 Map-based cloning of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
* Fengaizhan-1 (FAZ1) and Waiyin-3 (WY3) rice varieties were selected as parents to map the QTLs that affect grain length. FAZ1 is a small grain indica variety (1 000-grain weight: 20.18 ± 0.89 g), whereas WY3 is a larger grain japonica variety (1 000-grain weight: 43.40 ± 0.92 g; Figure 1A). We fine-mapped a new major QTL (GL3.1) for grain length to a 20-kb region between the L012 and L008 markers on chromosome 3 (25 036 192 bp to 25 060 567 bp at chromosome 3) (Figure 1B), which is distinct from other previously reported QTLs [35-38]. This region contains two genes: Os03g44510, which is a predicted transposon that was excluded from further analysis because the transcript was not detected in both parents, and the predicted phosphatase Os03g44500, which was expressed in both parents and considered as the GL3.1 candidate. Based on the mapping results, we developed a nearisogenic line (NIL) from BC4F2 generations that contained a 30-kb WY3 chromosomal region at the GL3.1 locus in a FAZ1 genetic background (Figure 1C; Supplementary information, Figure S1A-S1C). &lt;br /&gt;
* NIL had longer grains (+16.1%) than FAZ1 (10.71 ± 0.13 mm vs 9.22 ± 0.09 mm), but there were no significant differences in grain width or thickness (Figure 1D-1F), plant height or tiller number (Supplementary information, Figure S1DS1E). NIL had a significantly greater 1 000-grain weight than FAZ1 (+43.5%; Figure 1G) and reduced grain number per main panicle (21.3%, Supplementary information, Figure S1F). NIL exhibited an increase in the milk filling rate (Figure 1H-1I) and higher expression of milk filling-related genes (Supplementary information, Figure S1G). The plot grain yield was significantly increased in NIL (+ 11.1%; Figure 1J); however, the grain quality was not affected, as the packing density of starch granules was similar in the mature seeds of NIL and FAZ1 (Supplementary information, Figure S1H-S1I), and the chalky grain percentage and protein and amylose contents were similar between the NIL and FAZ1 grains (Supplementary information, Figure S1J-S1L). &lt;br /&gt;
* We crossed NIL with Huanghuazhan, which is a relatively high-yield elite indica variety that is widely cultivated in Southern China, and subsequently backcrossed the F1 generation with Huanghuazhan to obtain a Huanghuazhan (GL3.1) variety that exhibited a longer and heavier grain (Supplementary information, Figure S2A-S2E) and a higher grain yield than Huanghuazhan under field conditions (Supplementary information, Figure S2F). These findings confirmed that GL3.1 potentially increases grain yield. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''2.2 Confirmation of GL3.1 function'''&lt;br /&gt;
[[File:fig2.2.jpg|right|thumb|150px|''Figure 2.2 Transgenic analysis of GL3.1.(from reference &amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
GL3.1 contains a 3 012-bp open reading frame (ORF) that encodes 21 exons and 20 introns. The FAZ1 GL3.1 allele contains 4-bp differences when compared with the WY3 GL3.1 allele (FAZ1 to WY3: 1092C-A, 1495CT, 2643A-G, 2838T-C), which results in two amino acid substitutions (364 aspartic acid — glutamic acid (364DE), 499 histidine — tyrosine (499H-Y); Figure 2A). We sequenced GL3.1 in several large grain varieties and detected the japonica variety Nanyangzhan with a truncated GL3.1 allele as well as Jizi1560 and Jizi1581, which contained 15 additional amino acids at the C-terminus compared with FAZ1 and WY3. At the positions 364 and 499, Jizi1560 and Jizi1581 exhibited the same amino acid substitutions as WY3 (Supplementary information, Figure S3). Transgenic rice plants were generated to determine whether GL3.1 controls grain length. FAZ1 and WY3 failed to regenerate shoots from the callus, and therefore we used the small-grain japonica variety Zhonghua 11, which was easily regenerated [39]. We generated constructs containing the full-length GL3.1 ORFs from FAZ1 or WY3 under the CaMV 35S promoter. Some of the obtained transgenic lines that overexpressed the WY3 GL3.1 allele showed an increased grain length (GL3.1-WY3), whereas the grain length was not changed in all lines overexpressing the FAZ1 GL3.1 allele (GL3.1-FAZ1; data not shown). Only the GL3.1- WY3 line, which expressed relatively high levels of GL3.1-WY3, exhibited increases in grain length (Figure 2B-2D, Supplementary information, Figure S4A-S4B), which confirms that GL3.1 controls grain length. GL3.1- FAZ1 RNA interference (RNAi) and antisense transgenic plants were generated; however, no phenotypic changes in grain length were observed (data not shown). We also observed that GL3.1 was downregulated but not completely suppressed in these lines; therefore, we hypothesized that these lines retained adequate GL3.1 function, as GL3.1 was abundantly expressed.&lt;br /&gt;
GL3.1 is predicted to encode a Ser/Thr phosphatase of unknown function and with two predicted domains: a Kelch_1 protein interaction domain and a Ser/Thr phosphatase domain (Figure 2A). Transgenic plants were generated to investigate the effect of the GL3.1 point substitutions GL3.1-M1 (364E, 499H) and GL3.1-M2 (364D, 499Y) in FAZ1 and WY3. Both transgenic lines exhibited significant increases in grain length (Supplementary information, Figure S4C-S4H). Similar to the GL3.1-WY3 transgenic lines, only high levels of GL3.1- M1 or GL3.1-M2 overexpression led to enhanced grain length. These results suggest that the 364D-E and 499HY substitutions both influence the function of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.3 GL3.1 functions as a Ser/Thr phosphatase'''&lt;br /&gt;
[[File:fig2.3.jpg|right|thumb|150px|''Figure 3 Expression pattern and molecular function of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
Although some nucleotides were different between the promoters of FAZ1 and WY3, the GL3.1 expression pattern remained similar (Supplementary information, Figure S5). GL3.1 was expressed in all organs and developmental stages tested in FAZ1 and NIL (Supplementary information, Figure S6A-S6C). Notably, expression of GL3.1 was higher in the panicle of NIL at the heading stage than in the panicle of FAZ1 (Figure 3A) and lower in the calluses from FAZ1 and NIL, which primarily con- sist of dividing cells (Supplementary information, Figure S6D). GL3.1 in both parents was detected throughout the entire cell (Figure 3B). Purified GL3.1-FAZ1 and GL3.1- WY3 dephosphorylated myelin basic protein (MyBP; a standard substrate) in vitro, which demonstrates that GL3.1 is a functional Ser/Thr phosphatase (Figure 3C); however, GL3.1-FAZ1 exhibited higher activity than GL3.1-WY3. In addition, GL3.1 from Nanyangzhan (GL3.1-NYZ) did not show dephosphorylation ability (Figure 3C). GL3.1 was insensitive to both okadaic acid (OA) and Inhibitor 2 (Figure 3D), which suggests that GL3.1 may encode a novel type of PPKL, as the PPKL and PP1 enzymes are generally sensitive to Inhibitor 2 [27], whereas the PPKL family member BSU1 is sensitive to OA [32]. Furthermore, we observed that the phosphatase domain of GL3.1 was also not sensitive to these two inhibitors (Supplementary information, Figure S6E). A comparative analysis of phosphatases that are typically sensitive to OA revealed that 929G in GL3.1 conferred resistance to OA (Supplementary information, Figure S7). According to a previous study [40] in rats, PP2Aα is sensitive to OA, but the Y267G mutant of this protein is resistant to OA, which indicates that Y267G is a key mutation for OA resistance. Alignment analysis revealed that 267Y in rat PP2Aα corresponds to 929G in GL3.1, which suggests that GL3.1 harbors a Y to G mutation at this key site that may be responsible for the OA insensitivity of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.4 GL3.1 regulates spikelet hull cell division'''&lt;br /&gt;
[[File:fig2.4.jpg|right|thumb|150px|''Figure 4 GL3.1 alters spikelet hull cell division to regulate grain length. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
We measured the lemma cell length to determine whether GL3.1 regulates grain length. There were no significant differences in cell length at the central point of the lemma in the vertical orientation (Figure 4A-4B, Supplementary information, Figure S6F) and the distance between tubercles at the outer spikelet hull surface (Figure 4C-4D, Supplementary information, Figure S6G), which indicates that cell length is not responsible for the difference in grain length between FAZ1 and NIL. As the FAZ1 and NIL life cycles and heading days are similar, we hypothesized that an increased rate of cell division may be responsible for the longer spikelet hull in NIL. Therefore, we assessed the cell division rate during different developmental stages of the spikelet hull in the two parents. The detection points were set at the stages when the spikelet hull length reached 25%, 50%, 65%, 80% and 100% of the full spikelet hull length in FAZ1 and NIL, and the percentage of cells with 4C DNA content in the spikelet hull as well as the cell lengths at the central zone of the spikelet hull at these points were also recorded (Figure 4E, Supplementary information, Figure S6F). At the five detection points, the cell length in the vertical orientation was not different between FAZ1 and NIL. Notably, at 50% of full spikelet hull length, the percentage of cells with a 4C DNA content was significantly higher in NIL than in FAZ1 (Figure 4E). Consistent with this, the expression of cell cycle-related genes was significantly higher in the NIL than in the FAZ1 spikelet (Figure 4F). Therefore, we propose that rapid cell division occurs in NIL during spikelet hull development. Furthermore, we synchronized cells from FAZ1 and NIL using hydroxycarbamide, which blocks cell division at the G1/S boundary. 8 h after release from hydroxycarbamide, the expression of Histone H4 was maximal in FAZ1 and NIL (Supplementary information, Figure S6H), which suggests that the cells from FAZ1 and NIL had entered the S phase. In addition, a higher percentage of cells with 4C DNA content and a lower percentage of cells in S phase were observed in NIL when compared with FAZ1 (Figure 4G-4I), which implies that more cells from NIL completed DNA duplication. We also observed that the maximal expression of CYCD4;1, which was expressed from early G2 phase to M phase, was earlier in NIL (28 h after release) than in FAZ1 (32 h after release) (Supplementary information, Figure S6I), which implies faster entry into the G2 phase in NIL cells. Furthermore, we synchronized cells from FAZ1 and NIL using nocodazole, which blocks cell division at the G2/M boundary. The expression of CYCD3;1, which is specifically expressed at the G1/S stage, remained the same between FAZ1 and NIL (Supplementary information, Figure S6J), which implies that the transformation from the G2 phase to G1 phase was not different between the two parents. These results suggest that the transformation from G1 to G2 may be accelerated in NIL. Thus, our results collectively demonstrate that the GL3.1-WY3 allele increases the rate of cell division during spikelet hull development compared with the GL3.1-FAZ1 allele, which results in a longer spikelet hull. &lt;br /&gt;
&lt;br /&gt;
'''2.5 GL3.1 interacts with Cyclin-T1;3 to regulate grain length'''&lt;br /&gt;
[[File:fig2.5.jpg|right|thumb|150px|''Figure5 GL3.1 and Cyclin-T13 interact(from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
To determine the mechanism underlying the GL3.1- mediated regulation of grain size, a yeast two-hybrid system was used to screen a cDNA library constructed from Zhonghua 11 spikelets using GL3.1-FAZ1 as bait. We identified 23 interacting proteins, of which Os11g05850, annotated as Cyclin-T1;3, was selected for further analysis (Figure 5A). The expression of Cyclin-T1;3 was localized to the nucleus of Arabidopsis protoplasts (Figure 5B), which was consistent with the expression pattern observed in humans. When GL3.1 was co-expressed with Cyclin-T1;3, increased accumulation of GL3.1 was observed in the nuclei from both parents when compared with expression without Cyclin-T1;3 (Figures 5C and 3B). We confirmed that GL3.1 dephosphorylated Cyclin-T1;3 in vitro. GL3.1-FAZ1 exhibited stronger Cyclin-T1;3 dephosphorylation activity than GL3.1- WY3, GL3.1-M1 and GL3.1-M2 (Figure 5D), which was consistent with the effects observed for the common substrate MyBP (Figure 3C). As the kelch-repeat domain has demonstrated potential for protein interactions [41], we used a bimolecular fluorescence complementation (BiFC) assay to identify such interactions. GL3.1ΔP, which contains a kelch-repeat domain, interacted with Cyclin-T1;3 in the absence of the GL3.1 Ser/Thr phosphatase domain (Figure 5E). In addition, Cyclin-T1;3 was constitutively expressed in various tissues and organs in a pattern similar to that of GL3.1 (Supplementary information, Figure S8A-S8D). These results demonstrate that Cyclin-T1;3 interacts with GL3.1 and is dephosphorylated through GL3.1. &lt;br /&gt;
Real-time PCR was performed to analyze the expression of Cyclin-T1;3 after cell synchronization. In contrast to the high expression levels observed at 16 h and 32 h in FAZ1 cells, Cyclin-T1;3 showed increased expression at 8 h and 28 h in NIL cells (Figure 5F). At these two specific points, the cells were entering the S and G2 phases, respectively, which indicates that Cyclin-T1;3 may be involved in cell cycle control. Moreover, we used transgenic rice plants to determine whether Cyclin-T1;3 influences grain size. No obvious phenotype was observed when we overexpressed Cyclin-T1;3 in Zhonghua 11. However, antisense strands of Cyclin-T1;3 resulted in smaller grain sizes in the transgenic plants as well as reduced expression of CyclinT1;3 (Figure 5G-5I). Thus, our data indicate that Cyclin-T1;3 is involved in the GL3.1-mediated regulation of grain length.&lt;br /&gt;
&lt;br /&gt;
'''2.6 GL3.1 is a widespread gene that influences protein phosphorylation in vivo'''&lt;br /&gt;
[[File:fig2.6.jpg|right|thumb|150px|''Figure 6 GL3.1 influences protein phosphorylation status as a potential model for grain size control. (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
A quantitative proteomic analysis using two-dimensional difference gel electrophoresis (2-D DIGE) indicated that 21 proteins were differentially expressed in FAZ1 and NIL, of which 18 were upregulated in NIL (Supplementary information, Table S1). Mass spectrometry revealed that the 21 proteins were associated with cellular metabolic processes. Interestingly, actin was upregulated in NIL, which is consistent with the observation that GL3.1 influences the rate of cell proliferation. The phosphopeptides from the young spikelets of FAZ1 and NIL were enriched on the TiO2 beads and quantified using iTRAQ, which confirmed that GL3.1 is a phosphatase. 556 phosphopeptides were detected, and 464 of these molecules were quantified. Proteins showing a 1.5- fold difference between FAZ1 and NIL and demonstrating the same trend when quantified using two different labelling systems were chosen for further analysis. At least 130 proteins demonstrated a different phosphorylation status between FAZ1 and NIL during spikelet development (Figure 6A and Supplementary information, Table S2). Gene ontology analysis revealed that these proteins are primarily involved in processes related to nucleic acid metabolism and protein complex assembly (Figure 6B and Supplementary information, Table S3). The molecular functions of these proteins include nucleotide binding and the activities of phosphotransferases, helicases and the RNA polymerase II transcription factor. These results strongly suggest that GL3.1 could influence DNA duplication. Thus, we propose that GL3.1 regulates the expression and phosphorylation of a variety of genes involved in metabolism and cell division. Further phylogenetic analyzes based on genomic BLAST searches demonstrated the widespread existence of GL3.1 in plants (Supplementary information, Figure S9), which suggests that GL3.1 has an important conserved function in plants.&lt;br /&gt;
&lt;br /&gt;
== Knoledge Extension ==&lt;br /&gt;
&lt;br /&gt;
== Labs working on this gene ==&lt;br /&gt;
*Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China&lt;br /&gt;
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China&lt;br /&gt;
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi-110021, India&lt;br /&gt;
*RIKEN Plant Science Center (H.N., K.M., A.D., K.S.) and RIKEN Bioinformatics and Systems Engineering Division (Y.Y., T.T.), Tsurumi-ku, Yokohama 230–0045, Japan&lt;br /&gt;
*Institute for Advanced Biosciences, Keio University, Tsuruoka, Yamagata 997–0017, Japan (N.S., M.T., Y.I.)&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Peng Qi, You-Shun Lin, Xian-Jun Song.et al. The novel quantitative trait locus GL3.1 controls rice grain size and yield by regulating Cyclin-T1; 3. Cell Research (2012) 22:1666-1680.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Xiaojun Zhang, Jianfei Wang, Ji Huang, Hongxia Lan, Cailin Wang, Congfei Yin, Yunyu Wu, Haijuan Tang, Qian Qian, Jiayang Li, Hongsheng Zhang. Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice. Proc Natl Acad Sci (2012)52: 21534–21539..&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Amarjeet Singh, Jitender Giri, Sanjay Kapoor, Akhilesh K Tyagi, Girdhar K Pandey .Protein phosphatase complement in rice: genome-wide identification and transcriptional analysis under abiotic stress conditions and reproductive development. BMC Genomics(2010)11: 435.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Hirofumi Nakagami, Naoyuki Sugiyama, Keiichi Mochida, Arsalan Daudi, Yuko Yoshida, Tetsuro Toyoda, Masaru Tomita, Yasushi Ishihama, Ken Shirasu .Large-Scale Comparative Phosphoproteomics Identifies Conserved Phosphorylation Sites in Plant.Plant Physiol(2010) 153(3): 1161–1174&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270793</id>
		<title>Os09g0441900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270793"/>
				<updated>2016-06-23T13:38:55Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os09g0441900''''' was first identified as '''''OsDEP1''''' (DENSE AND ERECT PANICLE1) respectively in 2009 by the researchers from Chinese Academy of Sciences &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
*Natural variation at the ''DEP1'' locus enhances grain yield in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.The rice DEP1 (DENSE AND ERECT PANICLE 1) locus was first identified by two independent research groups with quantitative trait loci analysis to control grain yield, grain numbers per panicle, and panicle morphology.Deletion of the DEP1 gene during rice domestication was proposed to enhance meristematic activity and result in reduced inflorescence internode lengths that thereby increased grain numbers per panicle and, consequently, grain yields.''DEP1'' regulates nitrogen uptake and metabolism and participates in determining the amount and direction of cell division,which in turn controls organ size and shape.It has been suggested to encode a plant-specific G protein γ subunit.The DEP1 protein interacts in vivo with both the Gα(RGA1)and Gβ(RGB1)subunits,and reduced RGA1 or enhanced RGB1 activity inhibits nitrogen responses.The plant G protein complex regulates nitrogen signaling and modulation of heterotrimeric G protein activity provides a strategy for environmentally sustainable increases in rice grain yield&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:cd tolerance.jpg|right|thumb|300px|'''Figure 1.''' ''Impact of the C-terminal half of OsDEP1 on yeast Cd tolerance(from reference&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''OsDEP1'' encoded a highly cysteine (Cys)-rich G protein γ subunit composed of 426 aa,which was initially identified as it conferred cadmium (Cd) tolerance on yeast cells. Of the 426 aa constituting OsDEP1, 120 are Cys residues (28.2%), of which 88 are clustered in the C-terminal half region (aa 170-426).The OsDEP1(170–426) region is necessary and sufficient to confer cadmium (Cd)tolerance on host yeast cells(Figure 1).The Cd responses of transgenic  Arabidopsis plants constitutively expressing OsDEP1,OsDEP1(1–169) or OsDEP1(170–426),were similar to the observations in yeast cells, with  OsDEP1  and OsDEP1(170–426) transgenic plants displaying Cd tolerance but OsDEP1(1–169) plants showing no such tolerance&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.Cadmium (Cd) is one of the transition metals that is nonessential for almost all living organisms. It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups, thereby inhibiting their growth and development. Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn, Fe, and Ca, of enzymes, signalling intermediates, and transcription factors, especially the zinc-finger type.&lt;br /&gt;
*Arabidopsis AGG3, a DEP1 homologue, was identified as an Arabidopsis heterotrimeric GTP-binding protein (G protein) γ subunit.Unlike the complex mammalian system, Arabidopsis has only one α (GPA1), one β (AGB1), and three γ (AGG1, AGG2, and AGG3) subunits as components of the heterotrimeric G protein system. OsDEP1 is identified as a cDNA clone that confers Cd tolerance to yeast cells. The gene product, OsDEP1, is highly Cys-rich and is a component of the heterotrimeric G protein signalling pathway.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''GO assignment(s):''' GO:0005882&lt;br /&gt;
&lt;br /&gt;
*DEP1 (Dense and Erect Panicle1) gene encodes an unknown protein containing the PEBP (phosphatidylethanolamine-binding protein) domain which share some homology with the N terminus of GS3.DEP1 is pleiotropically responsible for all three traits: dense panicle, high grain number per panicle and erect panicle. In the case of the rice plant, more tillering equates to more grain-bearing branches. Rice branching determines the number of panicle and grain number per panicle ,and then control the grain yield.We can see the rice tillering at (Figure 6). &lt;br /&gt;
[[File:The tillering of rice.jpg|right|thumb|300px|'''Figure 6.''' ''The tillering of rice.'']]]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''dep1'' confers an increased number of grains per panicle (and a consequent increase in grain yield).Figure 2 shows the ''DEP1'' and ''dep1'' NIL line field performance.(a) Dense and erect panicle.(b)Increased panicle branching and reduced rachis length. (c)Grain number per main panicle was significantly higher in the presence of ''dep1''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:The tillering of rice. .jpg|right|thumb|300px|'''Figure 7.''' ''The tillering of rice(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*The ''dep1-1'' and ''dep1-32'' alleles exhibit insensitive growth to nitrogen input level(Figure 3)&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
* dep1 is the mutant DEP1 allele.The variant involves the replacement of a 637-bp stretch of the middle of exon 5 by 12-bp sequence,which has the effect of creatig a premature stop codon and consequently a loss of 230 residues from C termimus.As showed in (Figure 7)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*DEP1 acts as a dominant negative regulator of panicle architecture ad grain number.The near isogenic lines(NILs) carrying a mutated DEP1 (NIL-dep1) exhibit increased number of grain per panicle,shorter infloresence internodes, increased number of both primary and secondary panicle branches,which may result from the enhanced meristematic activity and cell proliferation through regulating OsCKX2&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;(Fig 8. a).&lt;br /&gt;
*But they do not exhibit noticeable change in panical architecture. The experiments are taken as the following several aspects[2]. Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 8.b,c). Close examination of the shoot apex meristem (SAM) showed that the SAM of NIL-dep1 plants was larger than that of NIL-DEP1 plants (Fig 8. 2d). Cells in the uppermost internode of the mature NIL-dep1 culm were shorter than those in NIL-DEP1 plants (Fig 8. 2e). At the same time, cell number across the longitudinal axis of NIL-dep1 plants was higher than in NIL-DEP1 plants (Fig 8. 2f). Taken together, these observations suggest that the dep1 allele enhances meristematic activity and promotes cell proliferation. So dep1 allele enhances meristematic activity and promotes cell proliferation. &lt;br /&gt;
*The activity of axillary meristem in the shoot apex is important for the determination of the extent of panicle branching and hence grain number&amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref15&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref16&amp;quot; /&amp;gt;. In NIL-dep1 plants, the Gn1a was clearly downregulated.Gn1a, a major grain number QTL, encodes a cytokinin oxidase/ dehydrogenase, and has been implicated in the regulation of meristematic activity, panicle branching and grain number through its effect on the level of cytokinin. ANIL-Gn1a line had the same number of primary branches as the control line but developed more secondary branches[6,7]. This suggests that dep1 genetically controls the number of both primary branches and secondary branches on primary branches at the panicle top, whereas Gn1a regulates the number of secondary branches on primary branches at the panicle base.&lt;br /&gt;
*Preparing the field performation of DEP1 and dep1, the grain number per mian panicle is higher in the presence of dep1 (Fig 9.c) and there are clear differences in panicle architecture, influorescence internode and panicle length (Fig 9.b,e), and the number of both primary (Fig 4.b,f)and secondary (Fig 4.g) branches per panicle.Furthermore,he grain-weight of NIL-dep1 plants was slightly less than that of NIL-DEP1 plants (Fig 9.h),but the overall grain yield per plant under field conditions was increased(+40.9%) (Fig 9.I).The evidence of grain-fillinf failure in the presence of dep1 is unclear.The vascular system of NIL-dep1 plants appeared rather better developed and their sclerenchyma cell walls were thicker at maturity than those in NIL-DEP1 plants. These traits are favorable for both water transport capacity and the mechanical strength of the stem, both of which are important factors for the breeding of high-yielding, lodging-resistant varieties. Through testing the effect of dep1 on grain yield in an indica background by backcrossing the dep1 segment present in the japonica variety Wuyunjing 7 into the indica variety Zhefu 802. This NIL, ZF 802 (dep1), produced more grains per panicle and out-yielded its recurrent parent. Thus, dep1 is a useful allele for increasing grain yield in rice.&lt;br /&gt;
&lt;br /&gt;
[[File:DEP1 expression and its effect on cell proliferation.jpg|right|thumb|300px|'''Figure 8.''' ''DEP1 expression and its effect on cell proliferation(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
[[File:The phenotype of NIL-dep1 plants.jpg|right|thumb|300px|'''Figure 9.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:DEP expression2.jpg|right|thumb|300px|'''Figure 4.''' ''The expression profile of DEP1 during spikelet development (from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*During reproductive development,''DEP1'' was preferentially expressed on the adaxial side of the bract primordium,as well as in the bract primordia of primary and secondary rachis-branches. Within the inflorescence meristem,''DEP1'' was expressed weakly in the carpel and stamen primordia, with patchy expression in the lemma and palea(Figure 4)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 3.b,c)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*''DEP1'' transcript abundance was positively induced by the level of nitrogen supplied&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Cellular Location===&lt;br /&gt;
RGB1-GFP, DEP1-GFP,and dep1-1–GFP fusion proteins were detected both on the plasma membrane and within the nucleus of transgenic rice root cells&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Evolution==&lt;br /&gt;
*Pedigree records show that many high-yielding Chinese japonica varieties, including Shennong 265, were derived from the Italian land race Balilla13,15, which was extensively cultivated in Italy in the 1970s and introduced into China in 1958&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
Genetic diversity analysis suggests that ''DEP1'' has been subjected to artificial selection during ''Oryza sativa'' spp.''japonica'' rice domestication&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
*The allelic constitution at the DEP1 locus was explored by resequencing from a panel of widely cultivated Chinese varieties (69 japonica and 83 indica)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.This truncated mutation was present in Balilla and all 36 japonica types having an erect or semierect panicle, including super high-yielding cultivars Liaojing 5 and Qianchonglang,but it was absent from all the other varieties. Thus, this natural allelic variation in DEP1 has clearly been exploited by japonica breeding programs in China.Several sequence variants at the DEP1 C terminus were present in the sample of indica types. The variety 93-11 differed from the japonica variety Nipponbare by three amino acids, whereas that of the variety Teqing differed by two amino acids. The Nipponbare sequence differed from that of an accession of Oryza rufipogon by one nucleotide at position 663, but this did not produce a variant peptide. We investigated the structure of the homologs of DEP1 in other smallgrain cereals&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. Several truncated C-terminal deletions were observed in barley, and in bread wheat and its diploid wild progenitor Triticum urartu. To determine whether any novel gain-of-function was induced by the presence of these truncated genes, we generated a number of transgenic wheat plants carrying a pUbi:RNAi-TaDEP1 construct. The consequent downregulation of TaDEP1 resulted in an increase in the length of the ear, a less compact ear and a somewhat reduced number of spikelets. This suggests that a functionally equivalent mutation may have occurred early in the divergence of the wheat and barley lineages.&lt;br /&gt;
&lt;br /&gt;
==Extension==&lt;br /&gt;
[[File:reponses to Cd.jpg|right|thumb|300px|'''Figure 5.''' ''Plant responses to Cd stress (from reference&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Heterotrimeric_G_proteins Heterotrimeric G proteins] are multisubunit, integral membrane signal-transduction complexes that mediate intracellular responses to external stimuli in diverse eukaryotic organisms&amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.G proteins typically consist of α, β and γ subunits&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;.Gβγ acts as a functional monomer,and Gβ-mediated processes require a γ subunit&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;.&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Cadmium Cadmium] (Cd)is one of the transition metals that is non-essential for almost all living organisms.It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups,thereby inhibiting their growth and development.Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn,Fe,and Ca, of enzymes,signalling intermediates,and transcription factors,especially the zinc-finger type&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. To cope with Cd toxicity effects,plants are known to be equipped with the potential to chelate and extrude Cd,to sequester Cd into vacuoles, and to dissipate reactive oxygen species triggered by Cd(Figure 5)&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.For the chelation of heavy metals, including Cd,various cysteine (Cys)-rich proteins are employed by plants.Small Cys-rich peptides,called metallothioneins (MTs),are the major chelators of Cd&amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Comparison of OsDEP1 and other Cys-rich proteins involved in Cd tolerance:Several other studies have previously identified Cys-rich proteins that can provide enhanced tolerance to Cd toxicity. DcCDT1 from D. ciliaris is a 55 aa peptide of which 15 residues (27%) are Cys. The protein is localized to the cytoplasmic membrane and appears to function in the chelation and possible extrusion of Cd, as transgenic DcCDT1 plants accumulate considerably less Cd than controls.Considering that OsDEP1 is a Gγ subunit, it is likely that it is localized to the inside of cytoplasmic membranes, whereas DcCDT1 may be oriented to the outside of the cytoplasmic membrane. Such a possibility would explain the observed differences in Cd uptake between the DcCDT1- and OsDEP1-expressing transgenic plants.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
*The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China.&lt;br /&gt;
*The State Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, China.&lt;br /&gt;
*Institute of Technical Biology and Agriculture Engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences, Hefei, China.&lt;br /&gt;
*The State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, China.&lt;br /&gt;
*Graduate School of Life Sciences, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi 980-8577, Japan.&lt;br /&gt;
*National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.&lt;br /&gt;
*Faculty of Bioresource Sciences, Akita Prefectural University, 241-7 Kaidobata Nishi, Akita 010-1095, Japan.&lt;br /&gt;
*Biodiversity and Climate Research Center (BiK-F), D-60323 Frankfurt, Germany.&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Huang X, Qian Q, Liu Z, et al. Natural variation at the ''DEP1'' locus enhances grain yield in rice[J]. Nature genetics, 2009, 41(4): 494-497.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sun H, Qian Q, Wu K, et al. Heterotrimeric G proteins regulate nitrogen-use efficiency in rice[J]. Nature genetics, 2014.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt; Kunihiro S, Saito T, Matsuda T, et al. Rice ''DEP1'', encoding a highly cysteine-rich G protein γ subunit, confers cadmium tolerance on yeast cells and plants[J]. Journal of experimental botany, 2013, 64(14): 4517-4527.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;DalCorso G, Farinati S, Maistri S, et al. How plants cope with cadmium: staking all on metabolism and gene expression[J]. Journal of integrative plant biology, 2008, 50(10): 1268-1280.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;New D C, Wong J T Y. The evidence for G-protein-coupled receptors and heterotrimeric G proteins in protozoa and ancestral metazoa[J]. Neurosignals, 1998, 7(2): 98-108.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Perfus-Barbeoch L, Jones A M, Assmann S M. Plant heterotrimeric G protein function: insights from ''Arabidopsis'' and rice mutants[J]. Current opinion in plant biology, 2004, 7(6): 719-731.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Jones J C, Duffy J W, Machius M, et al. The crystal structure of a self-activating G protein α subunit reveals its distinct mechanism of signal initiation[J]. Science signaling, 2011, 4(159): ra8.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Ford C E, Skiba N P, Bae H, et al. Molecular basis for interactions of G protein βγ subunits with effectors[J]. Science, 1998, 280(5367): 1271-1274.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Ullah H, Chen J G, Young J C, et al. Modulation of cell proliferation by heterotrimeric G protein in ''Arabidopsis''[J]. Science, 2001, 292(5524): 2066-2069.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Trusov Y, Rookes J E, Tilbrook K, et al. Heterotrimeric G protein γ subunits provide functional selectivity in Gβγ dimer signaling in ''Arabidopsis''[J]. The Plant Cell Online, 2007, 19(4): 1235-1250.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Verbruggen N, Hermans C, Schat H. Mechanisms to cope with arsenic or cadmium excess in plants[J]. Current opinion in plant biology, 2009, 12(3): 364-372.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt; Ecker D J, Butt T R, Sternberg E J, et al. Yeast metallothionein function in metal ion detoxification[J]. Journal of Biological Chemistry, 1986, 261(36): 16895-16900.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Freisinger E. Plant MTs—long neglected members of the metallothionein superfamily[J]. Dalton Transactions, 2008 (47): 6663-6675.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Rao, N.N., Prasad, K., Kumar, P.R. &amp;amp; Vijayraghavan, U. Distinct regulatory role for RFL,the rice LFY homolog, in determining flowering time and plant architecture[J]. Proc. Natl. Acad. Sci. USA 105, 3646–3651 (2008).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref15&amp;quot;&amp;gt;Kellogg, E.A. Floral displays: genetic control of grass inflorescences[J]. Curr. Opin. Plant Biol. 10, 26–31 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref16&amp;quot;&amp;gt;Kurakawa, T. et al. Direct control of shoot meristem activity by a cytokinin activating enzyme[J]. Nature 445, 652–655 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os09g0441900|&lt;br /&gt;
Description = Whey acidic protein, core region domain containing protein|&lt;br /&gt;
Version = NM_001069822.1 GI:115479386 GeneID:4347178|&lt;br /&gt;
Length = 4701 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os09g0441900, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|&lt;br /&gt;
AP = Chromosome 9:17064862..17069562|&lt;br /&gt;
CDS = 17065265..17065393,17066606..17066664,17067820..17067864,17067951..17067995,17068411..17069413&amp;lt;br&amp;gt;|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagataaatgagtttgttggtacaaaacatgacccactaataccaacaaagagaaggaggcacagatcttgccgtctttttcggtggatcggatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKD                     ELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICISC                     LCYCCKCSPKCKRPRCLNCSCSSCCDEPCCKPNCSACCAGSCCSPDCCSCCKPNCSCC                     KTPSCCKPNCSCSCPSCSSCCDTSCCKPSCTCFNIFSCFKSLYSCFKIPSCFKSQCNC                     SSPNCCTCTLPSCSCKGCACPSCGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGC                     GSCSCAQCKPDCGSCSTNCCSCKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCS                     CAGCCSSLCKCPCTTQCFSCQSSCCKRQPSCCKCQSSCCEGQPSCCEGHCCSLPKPSC                     PECSCGCVWSCKNCTEGCRCPRCRNPCCLSGCLC&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;404..532#1745..1803#2959..3003#3090..3134#3550..4552#tctcttccctctctctctttctctctccaaaccccacgcacgccgcgtcgccgcctcctcctctccatctccgctgctattattgcccgcgcagacgcaggccaccatccttcctctcgctcacgctcgctgctatatgggggtcctcctcatcgcatcgcatcgcatcacctcgcacgggcgcgcgcgccgtgccgtgccgctagctcgatccgcctcgtacgccagctcgctcgctcgctcccccaccccgctgctgcacggctgcgcccgcgctgtcccctgtccccccgctcgccgcggcgatttatacccaccacgccccctgctgctgctataatgcccatgagtgaaggcggcgaggggtggttctgagttggccgttggcgtgctgcgtgtggagatgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggtgagcgccccgcggcggcggcggctgcgtttttctctataggtttctctttcacactcgctcgctcgaaattctcggggcccgagctctacttgcttcgtcttcctttgactttaccgattaattttaaaaaaaaggagatccgattcgccgcgcatttttcaaaacccaagcggccgagtacggagctacccgctactgcaagtaggatgctgtgaagtgtacagtaatggcgttgttaattgcggtagctagtgctattctagtacttgtagtactgtttctaggcggaggtgaatcacggcgccatcaatccgaggctggcgagacaagcttggccctctttgggcgtggcgccatggctgtactacctttgtcgttgtttggttgggctcctcgttggagaaaagaagagcgtgggcatggacaactgacctgagtggccttgtcagggagagccatagcagtggacgtgtctatctccgccattgcttcgtcgacactggacgtgcagacggcatggccatgagggctttgcacgatgggtggtgccgtgttggtgttatgggctgccaccatggtttgaggcttttgatgttgctagattttgtgtttaacgagggagggaagaatgtgttgttcttgacactgtgctgtgcttttaaggagcagagatttcagaagctcttcagatatcagagaacttctttgtagtagtaatcaaatgcgctttagacatctttttatcgtttcttgcaaggtcagtccctgctttggtacccgatctcgcttttgtgcaacatcaaagttacacttacacagtaaagcaggaatctttatgggaccgttcgtactggtcaattactccaggctttgattaatgggttttaagttttaaccgcagatttggtacaagtaacaacctttatttactttttatttctgcaactgtgtcttttaacatgaaagaatccagctccattcaaaagtttagtttttattttccattgtggtgcatggtcactcagcctgcagtactgaattatcaaaattttcttttgtcatttctctcatgttaagtgcatagtctattttacttcaacaggtagaaaaacttttgtgggtttgtttctagctcaaggaggaaattcatgggtttgcatctagcacatgagagaacaatattggtctaacacaaagctccttttgtaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagtatgtactactgcccttcatgcattacagatattttgtttttaagtttttagaaatttgaagagcttatgtcaagtatgaaatgtcagcttaattttattgctgtccttatctaatgtcttatgctctgttttataaaatttggttgcattttctcccccagggaaaaatcttgtataagtgtgttatgtacttatgtgtataaaatcttgttgcacttgtatgtcacacttaggccctgtttagatcctccaaaatggcagtttgccattttgaagaaccttttgccattttggatctaaacactagtaacaaaacttggcaatttggcatttggcatttgctagtctatagtagcaaattgtgccaaaaagtgctttggaaccactctctctttctttctctctctcactttagtgctagaatggtaaaagtttaggatgcatctaaacaccaactagtacttttacaatactaaaacttttgccaccaaaacttttgccatttgccatttgctatttcaaatggatctaaacagggccttagcaaatcaccatatgttaaaattaccttgggatgaaaaagaaaaaggaaaccagcattgaagtcttgtttgaaatgcatatgtacttgtaccattacagaaattcttaaaactgctgtcttgacagctacttatcaaacagccccacctgcatcataacgttcctagtggtgcctataactctgcctcagttattattttgtggcccactggtccaacaatttgaaaaaaattatattgaactaaatatattgaacagtagtatgacgtcctctttgcttgagttccatattacagctcacagtcctgagatttgtttcaccgattctttccatgcgatgtgcacatattcttattcaatttaaaaaatgaaagcagattatttttaacaagtaacctatcacgttagcttaacattgtatatttgtggtggaattatgtaatattccgatatcgcatttgaagttttgaacatgtgtgctcaaattgagggacacatgactgtagtgaaagcaaatataaatgtctgagcaatggactatactttgtattcattactacaagttatgtccttttgcaggttgctaatgtcctcttacattacttgtcaggataaatgagtttgttggtacaaaacatgacccactaataccaacgtatggcctctaaactttcagttcccccattttaagcatgttcgctgtttatttacgagttttgacattgttttttccttttccagaaagagaaggaggcacagatcttgccgtctttttcggtggatcgggtatgttttgatccaatatagtttgctcgcaggttctgaggggcaagaacattcaaatatctataatgttttctgttggattcaacattcatcactatttccctcgaaaaaaaagcattcgtcactattggaattgaaagtctgaaagtgcctctagtccctttgtatgttaaaagtcaataaacaagcagtagttttctatatgccacattaatattattgacgcattttaaaaagcaaactagtccagggatgtaatcatctttgttatctaaaactaaaaaaggaaaaactagtgcttttttacattaacattgatttttttgcggctgaaattacatgtagaaactttggcataataatctgtactactgccaaactgagcttttacatggtgaaaatattttccctgcagatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttgatctagatccttttttggttgttgtttttcttgtattttttagttgttaggcctttgattaagttcgaactttcataaatatatggtgtttatcctgtaaagaaatgatgatttcaaggatttttcatagctatgagacgaggttgaacc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069822.1 RefSeq:Os09g0441900]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 9]]&lt;br /&gt;
[[Category:Chromosome 9]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270792</id>
		<title>Os09g0441900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270792"/>
				<updated>2016-06-23T13:30:38Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os09g0441900''''' was first identified as '''''OsDEP1''''' (DENSE AND ERECT PANICLE1) respectively in 2009 by researchers from Chinese Academy of Sciences &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
*Natural variation at the ''DEP1'' locus enhances grain yield in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.The rice DEP1 (DENSE AND ERECT PANICLE 1) locus was first identified by two independent research groups with quantitative trait loci analysis to control grain yield, grain numbers per panicle, and panicle morphology.Deletion of the DEP1 gene during rice domestication was proposed to enhance meristematic activity and result in reduced inflorescence internode lengths that thereby increased grain numbers per panicle and, consequently, grain yields.''DEP1'' regulates nitrogen uptake and metabolism and participates in determining the amount and direction of cell division,which in turn controls organ size and shape.It has been suggested to encode a plant-specific G protein γ subunit.The DEP1 protein interacts in vivo with both the Gα(RGA1)and Gβ(RGB1)subunits,and reduced RGA1 or enhanced RGB1 activity inhibits nitrogen responses.The plant G protein complex regulates nitrogen signaling and modulation of heterotrimeric G protein activity provides a strategy for environmentally sustainable increases in rice grain yield&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:cd tolerance.jpg|right|thumb|300px|'''Figure 1.''' ''Impact of the C-terminal half of OsDEP1 on yeast Cd tolerance(from reference&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''OsDEP1'' encoded a highly cysteine (Cys)-rich G protein γ subunit composed of 426 aa,which was initially identified as it conferred cadmium (Cd) tolerance on yeast cells. Of the 426 aa constituting OsDEP1, 120 are Cys residues (28.2%), of which 88 are clustered in the C-terminal half region (aa 170-426).The OsDEP1(170–426) region is necessary and sufficient to confer cadmium (Cd)tolerance on host yeast cells(Figure 1).The Cd responses of transgenic  Arabidopsis plants constitutively expressing OsDEP1,OsDEP1(1–169) or OsDEP1(170–426),were similar to the observations in yeast cells, with  OsDEP1  and OsDEP1(170–426) transgenic plants displaying Cd tolerance but OsDEP1(1–169) plants showing no such tolerance&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.Cadmium (Cd) is one of the transition metals that is nonessential for almost all living organisms. It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups, thereby inhibiting their growth and development. Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn, Fe, and Ca, of enzymes, signalling intermediates, and transcription factors, especially the zinc-finger type.&lt;br /&gt;
*Arabidopsis AGG3, a DEP1 homologue, was identified as an Arabidopsis heterotrimeric GTP-binding protein (G protein) γ subunit.Unlike the complex mammalian system, Arabidopsis has only one α (GPA1), one β (AGB1), and three γ (AGG1, AGG2, and AGG3) subunits as components of the heterotrimeric G protein system. OsDEP1 is identified as a cDNA clone that confers Cd tolerance to yeast cells. The gene product, OsDEP1, is highly Cys-rich and is a component of the heterotrimeric G protein signalling pathway.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''GO assignment(s):''' GO:0005882&lt;br /&gt;
&lt;br /&gt;
*DEP1 (Dense and Erect Panicle1) gene encodes an unknown protein containing the PEBP (phosphatidylethanolamine-binding protein) domain which share some homology with the N terminus of GS3.DEP1 is pleiotropically responsible for all three traits: dense panicle, high grain number per panicle and erect panicle. In the case of the rice plant, more tillering equates to more grain-bearing branches. Rice branching determines the number of panicle and grain number per panicle ,and then control the grain yield.We can see the rice tillering at (Figure 6). &lt;br /&gt;
[[File:The tillering of rice.jpg|right|thumb|300px|'''Figure 6.''' ''The tillering of rice.'']]]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''dep1'' confers an increased number of grains per panicle (and a consequent increase in grain yield).Figure 2 shows the ''DEP1'' and ''dep1'' NIL line field performance.(a) Dense and erect panicle.(b)Increased panicle branching and reduced rachis length. (c)Grain number per main panicle was significantly higher in the presence of ''dep1''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:The tillering of rice. .jpg|right|thumb|300px|'''Figure 7.''' ''The tillering of rice(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*The ''dep1-1'' and ''dep1-32'' alleles exhibit insensitive growth to nitrogen input level(Figure 3)&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
* dep1 is the mutant DEP1 allele.The variant involves the replacement of a 637-bp stretch of the middle of exon 5 by 12-bp sequence,which has the effect of creatig a premature stop codon and consequently a loss of 230 residues from C termimus.As showed in (Figure 7)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*DEP1 acts as a dominant negative regulator of panicle architecture ad grain number.The near isogenic lines(NILs) carrying a mutated DEP1 (NIL-dep1) exhibit increased number of grain per panicle,shorter infloresence internodes, increased number of both primary and secondary panicle branches,which may result from the enhanced meristematic activity and cell proliferation through regulating OsCKX2&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;(Fig 8. a).&lt;br /&gt;
*But they do not exhibit noticeable change in panical architecture. The experiments are taken as the following several aspects[2]. Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 8.b,c). Close examination of the shoot apex meristem (SAM) showed that the SAM of NIL-dep1 plants was larger than that of NIL-DEP1 plants (Fig 8. 2d). Cells in the uppermost internode of the mature NIL-dep1 culm were shorter than those in NIL-DEP1 plants (Fig 8. 2e). At the same time, cell number across the longitudinal axis of NIL-dep1 plants was higher than in NIL-DEP1 plants (Fig 8. 2f). Taken together, these observations suggest that the dep1 allele enhances meristematic activity and promotes cell proliferation. So dep1 allele enhances meristematic activity and promotes cell proliferation. &lt;br /&gt;
*The activity of axillary meristem in the shoot apex is important for the determination of the extent of panicle branching and hence grain number&amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref15&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref16&amp;quot; /&amp;gt;. In NIL-dep1 plants, the Gn1a was clearly downregulated.Gn1a, a major grain number QTL, encodes a cytokinin oxidase/ dehydrogenase, and has been implicated in the regulation of meristematic activity, panicle branching and grain number through its effect on the level of cytokinin. ANIL-Gn1a line had the same number of primary branches as the control line but developed more secondary branches[6,7]. This suggests that dep1 genetically controls the number of both primary branches and secondary branches on primary branches at the panicle top, whereas Gn1a regulates the number of secondary branches on primary branches at the panicle base.&lt;br /&gt;
*Preparing the field performation of DEP1 and dep1, the grain number per mian panicle is higher in the presence of dep1 (Fig 9.c) and there are clear differences in panicle architecture, influorescence internode and panicle length (Fig 9.b,e), and the number of both primary (Fig 4.b,f)and secondary (Fig 4.g) branches per panicle.Furthermore,he grain-weight of NIL-dep1 plants was slightly less than that of NIL-DEP1 plants (Fig 9.h),but the overall grain yield per plant under field conditions was increased(+40.9%) (Fig 9.I).The evidence of grain-fillinf failure in the presence of dep1 is unclear.The vascular system of NIL-dep1 plants appeared rather better developed and their sclerenchyma cell walls were thicker at maturity than those in NIL-DEP1 plants. These traits are favorable for both water transport capacity and the mechanical strength of the stem, both of which are important factors for the breeding of high-yielding, lodging-resistant varieties. Through testing the effect of dep1 on grain yield in an indica background by backcrossing the dep1 segment present in the japonica variety Wuyunjing 7 into the indica variety Zhefu 802. This NIL, ZF 802 (dep1), produced more grains per panicle and out-yielded its recurrent parent. Thus, dep1 is a useful allele for increasing grain yield in rice.&lt;br /&gt;
&lt;br /&gt;
[[File:DEP1 expression and its effect on cell proliferation.jpg|right|thumb|300px|'''Figure 8.''' ''DEP1 expression and its effect on cell proliferation(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
[[File:The phenotype of NIL-dep1 plants.jpg|right|thumb|300px|'''Figure 9.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:DEP expression2.jpg|right|thumb|300px|'''Figure 4.''' ''The expression profile of DEP1 during spikelet development (from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*During reproductive development,''DEP1'' was preferentially expressed on the adaxial side of the bract primordium,as well as in the bract primordia of primary and secondary rachis-branches. Within the inflorescence meristem,''DEP1'' was expressed weakly in the carpel and stamen primordia, with patchy expression in the lemma and palea(Figure 4)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 3.b,c)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*''DEP1'' transcript abundance was positively induced by the level of nitrogen supplied&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Cellular Location===&lt;br /&gt;
RGB1-GFP, DEP1-GFP,and dep1-1–GFP fusion proteins were detected both on the plasma membrane and within the nucleus of transgenic rice root cells&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Evolution==&lt;br /&gt;
*Pedigree records show that many high-yielding Chinese japonica varieties, including Shennong 265, were derived from the Italian land race Balilla13,15, which was extensively cultivated in Italy in the 1970s and introduced into China in 1958&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
Genetic diversity analysis suggests that ''DEP1'' has been subjected to artificial selection during ''Oryza sativa'' spp.''japonica'' rice domestication&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
*The allelic constitution at the DEP1 locus was explored by resequencing from a panel of widely cultivated Chinese varieties (69 japonica and 83 indica)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.This truncated mutation was present in Balilla and all 36 japonica types having an erect or semierect panicle, including super high-yielding cultivars Liaojing 5 and Qianchonglang,but it was absent from all the other varieties. Thus, this natural allelic variation in DEP1 has clearly been exploited by japonica breeding programs in China.Several sequence variants at the DEP1 C terminus were present in the sample of indica types. The variety 93-11 differed from the japonica variety Nipponbare by three amino acids, whereas that of the variety Teqing differed by two amino acids. The Nipponbare sequence differed from that of an accession of Oryza rufipogon by one nucleotide at position 663, but this did not produce a variant peptide. We investigated the structure of the homologs of DEP1 in other smallgrain cereals&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. Several truncated C-terminal deletions were observed in barley, and in bread wheat and its diploid wild progenitor Triticum urartu. To determine whether any novel gain-of-function was induced by the presence of these truncated genes, we generated a number of transgenic wheat plants carrying a pUbi:RNAi-TaDEP1 construct. The consequent downregulation of TaDEP1 resulted in an increase in the length of the ear, a less compact ear and a somewhat reduced number of spikelets. This suggests that a functionally equivalent mutation may have occurred early in the divergence of the wheat and barley lineages.&lt;br /&gt;
&lt;br /&gt;
==Extension==&lt;br /&gt;
[[File:reponses to Cd.jpg|right|thumb|300px|'''Figure 5.''' ''Plant responses to Cd stress (from reference&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Heterotrimeric_G_proteins Heterotrimeric G proteins] are multisubunit, integral membrane signal-transduction complexes that mediate intracellular responses to external stimuli in diverse eukaryotic organisms&amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.G proteins typically consist of α, β and γ subunits&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;.Gβγ acts as a functional monomer,and Gβ-mediated processes require a γ subunit&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;.&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Cadmium Cadmium] (Cd)is one of the transition metals that is non-essential for almost all living organisms.It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups,thereby inhibiting their growth and development.Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn,Fe,and Ca, of enzymes,signalling intermediates,and transcription factors,especially the zinc-finger type&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. To cope with Cd toxicity effects,plants are known to be equipped with the potential to chelate and extrude Cd,to sequester Cd into vacuoles, and to dissipate reactive oxygen species triggered by Cd(Figure 5)&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.For the chelation of heavy metals, including Cd,various cysteine (Cys)-rich proteins are employed by plants.Small Cys-rich peptides,called metallothioneins (MTs),are the major chelators of Cd&amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Comparison of OsDEP1 and other Cys-rich proteins involved in Cd tolerance:Several other studies have previously identified Cys-rich proteins that can provide enhanced tolerance to Cd toxicity. DcCDT1 from D. ciliaris is a 55 aa peptide of which 15 residues (27%) are Cys. The protein is localized to the cytoplasmic membrane and appears to function in the chelation and possible extrusion of Cd, as transgenic DcCDT1 plants accumulate considerably less Cd than controls.Considering that OsDEP1 is a Gγ subunit, it is likely that it is localized to the inside of cytoplasmic membranes, whereas DcCDT1 may be oriented to the outside of the cytoplasmic membrane. Such a possibility would explain the observed differences in Cd uptake between the DcCDT1- and OsDEP1-expressing transgenic plants.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
*The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China.&lt;br /&gt;
*The State Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, China.&lt;br /&gt;
*Institute of Technical Biology and Agriculture Engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences, Hefei, China.&lt;br /&gt;
*The State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, China.&lt;br /&gt;
*Graduate School of Life Sciences, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi 980-8577, Japan.&lt;br /&gt;
*National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.&lt;br /&gt;
*Faculty of Bioresource Sciences, Akita Prefectural University, 241-7 Kaidobata Nishi, Akita 010-1095, Japan.&lt;br /&gt;
*Biodiversity and Climate Research Center (BiK-F), D-60323 Frankfurt, Germany.&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Huang X, Qian Q, Liu Z, et al. Natural variation at the ''DEP1'' locus enhances grain yield in rice[J]. Nature genetics, 2009, 41(4): 494-497.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sun H, Qian Q, Wu K, et al. Heterotrimeric G proteins regulate nitrogen-use efficiency in rice[J]. Nature genetics, 2014.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt; Kunihiro S, Saito T, Matsuda T, et al. Rice ''DEP1'', encoding a highly cysteine-rich G protein γ subunit, confers cadmium tolerance on yeast cells and plants[J]. Journal of experimental botany, 2013, 64(14): 4517-4527.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;DalCorso G, Farinati S, Maistri S, et al. How plants cope with cadmium: staking all on metabolism and gene expression[J]. Journal of integrative plant biology, 2008, 50(10): 1268-1280.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;New D C, Wong J T Y. The evidence for G-protein-coupled receptors and heterotrimeric G proteins in protozoa and ancestral metazoa[J]. Neurosignals, 1998, 7(2): 98-108.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Perfus-Barbeoch L, Jones A M, Assmann S M. Plant heterotrimeric G protein function: insights from ''Arabidopsis'' and rice mutants[J]. Current opinion in plant biology, 2004, 7(6): 719-731.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Jones J C, Duffy J W, Machius M, et al. The crystal structure of a self-activating G protein α subunit reveals its distinct mechanism of signal initiation[J]. Science signaling, 2011, 4(159): ra8.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Ford C E, Skiba N P, Bae H, et al. Molecular basis for interactions of G protein βγ subunits with effectors[J]. Science, 1998, 280(5367): 1271-1274.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Ullah H, Chen J G, Young J C, et al. Modulation of cell proliferation by heterotrimeric G protein in ''Arabidopsis''[J]. Science, 2001, 292(5524): 2066-2069.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Trusov Y, Rookes J E, Tilbrook K, et al. Heterotrimeric G protein γ subunits provide functional selectivity in Gβγ dimer signaling in ''Arabidopsis''[J]. The Plant Cell Online, 2007, 19(4): 1235-1250.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Verbruggen N, Hermans C, Schat H. Mechanisms to cope with arsenic or cadmium excess in plants[J]. Current opinion in plant biology, 2009, 12(3): 364-372.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt; Ecker D J, Butt T R, Sternberg E J, et al. Yeast metallothionein function in metal ion detoxification[J]. Journal of Biological Chemistry, 1986, 261(36): 16895-16900.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Freisinger E. Plant MTs—long neglected members of the metallothionein superfamily[J]. Dalton Transactions, 2008 (47): 6663-6675.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Rao, N.N., Prasad, K., Kumar, P.R. &amp;amp; Vijayraghavan, U. Distinct regulatory role for RFL,the rice LFY homolog, in determining flowering time and plant architecture[J]. Proc. Natl. Acad. Sci. USA 105, 3646–3651 (2008).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref15&amp;quot;&amp;gt;Kellogg, E.A. Floral displays: genetic control of grass inflorescences[J]. Curr. Opin. Plant Biol. 10, 26–31 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref16&amp;quot;&amp;gt;Kurakawa, T. et al. Direct control of shoot meristem activity by a cytokinin activating enzyme[J]. Nature 445, 652–655 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os09g0441900|&lt;br /&gt;
Description = Whey acidic protein, core region domain containing protein|&lt;br /&gt;
Version = NM_001069822.1 GI:115479386 GeneID:4347178|&lt;br /&gt;
Length = 4701 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os09g0441900, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|&lt;br /&gt;
AP = Chromosome 9:17064862..17069562|&lt;br /&gt;
CDS = 17065265..17065393,17066606..17066664,17067820..17067864,17067951..17067995,17068411..17069413&amp;lt;br&amp;gt;|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagataaatgagtttgttggtacaaaacatgacccactaataccaacaaagagaaggaggcacagatcttgccgtctttttcggtggatcggatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKD                     ELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICISC                     LCYCCKCSPKCKRPRCLNCSCSSCCDEPCCKPNCSACCAGSCCSPDCCSCCKPNCSCC                     KTPSCCKPNCSCSCPSCSSCCDTSCCKPSCTCFNIFSCFKSLYSCFKIPSCFKSQCNC                     SSPNCCTCTLPSCSCKGCACPSCGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGC                     GSCSCAQCKPDCGSCSTNCCSCKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCS                     CAGCCSSLCKCPCTTQCFSCQSSCCKRQPSCCKCQSSCCEGQPSCCEGHCCSLPKPSC                     PECSCGCVWSCKNCTEGCRCPRCRNPCCLSGCLC&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;404..532#1745..1803#2959..3003#3090..3134#3550..4552#tctcttccctctctctctttctctctccaaaccccacgcacgccgcgtcgccgcctcctcctctccatctccgctgctattattgcccgcgcagacgcaggccaccatccttcctctcgctcacgctcgctgctatatgggggtcctcctcatcgcatcgcatcgcatcacctcgcacgggcgcgcgcgccgtgccgtgccgctagctcgatccgcctcgtacgccagctcgctcgctcgctcccccaccccgctgctgcacggctgcgcccgcgctgtcccctgtccccccgctcgccgcggcgatttatacccaccacgccccctgctgctgctataatgcccatgagtgaaggcggcgaggggtggttctgagttggccgttggcgtgctgcgtgtggagatgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggtgagcgccccgcggcggcggcggctgcgtttttctctataggtttctctttcacactcgctcgctcgaaattctcggggcccgagctctacttgcttcgtcttcctttgactttaccgattaattttaaaaaaaaggagatccgattcgccgcgcatttttcaaaacccaagcggccgagtacggagctacccgctactgcaagtaggatgctgtgaagtgtacagtaatggcgttgttaattgcggtagctagtgctattctagtacttgtagtactgtttctaggcggaggtgaatcacggcgccatcaatccgaggctggcgagacaagcttggccctctttgggcgtggcgccatggctgtactacctttgtcgttgtttggttgggctcctcgttggagaaaagaagagcgtgggcatggacaactgacctgagtggccttgtcagggagagccatagcagtggacgtgtctatctccgccattgcttcgtcgacactggacgtgcagacggcatggccatgagggctttgcacgatgggtggtgccgtgttggtgttatgggctgccaccatggtttgaggcttttgatgttgctagattttgtgtttaacgagggagggaagaatgtgttgttcttgacactgtgctgtgcttttaaggagcagagatttcagaagctcttcagatatcagagaacttctttgtagtagtaatcaaatgcgctttagacatctttttatcgtttcttgcaaggtcagtccctgctttggtacccgatctcgcttttgtgcaacatcaaagttacacttacacagtaaagcaggaatctttatgggaccgttcgtactggtcaattactccaggctttgattaatgggttttaagttttaaccgcagatttggtacaagtaacaacctttatttactttttatttctgcaactgtgtcttttaacatgaaagaatccagctccattcaaaagtttagtttttattttccattgtggtgcatggtcactcagcctgcagtactgaattatcaaaattttcttttgtcatttctctcatgttaagtgcatagtctattttacttcaacaggtagaaaaacttttgtgggtttgtttctagctcaaggaggaaattcatgggtttgcatctagcacatgagagaacaatattggtctaacacaaagctccttttgtaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagtatgtactactgcccttcatgcattacagatattttgtttttaagtttttagaaatttgaagagcttatgtcaagtatgaaatgtcagcttaattttattgctgtccttatctaatgtcttatgctctgttttataaaatttggttgcattttctcccccagggaaaaatcttgtataagtgtgttatgtacttatgtgtataaaatcttgttgcacttgtatgtcacacttaggccctgtttagatcctccaaaatggcagtttgccattttgaagaaccttttgccattttggatctaaacactagtaacaaaacttggcaatttggcatttggcatttgctagtctatagtagcaaattgtgccaaaaagtgctttggaaccactctctctttctttctctctctcactttagtgctagaatggtaaaagtttaggatgcatctaaacaccaactagtacttttacaatactaaaacttttgccaccaaaacttttgccatttgccatttgctatttcaaatggatctaaacagggccttagcaaatcaccatatgttaaaattaccttgggatgaaaaagaaaaaggaaaccagcattgaagtcttgtttgaaatgcatatgtacttgtaccattacagaaattcttaaaactgctgtcttgacagctacttatcaaacagccccacctgcatcataacgttcctagtggtgcctataactctgcctcagttattattttgtggcccactggtccaacaatttgaaaaaaattatattgaactaaatatattgaacagtagtatgacgtcctctttgcttgagttccatattacagctcacagtcctgagatttgtttcaccgattctttccatgcgatgtgcacatattcttattcaatttaaaaaatgaaagcagattatttttaacaagtaacctatcacgttagcttaacattgtatatttgtggtggaattatgtaatattccgatatcgcatttgaagttttgaacatgtgtgctcaaattgagggacacatgactgtagtgaaagcaaatataaatgtctgagcaatggactatactttgtattcattactacaagttatgtccttttgcaggttgctaatgtcctcttacattacttgtcaggataaatgagtttgttggtacaaaacatgacccactaataccaacgtatggcctctaaactttcagttcccccattttaagcatgttcgctgtttatttacgagttttgacattgttttttccttttccagaaagagaaggaggcacagatcttgccgtctttttcggtggatcgggtatgttttgatccaatatagtttgctcgcaggttctgaggggcaagaacattcaaatatctataatgttttctgttggattcaacattcatcactatttccctcgaaaaaaaagcattcgtcactattggaattgaaagtctgaaagtgcctctagtccctttgtatgttaaaagtcaataaacaagcagtagttttctatatgccacattaatattattgacgcattttaaaaagcaaactagtccagggatgtaatcatctttgttatctaaaactaaaaaaggaaaaactagtgcttttttacattaacattgatttttttgcggctgaaattacatgtagaaactttggcataataatctgtactactgccaaactgagcttttacatggtgaaaatattttccctgcagatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttgatctagatccttttttggttgttgtttttcttgtattttttagttgttaggcctttgattaagttcgaactttcataaatatatggtgtttatcctgtaaagaaatgatgatttcaaggatttttcatagctatgagacgaggttgaacc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069822.1 RefSeq:Os09g0441900]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 9]]&lt;br /&gt;
[[Category:Chromosome 9]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270791</id>
		<title>Os09g0441900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270791"/>
				<updated>2016-06-23T13:30:24Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os09g0441900''''' was identified as '''''OsDEP1''''' (DENSE AND ERECT PANICLE1) respectively in 2009 by researchers from Chinese Academy of Sciences &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
*Natural variation at the ''DEP1'' locus enhances grain yield in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.The rice DEP1 (DENSE AND ERECT PANICLE 1) locus was first identified by two independent research groups with quantitative trait loci analysis to control grain yield, grain numbers per panicle, and panicle morphology.Deletion of the DEP1 gene during rice domestication was proposed to enhance meristematic activity and result in reduced inflorescence internode lengths that thereby increased grain numbers per panicle and, consequently, grain yields.''DEP1'' regulates nitrogen uptake and metabolism and participates in determining the amount and direction of cell division,which in turn controls organ size and shape.It has been suggested to encode a plant-specific G protein γ subunit.The DEP1 protein interacts in vivo with both the Gα(RGA1)and Gβ(RGB1)subunits,and reduced RGA1 or enhanced RGB1 activity inhibits nitrogen responses.The plant G protein complex regulates nitrogen signaling and modulation of heterotrimeric G protein activity provides a strategy for environmentally sustainable increases in rice grain yield&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:cd tolerance.jpg|right|thumb|300px|'''Figure 1.''' ''Impact of the C-terminal half of OsDEP1 on yeast Cd tolerance(from reference&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''OsDEP1'' encoded a highly cysteine (Cys)-rich G protein γ subunit composed of 426 aa,which was initially identified as it conferred cadmium (Cd) tolerance on yeast cells. Of the 426 aa constituting OsDEP1, 120 are Cys residues (28.2%), of which 88 are clustered in the C-terminal half region (aa 170-426).The OsDEP1(170–426) region is necessary and sufficient to confer cadmium (Cd)tolerance on host yeast cells(Figure 1).The Cd responses of transgenic  Arabidopsis plants constitutively expressing OsDEP1,OsDEP1(1–169) or OsDEP1(170–426),were similar to the observations in yeast cells, with  OsDEP1  and OsDEP1(170–426) transgenic plants displaying Cd tolerance but OsDEP1(1–169) plants showing no such tolerance&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.Cadmium (Cd) is one of the transition metals that is nonessential for almost all living organisms. It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups, thereby inhibiting their growth and development. Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn, Fe, and Ca, of enzymes, signalling intermediates, and transcription factors, especially the zinc-finger type.&lt;br /&gt;
*Arabidopsis AGG3, a DEP1 homologue, was identified as an Arabidopsis heterotrimeric GTP-binding protein (G protein) γ subunit.Unlike the complex mammalian system, Arabidopsis has only one α (GPA1), one β (AGB1), and three γ (AGG1, AGG2, and AGG3) subunits as components of the heterotrimeric G protein system. OsDEP1 is identified as a cDNA clone that confers Cd tolerance to yeast cells. The gene product, OsDEP1, is highly Cys-rich and is a component of the heterotrimeric G protein signalling pathway.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''GO assignment(s):''' GO:0005882&lt;br /&gt;
&lt;br /&gt;
*DEP1 (Dense and Erect Panicle1) gene encodes an unknown protein containing the PEBP (phosphatidylethanolamine-binding protein) domain which share some homology with the N terminus of GS3.DEP1 is pleiotropically responsible for all three traits: dense panicle, high grain number per panicle and erect panicle. In the case of the rice plant, more tillering equates to more grain-bearing branches. Rice branching determines the number of panicle and grain number per panicle ,and then control the grain yield.We can see the rice tillering at (Figure 6). &lt;br /&gt;
[[File:The tillering of rice.jpg|right|thumb|300px|'''Figure 6.''' ''The tillering of rice.'']]]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''dep1'' confers an increased number of grains per panicle (and a consequent increase in grain yield).Figure 2 shows the ''DEP1'' and ''dep1'' NIL line field performance.(a) Dense and erect panicle.(b)Increased panicle branching and reduced rachis length. (c)Grain number per main panicle was significantly higher in the presence of ''dep1''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:The tillering of rice. .jpg|right|thumb|300px|'''Figure 7.''' ''The tillering of rice(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*The ''dep1-1'' and ''dep1-32'' alleles exhibit insensitive growth to nitrogen input level(Figure 3)&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
* dep1 is the mutant DEP1 allele.The variant involves the replacement of a 637-bp stretch of the middle of exon 5 by 12-bp sequence,which has the effect of creatig a premature stop codon and consequently a loss of 230 residues from C termimus.As showed in (Figure 7)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*DEP1 acts as a dominant negative regulator of panicle architecture ad grain number.The near isogenic lines(NILs) carrying a mutated DEP1 (NIL-dep1) exhibit increased number of grain per panicle,shorter infloresence internodes, increased number of both primary and secondary panicle branches,which may result from the enhanced meristematic activity and cell proliferation through regulating OsCKX2&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;(Fig 8. a).&lt;br /&gt;
*But they do not exhibit noticeable change in panical architecture. The experiments are taken as the following several aspects[2]. Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 8.b,c). Close examination of the shoot apex meristem (SAM) showed that the SAM of NIL-dep1 plants was larger than that of NIL-DEP1 plants (Fig 8. 2d). Cells in the uppermost internode of the mature NIL-dep1 culm were shorter than those in NIL-DEP1 plants (Fig 8. 2e). At the same time, cell number across the longitudinal axis of NIL-dep1 plants was higher than in NIL-DEP1 plants (Fig 8. 2f). Taken together, these observations suggest that the dep1 allele enhances meristematic activity and promotes cell proliferation. So dep1 allele enhances meristematic activity and promotes cell proliferation. &lt;br /&gt;
*The activity of axillary meristem in the shoot apex is important for the determination of the extent of panicle branching and hence grain number&amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref15&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref16&amp;quot; /&amp;gt;. In NIL-dep1 plants, the Gn1a was clearly downregulated.Gn1a, a major grain number QTL, encodes a cytokinin oxidase/ dehydrogenase, and has been implicated in the regulation of meristematic activity, panicle branching and grain number through its effect on the level of cytokinin. ANIL-Gn1a line had the same number of primary branches as the control line but developed more secondary branches[6,7]. This suggests that dep1 genetically controls the number of both primary branches and secondary branches on primary branches at the panicle top, whereas Gn1a regulates the number of secondary branches on primary branches at the panicle base.&lt;br /&gt;
*Preparing the field performation of DEP1 and dep1, the grain number per mian panicle is higher in the presence of dep1 (Fig 9.c) and there are clear differences in panicle architecture, influorescence internode and panicle length (Fig 9.b,e), and the number of both primary (Fig 4.b,f)and secondary (Fig 4.g) branches per panicle.Furthermore,he grain-weight of NIL-dep1 plants was slightly less than that of NIL-DEP1 plants (Fig 9.h),but the overall grain yield per plant under field conditions was increased(+40.9%) (Fig 9.I).The evidence of grain-fillinf failure in the presence of dep1 is unclear.The vascular system of NIL-dep1 plants appeared rather better developed and their sclerenchyma cell walls were thicker at maturity than those in NIL-DEP1 plants. These traits are favorable for both water transport capacity and the mechanical strength of the stem, both of which are important factors for the breeding of high-yielding, lodging-resistant varieties. Through testing the effect of dep1 on grain yield in an indica background by backcrossing the dep1 segment present in the japonica variety Wuyunjing 7 into the indica variety Zhefu 802. This NIL, ZF 802 (dep1), produced more grains per panicle and out-yielded its recurrent parent. Thus, dep1 is a useful allele for increasing grain yield in rice.&lt;br /&gt;
&lt;br /&gt;
[[File:DEP1 expression and its effect on cell proliferation.jpg|right|thumb|300px|'''Figure 8.''' ''DEP1 expression and its effect on cell proliferation(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
[[File:The phenotype of NIL-dep1 plants.jpg|right|thumb|300px|'''Figure 9.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:DEP expression2.jpg|right|thumb|300px|'''Figure 4.''' ''The expression profile of DEP1 during spikelet development (from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*During reproductive development,''DEP1'' was preferentially expressed on the adaxial side of the bract primordium,as well as in the bract primordia of primary and secondary rachis-branches. Within the inflorescence meristem,''DEP1'' was expressed weakly in the carpel and stamen primordia, with patchy expression in the lemma and palea(Figure 4)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 3.b,c)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*''DEP1'' transcript abundance was positively induced by the level of nitrogen supplied&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Cellular Location===&lt;br /&gt;
RGB1-GFP, DEP1-GFP,and dep1-1–GFP fusion proteins were detected both on the plasma membrane and within the nucleus of transgenic rice root cells&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Evolution==&lt;br /&gt;
*Pedigree records show that many high-yielding Chinese japonica varieties, including Shennong 265, were derived from the Italian land race Balilla13,15, which was extensively cultivated in Italy in the 1970s and introduced into China in 1958&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
Genetic diversity analysis suggests that ''DEP1'' has been subjected to artificial selection during ''Oryza sativa'' spp.''japonica'' rice domestication&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
*The allelic constitution at the DEP1 locus was explored by resequencing from a panel of widely cultivated Chinese varieties (69 japonica and 83 indica)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.This truncated mutation was present in Balilla and all 36 japonica types having an erect or semierect panicle, including super high-yielding cultivars Liaojing 5 and Qianchonglang,but it was absent from all the other varieties. Thus, this natural allelic variation in DEP1 has clearly been exploited by japonica breeding programs in China.Several sequence variants at the DEP1 C terminus were present in the sample of indica types. The variety 93-11 differed from the japonica variety Nipponbare by three amino acids, whereas that of the variety Teqing differed by two amino acids. The Nipponbare sequence differed from that of an accession of Oryza rufipogon by one nucleotide at position 663, but this did not produce a variant peptide. We investigated the structure of the homologs of DEP1 in other smallgrain cereals&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. Several truncated C-terminal deletions were observed in barley, and in bread wheat and its diploid wild progenitor Triticum urartu. To determine whether any novel gain-of-function was induced by the presence of these truncated genes, we generated a number of transgenic wheat plants carrying a pUbi:RNAi-TaDEP1 construct. The consequent downregulation of TaDEP1 resulted in an increase in the length of the ear, a less compact ear and a somewhat reduced number of spikelets. This suggests that a functionally equivalent mutation may have occurred early in the divergence of the wheat and barley lineages.&lt;br /&gt;
&lt;br /&gt;
==Extension==&lt;br /&gt;
[[File:reponses to Cd.jpg|right|thumb|300px|'''Figure 5.''' ''Plant responses to Cd stress (from reference&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Heterotrimeric_G_proteins Heterotrimeric G proteins] are multisubunit, integral membrane signal-transduction complexes that mediate intracellular responses to external stimuli in diverse eukaryotic organisms&amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.G proteins typically consist of α, β and γ subunits&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;.Gβγ acts as a functional monomer,and Gβ-mediated processes require a γ subunit&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;.&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Cadmium Cadmium] (Cd)is one of the transition metals that is non-essential for almost all living organisms.It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups,thereby inhibiting their growth and development.Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn,Fe,and Ca, of enzymes,signalling intermediates,and transcription factors,especially the zinc-finger type&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. To cope with Cd toxicity effects,plants are known to be equipped with the potential to chelate and extrude Cd,to sequester Cd into vacuoles, and to dissipate reactive oxygen species triggered by Cd(Figure 5)&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.For the chelation of heavy metals, including Cd,various cysteine (Cys)-rich proteins are employed by plants.Small Cys-rich peptides,called metallothioneins (MTs),are the major chelators of Cd&amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Comparison of OsDEP1 and other Cys-rich proteins involved in Cd tolerance:Several other studies have previously identified Cys-rich proteins that can provide enhanced tolerance to Cd toxicity. DcCDT1 from D. ciliaris is a 55 aa peptide of which 15 residues (27%) are Cys. The protein is localized to the cytoplasmic membrane and appears to function in the chelation and possible extrusion of Cd, as transgenic DcCDT1 plants accumulate considerably less Cd than controls.Considering that OsDEP1 is a Gγ subunit, it is likely that it is localized to the inside of cytoplasmic membranes, whereas DcCDT1 may be oriented to the outside of the cytoplasmic membrane. Such a possibility would explain the observed differences in Cd uptake between the DcCDT1- and OsDEP1-expressing transgenic plants.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
*The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China.&lt;br /&gt;
*The State Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, China.&lt;br /&gt;
*Institute of Technical Biology and Agriculture Engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences, Hefei, China.&lt;br /&gt;
*The State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, China.&lt;br /&gt;
*Graduate School of Life Sciences, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi 980-8577, Japan.&lt;br /&gt;
*National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.&lt;br /&gt;
*Faculty of Bioresource Sciences, Akita Prefectural University, 241-7 Kaidobata Nishi, Akita 010-1095, Japan.&lt;br /&gt;
*Biodiversity and Climate Research Center (BiK-F), D-60323 Frankfurt, Germany.&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Huang X, Qian Q, Liu Z, et al. Natural variation at the ''DEP1'' locus enhances grain yield in rice[J]. Nature genetics, 2009, 41(4): 494-497.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sun H, Qian Q, Wu K, et al. Heterotrimeric G proteins regulate nitrogen-use efficiency in rice[J]. Nature genetics, 2014.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt; Kunihiro S, Saito T, Matsuda T, et al. Rice ''DEP1'', encoding a highly cysteine-rich G protein γ subunit, confers cadmium tolerance on yeast cells and plants[J]. Journal of experimental botany, 2013, 64(14): 4517-4527.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;DalCorso G, Farinati S, Maistri S, et al. How plants cope with cadmium: staking all on metabolism and gene expression[J]. Journal of integrative plant biology, 2008, 50(10): 1268-1280.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;New D C, Wong J T Y. The evidence for G-protein-coupled receptors and heterotrimeric G proteins in protozoa and ancestral metazoa[J]. Neurosignals, 1998, 7(2): 98-108.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Perfus-Barbeoch L, Jones A M, Assmann S M. Plant heterotrimeric G protein function: insights from ''Arabidopsis'' and rice mutants[J]. Current opinion in plant biology, 2004, 7(6): 719-731.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Jones J C, Duffy J W, Machius M, et al. The crystal structure of a self-activating G protein α subunit reveals its distinct mechanism of signal initiation[J]. Science signaling, 2011, 4(159): ra8.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Ford C E, Skiba N P, Bae H, et al. Molecular basis for interactions of G protein βγ subunits with effectors[J]. Science, 1998, 280(5367): 1271-1274.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Ullah H, Chen J G, Young J C, et al. Modulation of cell proliferation by heterotrimeric G protein in ''Arabidopsis''[J]. Science, 2001, 292(5524): 2066-2069.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Trusov Y, Rookes J E, Tilbrook K, et al. Heterotrimeric G protein γ subunits provide functional selectivity in Gβγ dimer signaling in ''Arabidopsis''[J]. The Plant Cell Online, 2007, 19(4): 1235-1250.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Verbruggen N, Hermans C, Schat H. Mechanisms to cope with arsenic or cadmium excess in plants[J]. Current opinion in plant biology, 2009, 12(3): 364-372.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt; Ecker D J, Butt T R, Sternberg E J, et al. Yeast metallothionein function in metal ion detoxification[J]. Journal of Biological Chemistry, 1986, 261(36): 16895-16900.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Freisinger E. Plant MTs—long neglected members of the metallothionein superfamily[J]. Dalton Transactions, 2008 (47): 6663-6675.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Rao, N.N., Prasad, K., Kumar, P.R. &amp;amp; Vijayraghavan, U. Distinct regulatory role for RFL,the rice LFY homolog, in determining flowering time and plant architecture[J]. Proc. Natl. Acad. Sci. USA 105, 3646–3651 (2008).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref15&amp;quot;&amp;gt;Kellogg, E.A. Floral displays: genetic control of grass inflorescences[J]. Curr. Opin. Plant Biol. 10, 26–31 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref16&amp;quot;&amp;gt;Kurakawa, T. et al. Direct control of shoot meristem activity by a cytokinin activating enzyme[J]. Nature 445, 652–655 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os09g0441900|&lt;br /&gt;
Description = Whey acidic protein, core region domain containing protein|&lt;br /&gt;
Version = NM_001069822.1 GI:115479386 GeneID:4347178|&lt;br /&gt;
Length = 4701 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os09g0441900, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|&lt;br /&gt;
AP = Chromosome 9:17064862..17069562|&lt;br /&gt;
CDS = 17065265..17065393,17066606..17066664,17067820..17067864,17067951..17067995,17068411..17069413&amp;lt;br&amp;gt;|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagataaatgagtttgttggtacaaaacatgacccactaataccaacaaagagaaggaggcacagatcttgccgtctttttcggtggatcggatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKD                     ELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICISC                     LCYCCKCSPKCKRPRCLNCSCSSCCDEPCCKPNCSACCAGSCCSPDCCSCCKPNCSCC                     KTPSCCKPNCSCSCPSCSSCCDTSCCKPSCTCFNIFSCFKSLYSCFKIPSCFKSQCNC                     SSPNCCTCTLPSCSCKGCACPSCGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGC                     GSCSCAQCKPDCGSCSTNCCSCKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCS                     CAGCCSSLCKCPCTTQCFSCQSSCCKRQPSCCKCQSSCCEGQPSCCEGHCCSLPKPSC                     PECSCGCVWSCKNCTEGCRCPRCRNPCCLSGCLC&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;404..532#1745..1803#2959..3003#3090..3134#3550..4552#tctcttccctctctctctttctctctccaaaccccacgcacgccgcgtcgccgcctcctcctctccatctccgctgctattattgcccgcgcagacgcaggccaccatccttcctctcgctcacgctcgctgctatatgggggtcctcctcatcgcatcgcatcgcatcacctcgcacgggcgcgcgcgccgtgccgtgccgctagctcgatccgcctcgtacgccagctcgctcgctcgctcccccaccccgctgctgcacggctgcgcccgcgctgtcccctgtccccccgctcgccgcggcgatttatacccaccacgccccctgctgctgctataatgcccatgagtgaaggcggcgaggggtggttctgagttggccgttggcgtgctgcgtgtggagatgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggtgagcgccccgcggcggcggcggctgcgtttttctctataggtttctctttcacactcgctcgctcgaaattctcggggcccgagctctacttgcttcgtcttcctttgactttaccgattaattttaaaaaaaaggagatccgattcgccgcgcatttttcaaaacccaagcggccgagtacggagctacccgctactgcaagtaggatgctgtgaagtgtacagtaatggcgttgttaattgcggtagctagtgctattctagtacttgtagtactgtttctaggcggaggtgaatcacggcgccatcaatccgaggctggcgagacaagcttggccctctttgggcgtggcgccatggctgtactacctttgtcgttgtttggttgggctcctcgttggagaaaagaagagcgtgggcatggacaactgacctgagtggccttgtcagggagagccatagcagtggacgtgtctatctccgccattgcttcgtcgacactggacgtgcagacggcatggccatgagggctttgcacgatgggtggtgccgtgttggtgttatgggctgccaccatggtttgaggcttttgatgttgctagattttgtgtttaacgagggagggaagaatgtgttgttcttgacactgtgctgtgcttttaaggagcagagatttcagaagctcttcagatatcagagaacttctttgtagtagtaatcaaatgcgctttagacatctttttatcgtttcttgcaaggtcagtccctgctttggtacccgatctcgcttttgtgcaacatcaaagttacacttacacagtaaagcaggaatctttatgggaccgttcgtactggtcaattactccaggctttgattaatgggttttaagttttaaccgcagatttggtacaagtaacaacctttatttactttttatttctgcaactgtgtcttttaacatgaaagaatccagctccattcaaaagtttagtttttattttccattgtggtgcatggtcactcagcctgcagtactgaattatcaaaattttcttttgtcatttctctcatgttaagtgcatagtctattttacttcaacaggtagaaaaacttttgtgggtttgtttctagctcaaggaggaaattcatgggtttgcatctagcacatgagagaacaatattggtctaacacaaagctccttttgtaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagtatgtactactgcccttcatgcattacagatattttgtttttaagtttttagaaatttgaagagcttatgtcaagtatgaaatgtcagcttaattttattgctgtccttatctaatgtcttatgctctgttttataaaatttggttgcattttctcccccagggaaaaatcttgtataagtgtgttatgtacttatgtgtataaaatcttgttgcacttgtatgtcacacttaggccctgtttagatcctccaaaatggcagtttgccattttgaagaaccttttgccattttggatctaaacactagtaacaaaacttggcaatttggcatttggcatttgctagtctatagtagcaaattgtgccaaaaagtgctttggaaccactctctctttctttctctctctcactttagtgctagaatggtaaaagtttaggatgcatctaaacaccaactagtacttttacaatactaaaacttttgccaccaaaacttttgccatttgccatttgctatttcaaatggatctaaacagggccttagcaaatcaccatatgttaaaattaccttgggatgaaaaagaaaaaggaaaccagcattgaagtcttgtttgaaatgcatatgtacttgtaccattacagaaattcttaaaactgctgtcttgacagctacttatcaaacagccccacctgcatcataacgttcctagtggtgcctataactctgcctcagttattattttgtggcccactggtccaacaatttgaaaaaaattatattgaactaaatatattgaacagtagtatgacgtcctctttgcttgagttccatattacagctcacagtcctgagatttgtttcaccgattctttccatgcgatgtgcacatattcttattcaatttaaaaaatgaaagcagattatttttaacaagtaacctatcacgttagcttaacattgtatatttgtggtggaattatgtaatattccgatatcgcatttgaagttttgaacatgtgtgctcaaattgagggacacatgactgtagtgaaagcaaatataaatgtctgagcaatggactatactttgtattcattactacaagttatgtccttttgcaggttgctaatgtcctcttacattacttgtcaggataaatgagtttgttggtacaaaacatgacccactaataccaacgtatggcctctaaactttcagttcccccattttaagcatgttcgctgtttatttacgagttttgacattgttttttccttttccagaaagagaaggaggcacagatcttgccgtctttttcggtggatcgggtatgttttgatccaatatagtttgctcgcaggttctgaggggcaagaacattcaaatatctataatgttttctgttggattcaacattcatcactatttccctcgaaaaaaaagcattcgtcactattggaattgaaagtctgaaagtgcctctagtccctttgtatgttaaaagtcaataaacaagcagtagttttctatatgccacattaatattattgacgcattttaaaaagcaaactagtccagggatgtaatcatctttgttatctaaaactaaaaaaggaaaaactagtgcttttttacattaacattgatttttttgcggctgaaattacatgtagaaactttggcataataatctgtactactgccaaactgagcttttacatggtgaaaatattttccctgcagatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttgatctagatccttttttggttgttgtttttcttgtattttttagttgttaggcctttgattaagttcgaactttcataaatatatggtgtttatcctgtaaagaaatgatgatttcaaggatttttcatagctatgagacgaggttgaacc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069822.1 RefSeq:Os09g0441900]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 9]]&lt;br /&gt;
[[Category:Chromosome 9]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270790</id>
		<title>Os09g0441900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270790"/>
				<updated>2016-06-23T13:27:47Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os09g0441900''''' was identified as '''''OsDEP1''''' (DENSE AND ERECT PANICLE1) respectively in 2009 by researchers from China&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
*Natural variation at the ''DEP1'' locus enhances grain yield in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.The rice DEP1 (DENSE AND ERECT PANICLE 1) locus was first identified by two independent research groups with quantitative trait loci analysis to control grain yield, grain numbers per panicle, and panicle morphology.Deletion of the DEP1 gene during rice domestication was proposed to enhance meristematic activity and result in reduced inflorescence internode lengths that thereby increased grain numbers per panicle and, consequently, grain yields.''DEP1'' regulates nitrogen uptake and metabolism and participates in determining the amount and direction of cell division,which in turn controls organ size and shape.It has been suggested to encode a plant-specific G protein γ subunit.The DEP1 protein interacts in vivo with both the Gα(RGA1)and Gβ(RGB1)subunits,and reduced RGA1 or enhanced RGB1 activity inhibits nitrogen responses.The plant G protein complex regulates nitrogen signaling and modulation of heterotrimeric G protein activity provides a strategy for environmentally sustainable increases in rice grain yield&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:cd tolerance.jpg|right|thumb|300px|'''Figure 1.''' ''Impact of the C-terminal half of OsDEP1 on yeast Cd tolerance(from reference&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''OsDEP1'' encoded a highly cysteine (Cys)-rich G protein γ subunit composed of 426 aa,which was initially identified as it conferred cadmium (Cd) tolerance on yeast cells. Of the 426 aa constituting OsDEP1, 120 are Cys residues (28.2%), of which 88 are clustered in the C-terminal half region (aa 170-426).The OsDEP1(170–426) region is necessary and sufficient to confer cadmium (Cd)tolerance on host yeast cells(Figure 1).The Cd responses of transgenic  Arabidopsis plants constitutively expressing OsDEP1,OsDEP1(1–169) or OsDEP1(170–426),were similar to the observations in yeast cells, with  OsDEP1  and OsDEP1(170–426) transgenic plants displaying Cd tolerance but OsDEP1(1–169) plants showing no such tolerance&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.Cadmium (Cd) is one of the transition metals that is nonessential for almost all living organisms. It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups, thereby inhibiting their growth and development. Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn, Fe, and Ca, of enzymes, signalling intermediates, and transcription factors, especially the zinc-finger type.&lt;br /&gt;
*Arabidopsis AGG3, a DEP1 homologue, was identified as an Arabidopsis heterotrimeric GTP-binding protein (G protein) γ subunit.Unlike the complex mammalian system, Arabidopsis has only one α (GPA1), one β (AGB1), and three γ (AGG1, AGG2, and AGG3) subunits as components of the heterotrimeric G protein system. OsDEP1 is identified as a cDNA clone that confers Cd tolerance to yeast cells. The gene product, OsDEP1, is highly Cys-rich and is a component of the heterotrimeric G protein signalling pathway.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''GO assignment(s):''' GO:0005882&lt;br /&gt;
&lt;br /&gt;
*DEP1 (Dense and Erect Panicle1) gene encodes an unknown protein containing the PEBP (phosphatidylethanolamine-binding protein) domain which share some homology with the N terminus of GS3.DEP1 is pleiotropically responsible for all three traits: dense panicle, high grain number per panicle and erect panicle. In the case of the rice plant, more tillering equates to more grain-bearing branches. Rice branching determines the number of panicle and grain number per panicle ,and then control the grain yield.We can see the rice tillering at (Figure 6). &lt;br /&gt;
[[File:The tillering of rice.jpg|right|thumb|300px|'''Figure 6.''' ''The tillering of rice.'']]]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''dep1'' confers an increased number of grains per panicle (and a consequent increase in grain yield).Figure 2 shows the ''DEP1'' and ''dep1'' NIL line field performance.(a) Dense and erect panicle.(b)Increased panicle branching and reduced rachis length. (c)Grain number per main panicle was significantly higher in the presence of ''dep1''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:The tillering of rice. .jpg|right|thumb|300px|'''Figure 7.''' ''The tillering of rice(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*The ''dep1-1'' and ''dep1-32'' alleles exhibit insensitive growth to nitrogen input level(Figure 3)&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
* dep1 is the mutant DEP1 allele.The variant involves the replacement of a 637-bp stretch of the middle of exon 5 by 12-bp sequence,which has the effect of creatig a premature stop codon and consequently a loss of 230 residues from C termimus.As showed in (Figure 7)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*DEP1 acts as a dominant negative regulator of panicle architecture ad grain number.The near isogenic lines(NILs) carrying a mutated DEP1 (NIL-dep1) exhibit increased number of grain per panicle,shorter infloresence internodes, increased number of both primary and secondary panicle branches,which may result from the enhanced meristematic activity and cell proliferation through regulating OsCKX2&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;(Fig 8. a).&lt;br /&gt;
*But they do not exhibit noticeable change in panical architecture. The experiments are taken as the following several aspects[2]. Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 8.b,c). Close examination of the shoot apex meristem (SAM) showed that the SAM of NIL-dep1 plants was larger than that of NIL-DEP1 plants (Fig 8. 2d). Cells in the uppermost internode of the mature NIL-dep1 culm were shorter than those in NIL-DEP1 plants (Fig 8. 2e). At the same time, cell number across the longitudinal axis of NIL-dep1 plants was higher than in NIL-DEP1 plants (Fig 8. 2f). Taken together, these observations suggest that the dep1 allele enhances meristematic activity and promotes cell proliferation. So dep1 allele enhances meristematic activity and promotes cell proliferation. &lt;br /&gt;
*The activity of axillary meristem in the shoot apex is important for the determination of the extent of panicle branching and hence grain number&amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref15&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref16&amp;quot; /&amp;gt;. In NIL-dep1 plants, the Gn1a was clearly downregulated.Gn1a, a major grain number QTL, encodes a cytokinin oxidase/ dehydrogenase, and has been implicated in the regulation of meristematic activity, panicle branching and grain number through its effect on the level of cytokinin. ANIL-Gn1a line had the same number of primary branches as the control line but developed more secondary branches[6,7]. This suggests that dep1 genetically controls the number of both primary branches and secondary branches on primary branches at the panicle top, whereas Gn1a regulates the number of secondary branches on primary branches at the panicle base.&lt;br /&gt;
*Preparing the field performation of DEP1 and dep1, the grain number per mian panicle is higher in the presence of dep1 (Fig 9.c) and there are clear differences in panicle architecture, influorescence internode and panicle length (Fig 9.b,e), and the number of both primary (Fig 4.b,f)and secondary (Fig 4.g) branches per panicle.Furthermore,he grain-weight of NIL-dep1 plants was slightly less than that of NIL-DEP1 plants (Fig 9.h),but the overall grain yield per plant under field conditions was increased(+40.9%) (Fig 9.I).The evidence of grain-fillinf failure in the presence of dep1 is unclear.The vascular system of NIL-dep1 plants appeared rather better developed and their sclerenchyma cell walls were thicker at maturity than those in NIL-DEP1 plants. These traits are favorable for both water transport capacity and the mechanical strength of the stem, both of which are important factors for the breeding of high-yielding, lodging-resistant varieties. Through testing the effect of dep1 on grain yield in an indica background by backcrossing the dep1 segment present in the japonica variety Wuyunjing 7 into the indica variety Zhefu 802. This NIL, ZF 802 (dep1), produced more grains per panicle and out-yielded its recurrent parent. Thus, dep1 is a useful allele for increasing grain yield in rice.&lt;br /&gt;
&lt;br /&gt;
[[File:DEP1 expression and its effect on cell proliferation.jpg|right|thumb|300px|'''Figure 8.''' ''DEP1 expression and its effect on cell proliferation(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
[[File:The phenotype of NIL-dep1 plants.jpg|right|thumb|300px|'''Figure 9.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:DEP expression2.jpg|right|thumb|300px|'''Figure 4.''' ''The expression profile of DEP1 during spikelet development (from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*During reproductive development,''DEP1'' was preferentially expressed on the adaxial side of the bract primordium,as well as in the bract primordia of primary and secondary rachis-branches. Within the inflorescence meristem,''DEP1'' was expressed weakly in the carpel and stamen primordia, with patchy expression in the lemma and palea(Figure 4)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 3.b,c)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*''DEP1'' transcript abundance was positively induced by the level of nitrogen supplied&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Cellular Location===&lt;br /&gt;
RGB1-GFP, DEP1-GFP,and dep1-1–GFP fusion proteins were detected both on the plasma membrane and within the nucleus of transgenic rice root cells&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Evolution==&lt;br /&gt;
*Pedigree records show that many high-yielding Chinese japonica varieties, including Shennong 265, were derived from the Italian land race Balilla13,15, which was extensively cultivated in Italy in the 1970s and introduced into China in 1958&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
Genetic diversity analysis suggests that ''DEP1'' has been subjected to artificial selection during ''Oryza sativa'' spp.''japonica'' rice domestication&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
*The allelic constitution at the DEP1 locus was explored by resequencing from a panel of widely cultivated Chinese varieties (69 japonica and 83 indica)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.This truncated mutation was present in Balilla and all 36 japonica types having an erect or semierect panicle, including super high-yielding cultivars Liaojing 5 and Qianchonglang,but it was absent from all the other varieties. Thus, this natural allelic variation in DEP1 has clearly been exploited by japonica breeding programs in China.Several sequence variants at the DEP1 C terminus were present in the sample of indica types. The variety 93-11 differed from the japonica variety Nipponbare by three amino acids, whereas that of the variety Teqing differed by two amino acids. The Nipponbare sequence differed from that of an accession of Oryza rufipogon by one nucleotide at position 663, but this did not produce a variant peptide. We investigated the structure of the homologs of DEP1 in other smallgrain cereals&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. Several truncated C-terminal deletions were observed in barley, and in bread wheat and its diploid wild progenitor Triticum urartu. To determine whether any novel gain-of-function was induced by the presence of these truncated genes, we generated a number of transgenic wheat plants carrying a pUbi:RNAi-TaDEP1 construct. The consequent downregulation of TaDEP1 resulted in an increase in the length of the ear, a less compact ear and a somewhat reduced number of spikelets. This suggests that a functionally equivalent mutation may have occurred early in the divergence of the wheat and barley lineages.&lt;br /&gt;
&lt;br /&gt;
==Extension==&lt;br /&gt;
[[File:reponses to Cd.jpg|right|thumb|300px|'''Figure 5.''' ''Plant responses to Cd stress (from reference&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Heterotrimeric_G_proteins Heterotrimeric G proteins] are multisubunit, integral membrane signal-transduction complexes that mediate intracellular responses to external stimuli in diverse eukaryotic organisms&amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.G proteins typically consist of α, β and γ subunits&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;.Gβγ acts as a functional monomer,and Gβ-mediated processes require a γ subunit&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;.&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Cadmium Cadmium] (Cd)is one of the transition metals that is non-essential for almost all living organisms.It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups,thereby inhibiting their growth and development.Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn,Fe,and Ca, of enzymes,signalling intermediates,and transcription factors,especially the zinc-finger type&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. To cope with Cd toxicity effects,plants are known to be equipped with the potential to chelate and extrude Cd,to sequester Cd into vacuoles, and to dissipate reactive oxygen species triggered by Cd(Figure 5)&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.For the chelation of heavy metals, including Cd,various cysteine (Cys)-rich proteins are employed by plants.Small Cys-rich peptides,called metallothioneins (MTs),are the major chelators of Cd&amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Comparison of OsDEP1 and other Cys-rich proteins involved in Cd tolerance:Several other studies have previously identified Cys-rich proteins that can provide enhanced tolerance to Cd toxicity. DcCDT1 from D. ciliaris is a 55 aa peptide of which 15 residues (27%) are Cys. The protein is localized to the cytoplasmic membrane and appears to function in the chelation and possible extrusion of Cd, as transgenic DcCDT1 plants accumulate considerably less Cd than controls.Considering that OsDEP1 is a Gγ subunit, it is likely that it is localized to the inside of cytoplasmic membranes, whereas DcCDT1 may be oriented to the outside of the cytoplasmic membrane. Such a possibility would explain the observed differences in Cd uptake between the DcCDT1- and OsDEP1-expressing transgenic plants.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
*The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China.&lt;br /&gt;
*The State Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, China.&lt;br /&gt;
*Institute of Technical Biology and Agriculture Engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences, Hefei, China.&lt;br /&gt;
*The State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, China.&lt;br /&gt;
*Graduate School of Life Sciences, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi 980-8577, Japan.&lt;br /&gt;
*National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.&lt;br /&gt;
*Faculty of Bioresource Sciences, Akita Prefectural University, 241-7 Kaidobata Nishi, Akita 010-1095, Japan.&lt;br /&gt;
*Biodiversity and Climate Research Center (BiK-F), D-60323 Frankfurt, Germany.&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Huang X, Qian Q, Liu Z, et al. Natural variation at the ''DEP1'' locus enhances grain yield in rice[J]. Nature genetics, 2009, 41(4): 494-497.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sun H, Qian Q, Wu K, et al. Heterotrimeric G proteins regulate nitrogen-use efficiency in rice[J]. Nature genetics, 2014.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt; Kunihiro S, Saito T, Matsuda T, et al. Rice ''DEP1'', encoding a highly cysteine-rich G protein γ subunit, confers cadmium tolerance on yeast cells and plants[J]. Journal of experimental botany, 2013, 64(14): 4517-4527.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;DalCorso G, Farinati S, Maistri S, et al. How plants cope with cadmium: staking all on metabolism and gene expression[J]. Journal of integrative plant biology, 2008, 50(10): 1268-1280.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;New D C, Wong J T Y. The evidence for G-protein-coupled receptors and heterotrimeric G proteins in protozoa and ancestral metazoa[J]. Neurosignals, 1998, 7(2): 98-108.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Perfus-Barbeoch L, Jones A M, Assmann S M. Plant heterotrimeric G protein function: insights from ''Arabidopsis'' and rice mutants[J]. Current opinion in plant biology, 2004, 7(6): 719-731.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Jones J C, Duffy J W, Machius M, et al. The crystal structure of a self-activating G protein α subunit reveals its distinct mechanism of signal initiation[J]. Science signaling, 2011, 4(159): ra8.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Ford C E, Skiba N P, Bae H, et al. Molecular basis for interactions of G protein βγ subunits with effectors[J]. Science, 1998, 280(5367): 1271-1274.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Ullah H, Chen J G, Young J C, et al. Modulation of cell proliferation by heterotrimeric G protein in ''Arabidopsis''[J]. Science, 2001, 292(5524): 2066-2069.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Trusov Y, Rookes J E, Tilbrook K, et al. Heterotrimeric G protein γ subunits provide functional selectivity in Gβγ dimer signaling in ''Arabidopsis''[J]. The Plant Cell Online, 2007, 19(4): 1235-1250.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Verbruggen N, Hermans C, Schat H. Mechanisms to cope with arsenic or cadmium excess in plants[J]. Current opinion in plant biology, 2009, 12(3): 364-372.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt; Ecker D J, Butt T R, Sternberg E J, et al. Yeast metallothionein function in metal ion detoxification[J]. Journal of Biological Chemistry, 1986, 261(36): 16895-16900.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Freisinger E. Plant MTs—long neglected members of the metallothionein superfamily[J]. Dalton Transactions, 2008 (47): 6663-6675.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Rao, N.N., Prasad, K., Kumar, P.R. &amp;amp; Vijayraghavan, U. Distinct regulatory role for RFL,the rice LFY homolog, in determining flowering time and plant architecture[J]. Proc. Natl. Acad. Sci. USA 105, 3646–3651 (2008).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref15&amp;quot;&amp;gt;Kellogg, E.A. Floral displays: genetic control of grass inflorescences[J]. Curr. Opin. Plant Biol. 10, 26–31 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref16&amp;quot;&amp;gt;Kurakawa, T. et al. Direct control of shoot meristem activity by a cytokinin activating enzyme[J]. Nature 445, 652–655 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os09g0441900|&lt;br /&gt;
Description = Whey acidic protein, core region domain containing protein|&lt;br /&gt;
Version = NM_001069822.1 GI:115479386 GeneID:4347178|&lt;br /&gt;
Length = 4701 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os09g0441900, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|&lt;br /&gt;
AP = Chromosome 9:17064862..17069562|&lt;br /&gt;
CDS = 17065265..17065393,17066606..17066664,17067820..17067864,17067951..17067995,17068411..17069413&amp;lt;br&amp;gt;|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagataaatgagtttgttggtacaaaacatgacccactaataccaacaaagagaaggaggcacagatcttgccgtctttttcggtggatcggatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKD                     ELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICISC                     LCYCCKCSPKCKRPRCLNCSCSSCCDEPCCKPNCSACCAGSCCSPDCCSCCKPNCSCC                     KTPSCCKPNCSCSCPSCSSCCDTSCCKPSCTCFNIFSCFKSLYSCFKIPSCFKSQCNC                     SSPNCCTCTLPSCSCKGCACPSCGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGC                     GSCSCAQCKPDCGSCSTNCCSCKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCS                     CAGCCSSLCKCPCTTQCFSCQSSCCKRQPSCCKCQSSCCEGQPSCCEGHCCSLPKPSC                     PECSCGCVWSCKNCTEGCRCPRCRNPCCLSGCLC&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;404..532#1745..1803#2959..3003#3090..3134#3550..4552#tctcttccctctctctctttctctctccaaaccccacgcacgccgcgtcgccgcctcctcctctccatctccgctgctattattgcccgcgcagacgcaggccaccatccttcctctcgctcacgctcgctgctatatgggggtcctcctcatcgcatcgcatcgcatcacctcgcacgggcgcgcgcgccgtgccgtgccgctagctcgatccgcctcgtacgccagctcgctcgctcgctcccccaccccgctgctgcacggctgcgcccgcgctgtcccctgtccccccgctcgccgcggcgatttatacccaccacgccccctgctgctgctataatgcccatgagtgaaggcggcgaggggtggttctgagttggccgttggcgtgctgcgtgtggagatgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggtgagcgccccgcggcggcggcggctgcgtttttctctataggtttctctttcacactcgctcgctcgaaattctcggggcccgagctctacttgcttcgtcttcctttgactttaccgattaattttaaaaaaaaggagatccgattcgccgcgcatttttcaaaacccaagcggccgagtacggagctacccgctactgcaagtaggatgctgtgaagtgtacagtaatggcgttgttaattgcggtagctagtgctattctagtacttgtagtactgtttctaggcggaggtgaatcacggcgccatcaatccgaggctggcgagacaagcttggccctctttgggcgtggcgccatggctgtactacctttgtcgttgtttggttgggctcctcgttggagaaaagaagagcgtgggcatggacaactgacctgagtggccttgtcagggagagccatagcagtggacgtgtctatctccgccattgcttcgtcgacactggacgtgcagacggcatggccatgagggctttgcacgatgggtggtgccgtgttggtgttatgggctgccaccatggtttgaggcttttgatgttgctagattttgtgtttaacgagggagggaagaatgtgttgttcttgacactgtgctgtgcttttaaggagcagagatttcagaagctcttcagatatcagagaacttctttgtagtagtaatcaaatgcgctttagacatctttttatcgtttcttgcaaggtcagtccctgctttggtacccgatctcgcttttgtgcaacatcaaagttacacttacacagtaaagcaggaatctttatgggaccgttcgtactggtcaattactccaggctttgattaatgggttttaagttttaaccgcagatttggtacaagtaacaacctttatttactttttatttctgcaactgtgtcttttaacatgaaagaatccagctccattcaaaagtttagtttttattttccattgtggtgcatggtcactcagcctgcagtactgaattatcaaaattttcttttgtcatttctctcatgttaagtgcatagtctattttacttcaacaggtagaaaaacttttgtgggtttgtttctagctcaaggaggaaattcatgggtttgcatctagcacatgagagaacaatattggtctaacacaaagctccttttgtaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagtatgtactactgcccttcatgcattacagatattttgtttttaagtttttagaaatttgaagagcttatgtcaagtatgaaatgtcagcttaattttattgctgtccttatctaatgtcttatgctctgttttataaaatttggttgcattttctcccccagggaaaaatcttgtataagtgtgttatgtacttatgtgtataaaatcttgttgcacttgtatgtcacacttaggccctgtttagatcctccaaaatggcagtttgccattttgaagaaccttttgccattttggatctaaacactagtaacaaaacttggcaatttggcatttggcatttgctagtctatagtagcaaattgtgccaaaaagtgctttggaaccactctctctttctttctctctctcactttagtgctagaatggtaaaagtttaggatgcatctaaacaccaactagtacttttacaatactaaaacttttgccaccaaaacttttgccatttgccatttgctatttcaaatggatctaaacagggccttagcaaatcaccatatgttaaaattaccttgggatgaaaaagaaaaaggaaaccagcattgaagtcttgtttgaaatgcatatgtacttgtaccattacagaaattcttaaaactgctgtcttgacagctacttatcaaacagccccacctgcatcataacgttcctagtggtgcctataactctgcctcagttattattttgtggcccactggtccaacaatttgaaaaaaattatattgaactaaatatattgaacagtagtatgacgtcctctttgcttgagttccatattacagctcacagtcctgagatttgtttcaccgattctttccatgcgatgtgcacatattcttattcaatttaaaaaatgaaagcagattatttttaacaagtaacctatcacgttagcttaacattgtatatttgtggtggaattatgtaatattccgatatcgcatttgaagttttgaacatgtgtgctcaaattgagggacacatgactgtagtgaaagcaaatataaatgtctgagcaatggactatactttgtattcattactacaagttatgtccttttgcaggttgctaatgtcctcttacattacttgtcaggataaatgagtttgttggtacaaaacatgacccactaataccaacgtatggcctctaaactttcagttcccccattttaagcatgttcgctgtttatttacgagttttgacattgttttttccttttccagaaagagaaggaggcacagatcttgccgtctttttcggtggatcgggtatgttttgatccaatatagtttgctcgcaggttctgaggggcaagaacattcaaatatctataatgttttctgttggattcaacattcatcactatttccctcgaaaaaaaagcattcgtcactattggaattgaaagtctgaaagtgcctctagtccctttgtatgttaaaagtcaataaacaagcagtagttttctatatgccacattaatattattgacgcattttaaaaagcaaactagtccagggatgtaatcatctttgttatctaaaactaaaaaaggaaaaactagtgcttttttacattaacattgatttttttgcggctgaaattacatgtagaaactttggcataataatctgtactactgccaaactgagcttttacatggtgaaaatattttccctgcagatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttgatctagatccttttttggttgttgtttttcttgtattttttagttgttaggcctttgattaagttcgaactttcataaatatatggtgtttatcctgtaaagaaatgatgatttcaaggatttttcatagctatgagacgaggttgaacc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069822.1 RefSeq:Os09g0441900]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 9]]&lt;br /&gt;
[[Category:Chromosome 9]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270789</id>
		<title>Os09g0441900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0441900&amp;diff=270789"/>
				<updated>2016-06-23T13:27:22Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;The rice '''''Os09g0441900''''' was identified as '''''DEP1''''' (DENSE AND ERECT PANICLE1) respectively in 2009 by researchers from China&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.(in chronological order).&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
*Natural variation at the ''DEP1'' locus enhances grain yield in rice&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.The rice DEP1 (DENSE AND ERECT PANICLE 1) locus was first identified by two independent research groups with quantitative trait loci analysis to control grain yield, grain numbers per panicle, and panicle morphology.Deletion of the DEP1 gene during rice domestication was proposed to enhance meristematic activity and result in reduced inflorescence internode lengths that thereby increased grain numbers per panicle and, consequently, grain yields.''DEP1'' regulates nitrogen uptake and metabolism and participates in determining the amount and direction of cell division,which in turn controls organ size and shape.It has been suggested to encode a plant-specific G protein γ subunit.The DEP1 protein interacts in vivo with both the Gα(RGA1)and Gβ(RGB1)subunits,and reduced RGA1 or enhanced RGB1 activity inhibits nitrogen responses.The plant G protein complex regulates nitrogen signaling and modulation of heterotrimeric G protein activity provides a strategy for environmentally sustainable increases in rice grain yield&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:cd tolerance.jpg|right|thumb|300px|'''Figure 1.''' ''Impact of the C-terminal half of OsDEP1 on yeast Cd tolerance(from reference&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''OsDEP1'' encoded a highly cysteine (Cys)-rich G protein γ subunit composed of 426 aa,which was initially identified as it conferred cadmium (Cd) tolerance on yeast cells. Of the 426 aa constituting OsDEP1, 120 are Cys residues (28.2%), of which 88 are clustered in the C-terminal half region (aa 170-426).The OsDEP1(170–426) region is necessary and sufficient to confer cadmium (Cd)tolerance on host yeast cells(Figure 1).The Cd responses of transgenic  Arabidopsis plants constitutively expressing OsDEP1,OsDEP1(1–169) or OsDEP1(170–426),were similar to the observations in yeast cells, with  OsDEP1  and OsDEP1(170–426) transgenic plants displaying Cd tolerance but OsDEP1(1–169) plants showing no such tolerance&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;.Cadmium (Cd) is one of the transition metals that is nonessential for almost all living organisms. It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups, thereby inhibiting their growth and development. Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn, Fe, and Ca, of enzymes, signalling intermediates, and transcription factors, especially the zinc-finger type.&lt;br /&gt;
*Arabidopsis AGG3, a DEP1 homologue, was identified as an Arabidopsis heterotrimeric GTP-binding protein (G protein) γ subunit.Unlike the complex mammalian system, Arabidopsis has only one α (GPA1), one β (AGB1), and three γ (AGG1, AGG2, and AGG3) subunits as components of the heterotrimeric G protein system. OsDEP1 is identified as a cDNA clone that confers Cd tolerance to yeast cells. The gene product, OsDEP1, is highly Cys-rich and is a component of the heterotrimeric G protein signalling pathway.&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''GO assignment(s):''' GO:0005882&lt;br /&gt;
&lt;br /&gt;
*DEP1 (Dense and Erect Panicle1) gene encodes an unknown protein containing the PEBP (phosphatidylethanolamine-binding protein) domain which share some homology with the N terminus of GS3.DEP1 is pleiotropically responsible for all three traits: dense panicle, high grain number per panicle and erect panicle. In the case of the rice plant, more tillering equates to more grain-bearing branches. Rice branching determines the number of panicle and grain number per panicle ,and then control the grain yield.We can see the rice tillering at (Figure 6). &lt;br /&gt;
[[File:The tillering of rice.jpg|right|thumb|300px|'''Figure 6.''' ''The tillering of rice.'']]]]&lt;br /&gt;
&lt;br /&gt;
===Mutation===&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*''dep1'' confers an increased number of grains per panicle (and a consequent increase in grain yield).Figure 2 shows the ''DEP1'' and ''dep1'' NIL line field performance.(a) Dense and erect panicle.(b)Increased panicle branching and reduced rachis length. (c)Grain number per main panicle was significantly higher in the presence of ''dep1''&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
[[File:The tillering of rice. .jpg|right|thumb|300px|'''Figure 7.''' ''The tillering of rice(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*The ''dep1-1'' and ''dep1-32'' alleles exhibit insensitive growth to nitrogen input level(Figure 3)&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
* dep1 is the mutant DEP1 allele.The variant involves the replacement of a 637-bp stretch of the middle of exon 5 by 12-bp sequence,which has the effect of creatig a premature stop codon and consequently a loss of 230 residues from C termimus.As showed in (Figure 7)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&lt;br /&gt;
[[File:1 dep-1.jpg|right|thumb|300px|'''Figure 2.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*DEP1 acts as a dominant negative regulator of panicle architecture ad grain number.The near isogenic lines(NILs) carrying a mutated DEP1 (NIL-dep1) exhibit increased number of grain per panicle,shorter infloresence internodes, increased number of both primary and secondary panicle branches,which may result from the enhanced meristematic activity and cell proliferation through regulating OsCKX2&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;(Fig 8. a).&lt;br /&gt;
*But they do not exhibit noticeable change in panical architecture. The experiments are taken as the following several aspects[2]. Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 8.b,c). Close examination of the shoot apex meristem (SAM) showed that the SAM of NIL-dep1 plants was larger than that of NIL-DEP1 plants (Fig 8. 2d). Cells in the uppermost internode of the mature NIL-dep1 culm were shorter than those in NIL-DEP1 plants (Fig 8. 2e). At the same time, cell number across the longitudinal axis of NIL-dep1 plants was higher than in NIL-DEP1 plants (Fig 8. 2f). Taken together, these observations suggest that the dep1 allele enhances meristematic activity and promotes cell proliferation. So dep1 allele enhances meristematic activity and promotes cell proliferation. &lt;br /&gt;
*The activity of axillary meristem in the shoot apex is important for the determination of the extent of panicle branching and hence grain number&amp;lt;ref name=&amp;quot;ref14&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref15&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref16&amp;quot; /&amp;gt;. In NIL-dep1 plants, the Gn1a was clearly downregulated.Gn1a, a major grain number QTL, encodes a cytokinin oxidase/ dehydrogenase, and has been implicated in the regulation of meristematic activity, panicle branching and grain number through its effect on the level of cytokinin. ANIL-Gn1a line had the same number of primary branches as the control line but developed more secondary branches[6,7]. This suggests that dep1 genetically controls the number of both primary branches and secondary branches on primary branches at the panicle top, whereas Gn1a regulates the number of secondary branches on primary branches at the panicle base.&lt;br /&gt;
*Preparing the field performation of DEP1 and dep1, the grain number per mian panicle is higher in the presence of dep1 (Fig 9.c) and there are clear differences in panicle architecture, influorescence internode and panicle length (Fig 9.b,e), and the number of both primary (Fig 4.b,f)and secondary (Fig 4.g) branches per panicle.Furthermore,he grain-weight of NIL-dep1 plants was slightly less than that of NIL-DEP1 plants (Fig 9.h),but the overall grain yield per plant under field conditions was increased(+40.9%) (Fig 9.I).The evidence of grain-fillinf failure in the presence of dep1 is unclear.The vascular system of NIL-dep1 plants appeared rather better developed and their sclerenchyma cell walls were thicker at maturity than those in NIL-DEP1 plants. These traits are favorable for both water transport capacity and the mechanical strength of the stem, both of which are important factors for the breeding of high-yielding, lodging-resistant varieties. Through testing the effect of dep1 on grain yield in an indica background by backcrossing the dep1 segment present in the japonica variety Wuyunjing 7 into the indica variety Zhefu 802. This NIL, ZF 802 (dep1), produced more grains per panicle and out-yielded its recurrent parent. Thus, dep1 is a useful allele for increasing grain yield in rice.&lt;br /&gt;
&lt;br /&gt;
[[File:DEP1 expression and its effect on cell proliferation.jpg|right|thumb|300px|'''Figure 8.''' ''DEP1 expression and its effect on cell proliferation(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
[[File:The phenotype of NIL-dep1 plants.jpg|right|thumb|300px|'''Figure 9.''' ''The phenotype of NIL-dep1 plants(from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
[[File:DEP expression2.jpg|right|thumb|300px|'''Figure 4.''' ''The expression profile of DEP1 during spikelet development (from reference&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*During reproductive development,''DEP1'' was preferentially expressed on the adaxial side of the bract primordium,as well as in the bract primordia of primary and secondary rachis-branches. Within the inflorescence meristem,''DEP1'' was expressed weakly in the carpel and stamen primordia, with patchy expression in the lemma and palea(Figure 4)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*Through GFP-expression fused with dep1, in NIL-dep1, dep1 and DEP1 was detected in nucleis of root,leaf, culm, meristem, with the highest expression in the meristem at the stage of primary and secondary rachis branch formation(Fig 3.b,c)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.&lt;br /&gt;
*''DEP1'' transcript abundance was positively induced by the level of nitrogen supplied&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
===Cellular Location===&lt;br /&gt;
RGB1-GFP, DEP1-GFP,and dep1-1–GFP fusion proteins were detected both on the plasma membrane and within the nucleus of transgenic rice root cells&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
==Evolution==&lt;br /&gt;
*Pedigree records show that many high-yielding Chinese japonica varieties, including Shennong 265, were derived from the Italian land race Balilla13,15, which was extensively cultivated in Italy in the 1970s and introduced into China in 1958&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;.&lt;br /&gt;
Genetic diversity analysis suggests that ''DEP1'' has been subjected to artificial selection during ''Oryza sativa'' spp.''japonica'' rice domestication&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;.&lt;br /&gt;
*The allelic constitution at the DEP1 locus was explored by resequencing from a panel of widely cultivated Chinese varieties (69 japonica and 83 indica)&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;.This truncated mutation was present in Balilla and all 36 japonica types having an erect or semierect panicle, including super high-yielding cultivars Liaojing 5 and Qianchonglang,but it was absent from all the other varieties. Thus, this natural allelic variation in DEP1 has clearly been exploited by japonica breeding programs in China.Several sequence variants at the DEP1 C terminus were present in the sample of indica types. The variety 93-11 differed from the japonica variety Nipponbare by three amino acids, whereas that of the variety Teqing differed by two amino acids. The Nipponbare sequence differed from that of an accession of Oryza rufipogon by one nucleotide at position 663, but this did not produce a variant peptide. We investigated the structure of the homologs of DEP1 in other smallgrain cereals&amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;. Several truncated C-terminal deletions were observed in barley, and in bread wheat and its diploid wild progenitor Triticum urartu. To determine whether any novel gain-of-function was induced by the presence of these truncated genes, we generated a number of transgenic wheat plants carrying a pUbi:RNAi-TaDEP1 construct. The consequent downregulation of TaDEP1 resulted in an increase in the length of the ear, a less compact ear and a somewhat reduced number of spikelets. This suggests that a functionally equivalent mutation may have occurred early in the divergence of the wheat and barley lineages.&lt;br /&gt;
&lt;br /&gt;
==Extension==&lt;br /&gt;
[[File:reponses to Cd.jpg|right|thumb|300px|'''Figure 5.''' ''Plant responses to Cd stress (from reference&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Heterotrimeric_G_proteins Heterotrimeric G proteins] are multisubunit, integral membrane signal-transduction complexes that mediate intracellular responses to external stimuli in diverse eukaryotic organisms&amp;lt;ref name=&amp;quot;ref5&amp;quot; /&amp;gt;.G proteins typically consist of α, β and γ subunits&amp;lt;ref name=&amp;quot;ref6&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref7&amp;quot; /&amp;gt;.Gβγ acts as a functional monomer,and Gβ-mediated processes require a γ subunit&amp;lt;ref name=&amp;quot;ref8&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref9&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref10&amp;quot; /&amp;gt;.&lt;br /&gt;
*[http://en.wikipedia.org/wiki/Cadmium Cadmium] (Cd)is one of the transition metals that is non-essential for almost all living organisms.It is also a noxious compound that inactivates and denatures structural and functional proteins of organisms by binding to free sulfhydryl groups,thereby inhibiting their growth and development.Another aspect of Cd toxicity is derived from its chemical similarity to metal co-factors or coordinated metals, such as Zn,Fe,and Ca, of enzymes,signalling intermediates,and transcription factors,especially the zinc-finger type&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref11&amp;quot; /&amp;gt;. To cope with Cd toxicity effects,plants are known to be equipped with the potential to chelate and extrude Cd,to sequester Cd into vacuoles, and to dissipate reactive oxygen species triggered by Cd(Figure 5)&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;.For the chelation of heavy metals, including Cd,various cysteine (Cys)-rich proteins are employed by plants.Small Cys-rich peptides,called metallothioneins (MTs),are the major chelators of Cd&amp;lt;ref name=&amp;quot;ref12&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref13&amp;quot; /&amp;gt;.&lt;br /&gt;
&lt;br /&gt;
Comparison of OsDEP1 and other Cys-rich proteins involved in Cd tolerance:Several other studies have previously identified Cys-rich proteins that can provide enhanced tolerance to Cd toxicity. DcCDT1 from D. ciliaris is a 55 aa peptide of which 15 residues (27%) are Cys. The protein is localized to the cytoplasmic membrane and appears to function in the chelation and possible extrusion of Cd, as transgenic DcCDT1 plants accumulate considerably less Cd than controls.Considering that OsDEP1 is a Gγ subunit, it is likely that it is localized to the inside of cytoplasmic membranes, whereas DcCDT1 may be oriented to the outside of the cytoplasmic membrane. Such a possibility would explain the observed differences in Cd uptake between the DcCDT1- and OsDEP1-expressing transgenic plants.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
*The State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou, China.&lt;br /&gt;
*The State Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai, China.&lt;br /&gt;
*Institute of Technical Biology and Agriculture Engineering, Hefei Institutes of Physical Science, Chinese Academy of Sciences, Hefei, China.&lt;br /&gt;
*The State Key Laboratory of Genetic Resources and Evolution, Kunming Institute of Zoology, Chinese Academy of Sciences, Kunming, China.&lt;br /&gt;
*Graduate School of Life Sciences, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi 980-8577, Japan.&lt;br /&gt;
*National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan.&lt;br /&gt;
*Faculty of Bioresource Sciences, Akita Prefectural University, 241-7 Kaidobata Nishi, Akita 010-1095, Japan.&lt;br /&gt;
*Biodiversity and Climate Research Center (BiK-F), D-60323 Frankfurt, Germany.&lt;br /&gt;
*The State Key Laboratory of Plant Cell and Chromosome Engineering, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, National Centre for Plant Gene Research, Beijing, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;&lt;br /&gt;
Huang X, Qian Q, Liu Z, et al. Natural variation at the ''DEP1'' locus enhances grain yield in rice[J]. Nature genetics, 2009, 41(4): 494-497.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Sun H, Qian Q, Wu K, et al. Heterotrimeric G proteins regulate nitrogen-use efficiency in rice[J]. Nature genetics, 2014.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt; Kunihiro S, Saito T, Matsuda T, et al. Rice ''DEP1'', encoding a highly cysteine-rich G protein γ subunit, confers cadmium tolerance on yeast cells and plants[J]. Journal of experimental botany, 2013, 64(14): 4517-4527.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;DalCorso G, Farinati S, Maistri S, et al. How plants cope with cadmium: staking all on metabolism and gene expression[J]. Journal of integrative plant biology, 2008, 50(10): 1268-1280.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref5&amp;quot;&amp;gt;New D C, Wong J T Y. The evidence for G-protein-coupled receptors and heterotrimeric G proteins in protozoa and ancestral metazoa[J]. Neurosignals, 1998, 7(2): 98-108.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref6&amp;quot;&amp;gt;Perfus-Barbeoch L, Jones A M, Assmann S M. Plant heterotrimeric G protein function: insights from ''Arabidopsis'' and rice mutants[J]. Current opinion in plant biology, 2004, 7(6): 719-731.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref7&amp;quot;&amp;gt;Jones J C, Duffy J W, Machius M, et al. The crystal structure of a self-activating G protein α subunit reveals its distinct mechanism of signal initiation[J]. Science signaling, 2011, 4(159): ra8.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref8&amp;quot;&amp;gt;Ford C E, Skiba N P, Bae H, et al. Molecular basis for interactions of G protein βγ subunits with effectors[J]. Science, 1998, 280(5367): 1271-1274.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref9&amp;quot;&amp;gt;Ullah H, Chen J G, Young J C, et al. Modulation of cell proliferation by heterotrimeric G protein in ''Arabidopsis''[J]. Science, 2001, 292(5524): 2066-2069.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref10&amp;quot;&amp;gt;Trusov Y, Rookes J E, Tilbrook K, et al. Heterotrimeric G protein γ subunits provide functional selectivity in Gβγ dimer signaling in ''Arabidopsis''[J]. The Plant Cell Online, 2007, 19(4): 1235-1250.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref11&amp;quot;&amp;gt;Verbruggen N, Hermans C, Schat H. Mechanisms to cope with arsenic or cadmium excess in plants[J]. Current opinion in plant biology, 2009, 12(3): 364-372.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref12&amp;quot;&amp;gt; Ecker D J, Butt T R, Sternberg E J, et al. Yeast metallothionein function in metal ion detoxification[J]. Journal of Biological Chemistry, 1986, 261(36): 16895-16900.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref13&amp;quot;&amp;gt;Freisinger E. Plant MTs—long neglected members of the metallothionein superfamily[J]. Dalton Transactions, 2008 (47): 6663-6675.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref14&amp;quot;&amp;gt;Rao, N.N., Prasad, K., Kumar, P.R. &amp;amp; Vijayraghavan, U. Distinct regulatory role for RFL,the rice LFY homolog, in determining flowering time and plant architecture[J]. Proc. Natl. Acad. Sci. USA 105, 3646–3651 (2008).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref15&amp;quot;&amp;gt;Kellogg, E.A. Floral displays: genetic control of grass inflorescences[J]. Curr. Opin. Plant Biol. 10, 26–31 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref16&amp;quot;&amp;gt;Kurakawa, T. et al. Direct control of shoot meristem activity by a cytokinin activating enzyme[J]. Nature 445, 652–655 (2007).&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{JaponicaGene|&lt;br /&gt;
GeneName = Os09g0441900|&lt;br /&gt;
Description = Whey acidic protein, core region domain containing protein|&lt;br /&gt;
Version = NM_001069822.1 GI:115479386 GeneID:4347178|&lt;br /&gt;
Length = 4701 bp|&lt;br /&gt;
Definition = Oryza sativa Japonica Group Os09g0441900, complete gene.|&lt;br /&gt;
Source = Oryza sativa Japonica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Japonica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|&lt;br /&gt;
AP = Chromosome 9:17064862..17069562|&lt;br /&gt;
CDS = 17065265..17065393,17066606..17066664,17067820..17067864,17067951..17067995,17068411..17069413&amp;lt;br&amp;gt;|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=NC_008402:17064862..17069562&lt;br /&gt;
source=RiceChromosome09&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;atgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagataaatgagtttgttggtacaaaacatgacccactaataccaacaaagagaaggaggcacagatcttgccgtctttttcggtggatcggatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttga&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MGEEAVVMEAPRPKSPPRYPDLCGRRRMQLEVQILSREITFLKD                     ELHFLEGAQPVSRSGCIKEINEFVGTKHDPLIPTKRRRHRSCRLFRWIGSKLCICISC                     LCYCCKCSPKCKRPRCLNCSCSSCCDEPCCKPNCSACCAGSCCSPDCCSCCKPNCSCC                     KTPSCCKPNCSCSCPSCSSCCDTSCCKPSCTCFNIFSCFKSLYSCFKIPSCFKSQCNC                     SSPNCCTCTLPSCSCKGCACPSCGCNGCGCPSCGCNGCGCPSCGCNGCGLPSCGCNGC                     GSCSCAQCKPDCGSCSTNCCSCKPSCNGCCGEQCCRCADCFSCSCPRCSSCFNIFKCS                     CAGCCSSLCKCPCTTQCFSCQSSCCKRQPSCCKCQSSCCEGQPSCCEGHCCSLPKPSC                     PECSCGCVWSCKNCTEGCRCPRCRNPCCLSGCLC&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;404..532#1745..1803#2959..3003#3090..3134#3550..4552#tctcttccctctctctctttctctctccaaaccccacgcacgccgcgtcgccgcctcctcctctccatctccgctgctattattgcccgcgcagacgcaggccaccatccttcctctcgctcacgctcgctgctatatgggggtcctcctcatcgcatcgcatcgcatcacctcgcacgggcgcgcgcgccgtgccgtgccgctagctcgatccgcctcgtacgccagctcgctcgctcgctcccccaccccgctgctgcacggctgcgcccgcgctgtcccctgtccccccgctcgccgcggcgatttatacccaccacgccccctgctgctgctataatgcccatgagtgaaggcggcgaggggtggttctgagttggccgttggcgtgctgcgtgtggagatgggggaggaggcggtggtgatggaggcgccgaggcccaagtcgccgccgaggtacccggacctgtgcggccggcggcggatgcagctggaggtgcagatcctgagccgcgagatcacgttcctcaaggtgagcgccccgcggcggcggcggctgcgtttttctctataggtttctctttcacactcgctcgctcgaaattctcggggcccgagctctacttgcttcgtcttcctttgactttaccgattaattttaaaaaaaaggagatccgattcgccgcgcatttttcaaaacccaagcggccgagtacggagctacccgctactgcaagtaggatgctgtgaagtgtacagtaatggcgttgttaattgcggtagctagtgctattctagtacttgtagtactgtttctaggcggaggtgaatcacggcgccatcaatccgaggctggcgagacaagcttggccctctttgggcgtggcgccatggctgtactacctttgtcgttgtttggttgggctcctcgttggagaaaagaagagcgtgggcatggacaactgacctgagtggccttgtcagggagagccatagcagtggacgtgtctatctccgccattgcttcgtcgacactggacgtgcagacggcatggccatgagggctttgcacgatgggtggtgccgtgttggtgttatgggctgccaccatggtttgaggcttttgatgttgctagattttgtgtttaacgagggagggaagaatgtgttgttcttgacactgtgctgtgcttttaaggagcagagatttcagaagctcttcagatatcagagaacttctttgtagtagtaatcaaatgcgctttagacatctttttatcgtttcttgcaaggtcagtccctgctttggtacccgatctcgcttttgtgcaacatcaaagttacacttacacagtaaagcaggaatctttatgggaccgttcgtactggtcaattactccaggctttgattaatgggttttaagttttaaccgcagatttggtacaagtaacaacctttatttactttttatttctgcaactgtgtcttttaacatgaaagaatccagctccattcaaaagtttagtttttattttccattgtggtgcatggtcactcagcctgcagtactgaattatcaaaattttcttttgtcatttctctcatgttaagtgcatagtctattttacttcaacaggtagaaaaacttttgtgggtttgtttctagctcaaggaggaaattcatgggtttgcatctagcacatgagagaacaatattggtctaacacaaagctccttttgtaggatgagcttcacttccttgaaggagctcagcccgtttctcgttctggatgcattaaagagtatgtactactgcccttcatgcattacagatattttgtttttaagtttttagaaatttgaagagcttatgtcaagtatgaaatgtcagcttaattttattgctgtccttatctaatgtcttatgctctgttttataaaatttggttgcattttctcccccagggaaaaatcttgtataagtgtgttatgtacttatgtgtataaaatcttgttgcacttgtatgtcacacttaggccctgtttagatcctccaaaatggcagtttgccattttgaagaaccttttgccattttggatctaaacactagtaacaaaacttggcaatttggcatttggcatttgctagtctatagtagcaaattgtgccaaaaagtgctttggaaccactctctctttctttctctctctcactttagtgctagaatggtaaaagtttaggatgcatctaaacaccaactagtacttttacaatactaaaacttttgccaccaaaacttttgccatttgccatttgctatttcaaatggatctaaacagggccttagcaaatcaccatatgttaaaattaccttgggatgaaaaagaaaaaggaaaccagcattgaagtcttgtttgaaatgcatatgtacttgtaccattacagaaattcttaaaactgctgtcttgacagctacttatcaaacagccccacctgcatcataacgttcctagtggtgcctataactctgcctcagttattattttgtggcccactggtccaacaatttgaaaaaaattatattgaactaaatatattgaacagtagtatgacgtcctctttgcttgagttccatattacagctcacagtcctgagatttgtttcaccgattctttccatgcgatgtgcacatattcttattcaatttaaaaaatgaaagcagattatttttaacaagtaacctatcacgttagcttaacattgtatatttgtggtggaattatgtaatattccgatatcgcatttgaagttttgaacatgtgtgctcaaattgagggacacatgactgtagtgaaagcaaatataaatgtctgagcaatggactatactttgtattcattactacaagttatgtccttttgcaggttgctaatgtcctcttacattacttgtcaggataaatgagtttgttggtacaaaacatgacccactaataccaacgtatggcctctaaactttcagttcccccattttaagcatgttcgctgtttatttacgagttttgacattgttttttccttttccagaaagagaaggaggcacagatcttgccgtctttttcggtggatcgggtatgttttgatccaatatagtttgctcgcaggttctgaggggcaagaacattcaaatatctataatgttttctgttggattcaacattcatcactatttccctcgaaaaaaaagcattcgtcactattggaattgaaagtctgaaagtgcctctagtccctttgtatgttaaaagtcaataaacaagcagtagttttctatatgccacattaatattattgacgcattttaaaaagcaaactagtccagggatgtaatcatctttgttatctaaaactaaaaaaggaaaaactagtgcttttttacattaacattgatttttttgcggctgaaattacatgtagaaactttggcataataatctgtactactgccaaactgagcttttacatggtgaaaatattttccctgcagatcaaaattgtgtatctgcatttcatgtctttgctactgttgcaagtgctcacccaagtgcaaaagaccaaggtgcctcaattgttcttgcagctcatgctgcgacgagccatgctgtaagccaaactgcagtgcgtgctgcgctgggtcatgctgtagtccagactgctgctcatgctgtaaacctaactgcagttgctgcaagaccccttcttgctgcaaaccgaactgctcgtgctcctgtccaagctgcagctcatgctgcgatacatcgtgctgcaaaccgagctgcacctgcttcaacatcttttcatgcttcaaatccctgtacagctgcttcaagatcccttcatgcttcaagtcccagtgcaactgctctagccccaattgctgcacttgcacccttccaagctgtagctgcaagggctgtgcctgtccaagctgtggatgcaacggctgtggctgtccaagctgcggatgcaacggttgtggctgtccaagctgcggttgcaacggctgtggccttccaagctgcggttgcaacggctgcggctcgtgctcttgcgcccaatgcaaacccgattgtggctcgtgctctaccaattgctgtagctgcaagccaagctgcaacggctgctgcggcgagcagtgctgccgctgcgcggactgcttctcctgctcgtgccctcgttgctccagctgcttcaacatcttcaaatgctcctgcgctggctgctgctcgagcctgtgcaagtgcccctgcacgacgcagtgcttcagctgccagtcgtcatgctgcaagcggcagccttcgtgctgcaagtgccagtcgtcttgctgcgaggggcagccttcctgctgcgagggacactgctgcagcctcccgaaaccgtcgtgccctgaatgttcctgtgggtgtgtctggtcttgcaagaattgtacagagggttgtcgatgcccacggtgtcgtaacccatgctgtctcagtggttgcttatgttgatctagatccttttttggttgttgtttttcttgtattttttagttgttaggcctttgattaagttcgaactttcataaatatatggtgtttatcctgtaaagaaatgatgatttcaaggatttttcatagctatgagacgaggttgaacc&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069822.1 RefSeq:Os09g0441900]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Japonica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Japonica Group]]&lt;br /&gt;
[[Category:Japonica Genes]]&lt;br /&gt;
[[Category:Japonica Chromosome 9]]&lt;br /&gt;
[[Category:Chromosome 9]]&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270778</id>
		<title>Os03g0646900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270778"/>
				<updated>2016-06-23T07:33:43Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* one sentence summary */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== '''One sentence summary''' ==&lt;br /&gt;
* GL3.1 encodes a protein phosphatase kelch (PPKL) family — Ser/Thr phosphatase and GL3.1 is a member of the large grain WY3 variety, which is associated with weaker dephosphorylation activity than the small grain FAZ1 variety GL3.1&lt;br /&gt;
&lt;br /&gt;
== '''Annotated Information''' ==&lt;br /&gt;
&lt;br /&gt;
'''2.1 Fine-mapping of a new QTL, GL3.1, which regulates rice grain yield'''&lt;br /&gt;
[[File:fig2.1.jpg|right|thumb|550px|''fig2.1 Map-based cloning of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
* Fengaizhan-1 (FAZ1) and Waiyin-3 (WY3) rice varieties were selected as parents to map the QTLs that affect grain length. FAZ1 is a small grain indica variety (1 000-grain weight: 20.18 ± 0.89 g), whereas WY3 is a larger grain japonica variety (1 000-grain weight: 43.40 ± 0.92 g; Figure 1A). We fine-mapped a new major QTL (GL3.1) for grain length to a 20-kb region between the L012 and L008 markers on chromosome 3 (25 036 192 bp to 25 060 567 bp at chromosome 3) (Figure 1B), which is distinct from other previously reported QTLs [35-38]. This region contains two genes: Os03g44510, which is a predicted transposon that was excluded from further analysis because the transcript was not detected in both parents, and the predicted phosphatase Os03g44500, which was expressed in both parents and considered as the GL3.1 candidate. Based on the mapping results, we developed a nearisogenic line (NIL) from BC4F2 generations that contained a 30-kb WY3 chromosomal region at the GL3.1 locus in a FAZ1 genetic background (Figure 1C; Supplementary information, Figure S1A-S1C). &lt;br /&gt;
* NIL had longer grains (+16.1%) than FAZ1 (10.71 ± 0.13 mm vs 9.22 ± 0.09 mm), but there were no significant differences in grain width or thickness (Figure 1D-1F), plant height or tiller number (Supplementary information, Figure S1DS1E). NIL had a significantly greater 1 000-grain weight than FAZ1 (+43.5%; Figure 1G) and reduced grain number per main panicle (21.3%, Supplementary information, Figure S1F). NIL exhibited an increase in the milk filling rate (Figure 1H-1I) and higher expression of milk filling-related genes (Supplementary information, Figure S1G). The plot grain yield was significantly increased in NIL (+ 11.1%; Figure 1J); however, the grain quality was not affected, as the packing density of starch granules was similar in the mature seeds of NIL and FAZ1 (Supplementary information, Figure S1H-S1I), and the chalky grain percentage and protein and amylose contents were similar between the NIL and FAZ1 grains (Supplementary information, Figure S1J-S1L). &lt;br /&gt;
* We crossed NIL with Huanghuazhan, which is a relatively high-yield elite indica variety that is widely cultivated in Southern China, and subsequently backcrossed the F1 generation with Huanghuazhan to obtain a Huanghuazhan (GL3.1) variety that exhibited a longer and heavier grain (Supplementary information, Figure S2A-S2E) and a higher grain yield than Huanghuazhan under field conditions (Supplementary information, Figure S2F). These findings confirmed that GL3.1 potentially increases grain yield. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''2.2 Confirmation of GL3.1 function'''&lt;br /&gt;
[[File:fig2.2.jpg|right|thumb|150px|''Figure 2.2 Transgenic analysis of GL3.1.(from reference &amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
GL3.1 contains a 3 012-bp open reading frame (ORF) that encodes 21 exons and 20 introns. The FAZ1 GL3.1 allele contains 4-bp differences when compared with the WY3 GL3.1 allele (FAZ1 to WY3: 1092C-A, 1495CT, 2643A-G, 2838T-C), which results in two amino acid substitutions (364 aspartic acid — glutamic acid (364DE), 499 histidine — tyrosine (499H-Y); Figure 2A). We sequenced GL3.1 in several large grain varieties and detected the japonica variety Nanyangzhan with a truncated GL3.1 allele as well as Jizi1560 and Jizi1581, which contained 15 additional amino acids at the C-terminus compared with FAZ1 and WY3. At the positions 364 and 499, Jizi1560 and Jizi1581 exhibited the same amino acid substitutions as WY3 (Supplementary information, Figure S3). Transgenic rice plants were generated to determine whether GL3.1 controls grain length. FAZ1 and WY3 failed to regenerate shoots from the callus, and therefore we used the small-grain japonica variety Zhonghua 11, which was easily regenerated [39]. We generated constructs containing the full-length GL3.1 ORFs from FAZ1 or WY3 under the CaMV 35S promoter. Some of the obtained transgenic lines that overexpressed the WY3 GL3.1 allele showed an increased grain length (GL3.1-WY3), whereas the grain length was not changed in all lines overexpressing the FAZ1 GL3.1 allele (GL3.1-FAZ1; data not shown). Only the GL3.1- WY3 line, which expressed relatively high levels of GL3.1-WY3, exhibited increases in grain length (Figure 2B-2D, Supplementary information, Figure S4A-S4B), which confirms that GL3.1 controls grain length. GL3.1- FAZ1 RNA interference (RNAi) and antisense transgenic plants were generated; however, no phenotypic changes in grain length were observed (data not shown). We also observed that GL3.1 was downregulated but not completely suppressed in these lines; therefore, we hypothesized that these lines retained adequate GL3.1 function, as GL3.1 was abundantly expressed.&lt;br /&gt;
GL3.1 is predicted to encode a Ser/Thr phosphatase of unknown function and with two predicted domains: a Kelch_1 protein interaction domain and a Ser/Thr phosphatase domain (Figure 2A). Transgenic plants were generated to investigate the effect of the GL3.1 point substitutions GL3.1-M1 (364E, 499H) and GL3.1-M2 (364D, 499Y) in FAZ1 and WY3. Both transgenic lines exhibited significant increases in grain length (Supplementary information, Figure S4C-S4H). Similar to the GL3.1-WY3 transgenic lines, only high levels of GL3.1- M1 or GL3.1-M2 overexpression led to enhanced grain length. These results suggest that the 364D-E and 499HY substitutions both influence the function of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.3 GL3.1 functions as a Ser/Thr phosphatase'''&lt;br /&gt;
[[File:fig2.3.jpg|right|thumb|150px|''Figure 3 Expression pattern and molecular function of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
Although some nucleotides were different between the promoters of FAZ1 and WY3, the GL3.1 expression pattern remained similar (Supplementary information, Figure S5). GL3.1 was expressed in all organs and developmental stages tested in FAZ1 and NIL (Supplementary information, Figure S6A-S6C). Notably, expression of GL3.1 was higher in the panicle of NIL at the heading stage than in the panicle of FAZ1 (Figure 3A) and lower in the calluses from FAZ1 and NIL, which primarily con- sist of dividing cells (Supplementary information, Figure S6D). GL3.1 in both parents was detected throughout the entire cell (Figure 3B). Purified GL3.1-FAZ1 and GL3.1- WY3 dephosphorylated myelin basic protein (MyBP; a standard substrate) in vitro, which demonstrates that GL3.1 is a functional Ser/Thr phosphatase (Figure 3C); however, GL3.1-FAZ1 exhibited higher activity than GL3.1-WY3. In addition, GL3.1 from Nanyangzhan (GL3.1-NYZ) did not show dephosphorylation ability (Figure 3C). GL3.1 was insensitive to both okadaic acid (OA) and Inhibitor 2 (Figure 3D), which suggests that GL3.1 may encode a novel type of PPKL, as the PPKL and PP1 enzymes are generally sensitive to Inhibitor 2 [27], whereas the PPKL family member BSU1 is sensitive to OA [32]. Furthermore, we observed that the phosphatase domain of GL3.1 was also not sensitive to these two inhibitors (Supplementary information, Figure S6E). A comparative analysis of phosphatases that are typically sensitive to OA revealed that 929G in GL3.1 conferred resistance to OA (Supplementary information, Figure S7). According to a previous study [40] in rats, PP2Aα is sensitive to OA, but the Y267G mutant of this protein is resistant to OA, which indicates that Y267G is a key mutation for OA resistance. Alignment analysis revealed that 267Y in rat PP2Aα corresponds to 929G in GL3.1, which suggests that GL3.1 harbors a Y to G mutation at this key site that may be responsible for the OA insensitivity of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.4 GL3.1 regulates spikelet hull cell division'''&lt;br /&gt;
[[File:fig2.4.jpg|right|thumb|150px|''Figure 4 GL3.1 alters spikelet hull cell division to regulate grain length. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
We measured the lemma cell length to determine whether GL3.1 regulates grain length. There were no significant differences in cell length at the central point of the lemma in the vertical orientation (Figure 4A-4B, Supplementary information, Figure S6F) and the distance between tubercles at the outer spikelet hull surface (Figure 4C-4D, Supplementary information, Figure S6G), which indicates that cell length is not responsible for the difference in grain length between FAZ1 and NIL. As the FAZ1 and NIL life cycles and heading days are similar, we hypothesized that an increased rate of cell division may be responsible for the longer spikelet hull in NIL. Therefore, we assessed the cell division rate during different developmental stages of the spikelet hull in the two parents. The detection points were set at the stages when the spikelet hull length reached 25%, 50%, 65%, 80% and 100% of the full spikelet hull length in FAZ1 and NIL, and the percentage of cells with 4C DNA content in the spikelet hull as well as the cell lengths at the central zone of the spikelet hull at these points were also recorded (Figure 4E, Supplementary information, Figure S6F). At the five detection points, the cell length in the vertical orientation was not different between FAZ1 and NIL. Notably, at 50% of full spikelet hull length, the percentage of cells with a 4C DNA content was significantly higher in NIL than in FAZ1 (Figure 4E). Consistent with this, the expression of cell cycle-related genes was significantly higher in the NIL than in the FAZ1 spikelet (Figure 4F). Therefore, we propose that rapid cell division occurs in NIL during spikelet hull development. Furthermore, we synchronized cells from FAZ1 and NIL using hydroxycarbamide, which blocks cell division at the G1/S boundary. 8 h after release from hydroxycarbamide, the expression of Histone H4 was maximal in FAZ1 and NIL (Supplementary information, Figure S6H), which suggests that the cells from FAZ1 and NIL had entered the S phase. In addition, a higher percentage of cells with 4C DNA content and a lower percentage of cells in S phase were observed in NIL when compared with FAZ1 (Figure 4G-4I), which implies that more cells from NIL completed DNA duplication. We also observed that the maximal expression of CYCD4;1, which was expressed from early G2 phase to M phase, was earlier in NIL (28 h after release) than in FAZ1 (32 h after release) (Supplementary information, Figure S6I), which implies faster entry into the G2 phase in NIL cells. Furthermore, we synchronized cells from FAZ1 and NIL using nocodazole, which blocks cell division at the G2/M boundary. The expression of CYCD3;1, which is specifically expressed at the G1/S stage, remained the same between FAZ1 and NIL (Supplementary information, Figure S6J), which implies that the transformation from the G2 phase to G1 phase was not different between the two parents. These results suggest that the transformation from G1 to G2 may be accelerated in NIL. Thus, our results collectively demonstrate that the GL3.1-WY3 allele increases the rate of cell division during spikelet hull development compared with the GL3.1-FAZ1 allele, which results in a longer spikelet hull. &lt;br /&gt;
&lt;br /&gt;
'''2.5 GL3.1 interacts with Cyclin-T1;3 to regulate grain length'''&lt;br /&gt;
[[File:fig2.5.jpg|right|thumb|150px|''Figure5 GL3.1 and Cyclin-T13 interact(from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
To determine the mechanism underlying the GL3.1- mediated regulation of grain size, a yeast two-hybrid system was used to screen a cDNA library constructed from Zhonghua 11 spikelets using GL3.1-FAZ1 as bait. We identified 23 interacting proteins, of which Os11g05850, annotated as Cyclin-T1;3, was selected for further analysis (Figure 5A). The expression of Cyclin-T1;3 was localized to the nucleus of Arabidopsis protoplasts (Figure 5B), which was consistent with the expression pattern observed in humans. When GL3.1 was co-expressed with Cyclin-T1;3, increased accumulation of GL3.1 was observed in the nuclei from both parents when compared with expression without Cyclin-T1;3 (Figures 5C and 3B). We confirmed that GL3.1 dephosphorylated Cyclin-T1;3 in vitro. GL3.1-FAZ1 exhibited stronger Cyclin-T1;3 dephosphorylation activity than GL3.1- WY3, GL3.1-M1 and GL3.1-M2 (Figure 5D), which was consistent with the effects observed for the common substrate MyBP (Figure 3C). As the kelch-repeat domain has demonstrated potential for protein interactions [41], we used a bimolecular fluorescence complementation (BiFC) assay to identify such interactions. GL3.1ΔP, which contains a kelch-repeat domain, interacted with Cyclin-T1;3 in the absence of the GL3.1 Ser/Thr phosphatase domain (Figure 5E). In addition, Cyclin-T1;3 was constitutively expressed in various tissues and organs in a pattern similar to that of GL3.1 (Supplementary information, Figure S8A-S8D). These results demonstrate that Cyclin-T1;3 interacts with GL3.1 and is dephosphorylated through GL3.1. &lt;br /&gt;
Real-time PCR was performed to analyze the expression of Cyclin-T1;3 after cell synchronization. In contrast to the high expression levels observed at 16 h and 32 h in FAZ1 cells, Cyclin-T1;3 showed increased expression at 8 h and 28 h in NIL cells (Figure 5F). At these two specific points, the cells were entering the S and G2 phases, respectively, which indicates that Cyclin-T1;3 may be involved in cell cycle control. Moreover, we used transgenic rice plants to determine whether Cyclin-T1;3 influences grain size. No obvious phenotype was observed when we overexpressed Cyclin-T1;3 in Zhonghua 11. However, antisense strands of Cyclin-T1;3 resulted in smaller grain sizes in the transgenic plants as well as reduced expression of CyclinT1;3 (Figure 5G-5I). Thus, our data indicate that Cyclin-T1;3 is involved in the GL3.1-mediated regulation of grain length.&lt;br /&gt;
&lt;br /&gt;
'''2.6 GL3.1 is a widespread gene that influences protein phosphorylation in vivo'''&lt;br /&gt;
[[File:fig2.6.jpg|right|thumb|150px|''Figure 6 GL3.1 influences protein phosphorylation status as a potential model for grain size control. (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
A quantitative proteomic analysis using two-dimensional difference gel electrophoresis (2-D DIGE) indicated that 21 proteins were differentially expressed in FAZ1 and NIL, of which 18 were upregulated in NIL (Supplementary information, Table S1). Mass spectrometry revealed that the 21 proteins were associated with cellular metabolic processes. Interestingly, actin was upregulated in NIL, which is consistent with the observation that GL3.1 influences the rate of cell proliferation. The phosphopeptides from the young spikelets of FAZ1 and NIL were enriched on the TiO2 beads and quantified using iTRAQ, which confirmed that GL3.1 is a phosphatase. 556 phosphopeptides were detected, and 464 of these molecules were quantified. Proteins showing a 1.5- fold difference between FAZ1 and NIL and demonstrating the same trend when quantified using two different labelling systems were chosen for further analysis. At least 130 proteins demonstrated a different phosphorylation status between FAZ1 and NIL during spikelet development (Figure 6A and Supplementary information, Table S2). Gene ontology analysis revealed that these proteins are primarily involved in processes related to nucleic acid metabolism and protein complex assembly (Figure 6B and Supplementary information, Table S3). The molecular functions of these proteins include nucleotide binding and the activities of phosphotransferases, helicases and the RNA polymerase II transcription factor. These results strongly suggest that GL3.1 could influence DNA duplication. Thus, we propose that GL3.1 regulates the expression and phosphorylation of a variety of genes involved in metabolism and cell division. Further phylogenetic analyzes based on genomic BLAST searches demonstrated the widespread existence of GL3.1 in plants (Supplementary information, Figure S9), which suggests that GL3.1 has an important conserved function in plants.&lt;br /&gt;
&lt;br /&gt;
== Labs working on this gene ==&lt;br /&gt;
*Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China&lt;br /&gt;
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China&lt;br /&gt;
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi-110021, India&lt;br /&gt;
*RIKEN Plant Science Center (H.N., K.M., A.D., K.S.) and RIKEN Bioinformatics and Systems Engineering Division (Y.Y., T.T.), Tsurumi-ku, Yokohama 230–0045, Japan&lt;br /&gt;
*Institute for Advanced Biosciences, Keio University, Tsuruoka, Yamagata 997–0017, Japan (N.S., M.T., Y.I.)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Peng Qi, You-Shun Lin, Xian-Jun Song.et al. The novel quantitative trait locus GL3.1 controls rice grain size and yield by regulating Cyclin-T1; 3. Cell Research (2012) 22:1666-1680.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Xiaojun Zhang, Jianfei Wang, Ji Huang, Hongxia Lan, Cailin Wang, Congfei Yin, Yunyu Wu, Haijuan Tang, Qian Qian, Jiayang Li, Hongsheng Zhang. Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice. Proc Natl Acad Sci (2012)52: 21534–21539..&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Amarjeet Singh, Jitender Giri, Sanjay Kapoor, Akhilesh K Tyagi, Girdhar K Pandey .Protein phosphatase complement in rice: genome-wide identification and transcriptional analysis under abiotic stress conditions and reproductive development. BMC Genomics(2010)11: 435.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Hirofumi Nakagami, Naoyuki Sugiyama, Keiichi Mochida, Arsalan Daudi, Yuko Yoshida, Tetsuro Toyoda, Masaru Tomita, Yasushi Ishihama, Ken Shirasu .Large-Scale Comparative Phosphoproteomics Identifies Conserved Phosphorylation Sites in Plant.Plant Physiol(2010) 153(3): 1161–1174&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270777</id>
		<title>Os03g0646900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270777"/>
				<updated>2016-06-23T07:33:26Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* one sentence summary */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== '''one sentence summary''' ==&lt;br /&gt;
* GL3.1 encodes a protein phosphatase kelch (PPKL) family — Ser/Thr phosphatase and GL3.1 is a member of the large grain WY3 variety, which is associated with weaker dephosphorylation activity than the small grain FAZ1 variety GL3.1&lt;br /&gt;
&lt;br /&gt;
== '''Annotated Information''' ==&lt;br /&gt;
&lt;br /&gt;
'''2.1 Fine-mapping of a new QTL, GL3.1, which regulates rice grain yield'''&lt;br /&gt;
[[File:fig2.1.jpg|right|thumb|550px|''fig2.1 Map-based cloning of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
* Fengaizhan-1 (FAZ1) and Waiyin-3 (WY3) rice varieties were selected as parents to map the QTLs that affect grain length. FAZ1 is a small grain indica variety (1 000-grain weight: 20.18 ± 0.89 g), whereas WY3 is a larger grain japonica variety (1 000-grain weight: 43.40 ± 0.92 g; Figure 1A). We fine-mapped a new major QTL (GL3.1) for grain length to a 20-kb region between the L012 and L008 markers on chromosome 3 (25 036 192 bp to 25 060 567 bp at chromosome 3) (Figure 1B), which is distinct from other previously reported QTLs [35-38]. This region contains two genes: Os03g44510, which is a predicted transposon that was excluded from further analysis because the transcript was not detected in both parents, and the predicted phosphatase Os03g44500, which was expressed in both parents and considered as the GL3.1 candidate. Based on the mapping results, we developed a nearisogenic line (NIL) from BC4F2 generations that contained a 30-kb WY3 chromosomal region at the GL3.1 locus in a FAZ1 genetic background (Figure 1C; Supplementary information, Figure S1A-S1C). &lt;br /&gt;
* NIL had longer grains (+16.1%) than FAZ1 (10.71 ± 0.13 mm vs 9.22 ± 0.09 mm), but there were no significant differences in grain width or thickness (Figure 1D-1F), plant height or tiller number (Supplementary information, Figure S1DS1E). NIL had a significantly greater 1 000-grain weight than FAZ1 (+43.5%; Figure 1G) and reduced grain number per main panicle (21.3%, Supplementary information, Figure S1F). NIL exhibited an increase in the milk filling rate (Figure 1H-1I) and higher expression of milk filling-related genes (Supplementary information, Figure S1G). The plot grain yield was significantly increased in NIL (+ 11.1%; Figure 1J); however, the grain quality was not affected, as the packing density of starch granules was similar in the mature seeds of NIL and FAZ1 (Supplementary information, Figure S1H-S1I), and the chalky grain percentage and protein and amylose contents were similar between the NIL and FAZ1 grains (Supplementary information, Figure S1J-S1L). &lt;br /&gt;
* We crossed NIL with Huanghuazhan, which is a relatively high-yield elite indica variety that is widely cultivated in Southern China, and subsequently backcrossed the F1 generation with Huanghuazhan to obtain a Huanghuazhan (GL3.1) variety that exhibited a longer and heavier grain (Supplementary information, Figure S2A-S2E) and a higher grain yield than Huanghuazhan under field conditions (Supplementary information, Figure S2F). These findings confirmed that GL3.1 potentially increases grain yield. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''2.2 Confirmation of GL3.1 function'''&lt;br /&gt;
[[File:fig2.2.jpg|right|thumb|150px|''Figure 2.2 Transgenic analysis of GL3.1.(from reference &amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
GL3.1 contains a 3 012-bp open reading frame (ORF) that encodes 21 exons and 20 introns. The FAZ1 GL3.1 allele contains 4-bp differences when compared with the WY3 GL3.1 allele (FAZ1 to WY3: 1092C-A, 1495CT, 2643A-G, 2838T-C), which results in two amino acid substitutions (364 aspartic acid — glutamic acid (364DE), 499 histidine — tyrosine (499H-Y); Figure 2A). We sequenced GL3.1 in several large grain varieties and detected the japonica variety Nanyangzhan with a truncated GL3.1 allele as well as Jizi1560 and Jizi1581, which contained 15 additional amino acids at the C-terminus compared with FAZ1 and WY3. At the positions 364 and 499, Jizi1560 and Jizi1581 exhibited the same amino acid substitutions as WY3 (Supplementary information, Figure S3). Transgenic rice plants were generated to determine whether GL3.1 controls grain length. FAZ1 and WY3 failed to regenerate shoots from the callus, and therefore we used the small-grain japonica variety Zhonghua 11, which was easily regenerated [39]. We generated constructs containing the full-length GL3.1 ORFs from FAZ1 or WY3 under the CaMV 35S promoter. Some of the obtained transgenic lines that overexpressed the WY3 GL3.1 allele showed an increased grain length (GL3.1-WY3), whereas the grain length was not changed in all lines overexpressing the FAZ1 GL3.1 allele (GL3.1-FAZ1; data not shown). Only the GL3.1- WY3 line, which expressed relatively high levels of GL3.1-WY3, exhibited increases in grain length (Figure 2B-2D, Supplementary information, Figure S4A-S4B), which confirms that GL3.1 controls grain length. GL3.1- FAZ1 RNA interference (RNAi) and antisense transgenic plants were generated; however, no phenotypic changes in grain length were observed (data not shown). We also observed that GL3.1 was downregulated but not completely suppressed in these lines; therefore, we hypothesized that these lines retained adequate GL3.1 function, as GL3.1 was abundantly expressed.&lt;br /&gt;
GL3.1 is predicted to encode a Ser/Thr phosphatase of unknown function and with two predicted domains: a Kelch_1 protein interaction domain and a Ser/Thr phosphatase domain (Figure 2A). Transgenic plants were generated to investigate the effect of the GL3.1 point substitutions GL3.1-M1 (364E, 499H) and GL3.1-M2 (364D, 499Y) in FAZ1 and WY3. Both transgenic lines exhibited significant increases in grain length (Supplementary information, Figure S4C-S4H). Similar to the GL3.1-WY3 transgenic lines, only high levels of GL3.1- M1 or GL3.1-M2 overexpression led to enhanced grain length. These results suggest that the 364D-E and 499HY substitutions both influence the function of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.3 GL3.1 functions as a Ser/Thr phosphatase'''&lt;br /&gt;
[[File:fig2.3.jpg|right|thumb|150px|''Figure 3 Expression pattern and molecular function of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
Although some nucleotides were different between the promoters of FAZ1 and WY3, the GL3.1 expression pattern remained similar (Supplementary information, Figure S5). GL3.1 was expressed in all organs and developmental stages tested in FAZ1 and NIL (Supplementary information, Figure S6A-S6C). Notably, expression of GL3.1 was higher in the panicle of NIL at the heading stage than in the panicle of FAZ1 (Figure 3A) and lower in the calluses from FAZ1 and NIL, which primarily con- sist of dividing cells (Supplementary information, Figure S6D). GL3.1 in both parents was detected throughout the entire cell (Figure 3B). Purified GL3.1-FAZ1 and GL3.1- WY3 dephosphorylated myelin basic protein (MyBP; a standard substrate) in vitro, which demonstrates that GL3.1 is a functional Ser/Thr phosphatase (Figure 3C); however, GL3.1-FAZ1 exhibited higher activity than GL3.1-WY3. In addition, GL3.1 from Nanyangzhan (GL3.1-NYZ) did not show dephosphorylation ability (Figure 3C). GL3.1 was insensitive to both okadaic acid (OA) and Inhibitor 2 (Figure 3D), which suggests that GL3.1 may encode a novel type of PPKL, as the PPKL and PP1 enzymes are generally sensitive to Inhibitor 2 [27], whereas the PPKL family member BSU1 is sensitive to OA [32]. Furthermore, we observed that the phosphatase domain of GL3.1 was also not sensitive to these two inhibitors (Supplementary information, Figure S6E). A comparative analysis of phosphatases that are typically sensitive to OA revealed that 929G in GL3.1 conferred resistance to OA (Supplementary information, Figure S7). According to a previous study [40] in rats, PP2Aα is sensitive to OA, but the Y267G mutant of this protein is resistant to OA, which indicates that Y267G is a key mutation for OA resistance. Alignment analysis revealed that 267Y in rat PP2Aα corresponds to 929G in GL3.1, which suggests that GL3.1 harbors a Y to G mutation at this key site that may be responsible for the OA insensitivity of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.4 GL3.1 regulates spikelet hull cell division'''&lt;br /&gt;
[[File:fig2.4.jpg|right|thumb|150px|''Figure 4 GL3.1 alters spikelet hull cell division to regulate grain length. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
We measured the lemma cell length to determine whether GL3.1 regulates grain length. There were no significant differences in cell length at the central point of the lemma in the vertical orientation (Figure 4A-4B, Supplementary information, Figure S6F) and the distance between tubercles at the outer spikelet hull surface (Figure 4C-4D, Supplementary information, Figure S6G), which indicates that cell length is not responsible for the difference in grain length between FAZ1 and NIL. As the FAZ1 and NIL life cycles and heading days are similar, we hypothesized that an increased rate of cell division may be responsible for the longer spikelet hull in NIL. Therefore, we assessed the cell division rate during different developmental stages of the spikelet hull in the two parents. The detection points were set at the stages when the spikelet hull length reached 25%, 50%, 65%, 80% and 100% of the full spikelet hull length in FAZ1 and NIL, and the percentage of cells with 4C DNA content in the spikelet hull as well as the cell lengths at the central zone of the spikelet hull at these points were also recorded (Figure 4E, Supplementary information, Figure S6F). At the five detection points, the cell length in the vertical orientation was not different between FAZ1 and NIL. Notably, at 50% of full spikelet hull length, the percentage of cells with a 4C DNA content was significantly higher in NIL than in FAZ1 (Figure 4E). Consistent with this, the expression of cell cycle-related genes was significantly higher in the NIL than in the FAZ1 spikelet (Figure 4F). Therefore, we propose that rapid cell division occurs in NIL during spikelet hull development. Furthermore, we synchronized cells from FAZ1 and NIL using hydroxycarbamide, which blocks cell division at the G1/S boundary. 8 h after release from hydroxycarbamide, the expression of Histone H4 was maximal in FAZ1 and NIL (Supplementary information, Figure S6H), which suggests that the cells from FAZ1 and NIL had entered the S phase. In addition, a higher percentage of cells with 4C DNA content and a lower percentage of cells in S phase were observed in NIL when compared with FAZ1 (Figure 4G-4I), which implies that more cells from NIL completed DNA duplication. We also observed that the maximal expression of CYCD4;1, which was expressed from early G2 phase to M phase, was earlier in NIL (28 h after release) than in FAZ1 (32 h after release) (Supplementary information, Figure S6I), which implies faster entry into the G2 phase in NIL cells. Furthermore, we synchronized cells from FAZ1 and NIL using nocodazole, which blocks cell division at the G2/M boundary. The expression of CYCD3;1, which is specifically expressed at the G1/S stage, remained the same between FAZ1 and NIL (Supplementary information, Figure S6J), which implies that the transformation from the G2 phase to G1 phase was not different between the two parents. These results suggest that the transformation from G1 to G2 may be accelerated in NIL. Thus, our results collectively demonstrate that the GL3.1-WY3 allele increases the rate of cell division during spikelet hull development compared with the GL3.1-FAZ1 allele, which results in a longer spikelet hull. &lt;br /&gt;
&lt;br /&gt;
'''2.5 GL3.1 interacts with Cyclin-T1;3 to regulate grain length'''&lt;br /&gt;
[[File:fig2.5.jpg|right|thumb|150px|''Figure5 GL3.1 and Cyclin-T13 interact(from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
To determine the mechanism underlying the GL3.1- mediated regulation of grain size, a yeast two-hybrid system was used to screen a cDNA library constructed from Zhonghua 11 spikelets using GL3.1-FAZ1 as bait. We identified 23 interacting proteins, of which Os11g05850, annotated as Cyclin-T1;3, was selected for further analysis (Figure 5A). The expression of Cyclin-T1;3 was localized to the nucleus of Arabidopsis protoplasts (Figure 5B), which was consistent with the expression pattern observed in humans. When GL3.1 was co-expressed with Cyclin-T1;3, increased accumulation of GL3.1 was observed in the nuclei from both parents when compared with expression without Cyclin-T1;3 (Figures 5C and 3B). We confirmed that GL3.1 dephosphorylated Cyclin-T1;3 in vitro. GL3.1-FAZ1 exhibited stronger Cyclin-T1;3 dephosphorylation activity than GL3.1- WY3, GL3.1-M1 and GL3.1-M2 (Figure 5D), which was consistent with the effects observed for the common substrate MyBP (Figure 3C). As the kelch-repeat domain has demonstrated potential for protein interactions [41], we used a bimolecular fluorescence complementation (BiFC) assay to identify such interactions. GL3.1ΔP, which contains a kelch-repeat domain, interacted with Cyclin-T1;3 in the absence of the GL3.1 Ser/Thr phosphatase domain (Figure 5E). In addition, Cyclin-T1;3 was constitutively expressed in various tissues and organs in a pattern similar to that of GL3.1 (Supplementary information, Figure S8A-S8D). These results demonstrate that Cyclin-T1;3 interacts with GL3.1 and is dephosphorylated through GL3.1. &lt;br /&gt;
Real-time PCR was performed to analyze the expression of Cyclin-T1;3 after cell synchronization. In contrast to the high expression levels observed at 16 h and 32 h in FAZ1 cells, Cyclin-T1;3 showed increased expression at 8 h and 28 h in NIL cells (Figure 5F). At these two specific points, the cells were entering the S and G2 phases, respectively, which indicates that Cyclin-T1;3 may be involved in cell cycle control. Moreover, we used transgenic rice plants to determine whether Cyclin-T1;3 influences grain size. No obvious phenotype was observed when we overexpressed Cyclin-T1;3 in Zhonghua 11. However, antisense strands of Cyclin-T1;3 resulted in smaller grain sizes in the transgenic plants as well as reduced expression of CyclinT1;3 (Figure 5G-5I). Thus, our data indicate that Cyclin-T1;3 is involved in the GL3.1-mediated regulation of grain length.&lt;br /&gt;
&lt;br /&gt;
'''2.6 GL3.1 is a widespread gene that influences protein phosphorylation in vivo'''&lt;br /&gt;
[[File:fig2.6.jpg|right|thumb|150px|''Figure 6 GL3.1 influences protein phosphorylation status as a potential model for grain size control. (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
A quantitative proteomic analysis using two-dimensional difference gel electrophoresis (2-D DIGE) indicated that 21 proteins were differentially expressed in FAZ1 and NIL, of which 18 were upregulated in NIL (Supplementary information, Table S1). Mass spectrometry revealed that the 21 proteins were associated with cellular metabolic processes. Interestingly, actin was upregulated in NIL, which is consistent with the observation that GL3.1 influences the rate of cell proliferation. The phosphopeptides from the young spikelets of FAZ1 and NIL were enriched on the TiO2 beads and quantified using iTRAQ, which confirmed that GL3.1 is a phosphatase. 556 phosphopeptides were detected, and 464 of these molecules were quantified. Proteins showing a 1.5- fold difference between FAZ1 and NIL and demonstrating the same trend when quantified using two different labelling systems were chosen for further analysis. At least 130 proteins demonstrated a different phosphorylation status between FAZ1 and NIL during spikelet development (Figure 6A and Supplementary information, Table S2). Gene ontology analysis revealed that these proteins are primarily involved in processes related to nucleic acid metabolism and protein complex assembly (Figure 6B and Supplementary information, Table S3). The molecular functions of these proteins include nucleotide binding and the activities of phosphotransferases, helicases and the RNA polymerase II transcription factor. These results strongly suggest that GL3.1 could influence DNA duplication. Thus, we propose that GL3.1 regulates the expression and phosphorylation of a variety of genes involved in metabolism and cell division. Further phylogenetic analyzes based on genomic BLAST searches demonstrated the widespread existence of GL3.1 in plants (Supplementary information, Figure S9), which suggests that GL3.1 has an important conserved function in plants.&lt;br /&gt;
&lt;br /&gt;
== Labs working on this gene ==&lt;br /&gt;
*Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China&lt;br /&gt;
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China&lt;br /&gt;
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi-110021, India&lt;br /&gt;
*RIKEN Plant Science Center (H.N., K.M., A.D., K.S.) and RIKEN Bioinformatics and Systems Engineering Division (Y.Y., T.T.), Tsurumi-ku, Yokohama 230–0045, Japan&lt;br /&gt;
*Institute for Advanced Biosciences, Keio University, Tsuruoka, Yamagata 997–0017, Japan (N.S., M.T., Y.I.)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Peng Qi, You-Shun Lin, Xian-Jun Song.et al. The novel quantitative trait locus GL3.1 controls rice grain size and yield by regulating Cyclin-T1; 3. Cell Research (2012) 22:1666-1680.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Xiaojun Zhang, Jianfei Wang, Ji Huang, Hongxia Lan, Cailin Wang, Congfei Yin, Yunyu Wu, Haijuan Tang, Qian Qian, Jiayang Li, Hongsheng Zhang. Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice. Proc Natl Acad Sci (2012)52: 21534–21539..&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Amarjeet Singh, Jitender Giri, Sanjay Kapoor, Akhilesh K Tyagi, Girdhar K Pandey .Protein phosphatase complement in rice: genome-wide identification and transcriptional analysis under abiotic stress conditions and reproductive development. BMC Genomics(2010)11: 435.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Hirofumi Nakagami, Naoyuki Sugiyama, Keiichi Mochida, Arsalan Daudi, Yuko Yoshida, Tetsuro Toyoda, Masaru Tomita, Yasushi Ishihama, Ken Shirasu .Large-Scale Comparative Phosphoproteomics Identifies Conserved Phosphorylation Sites in Plant.Plant Physiol(2010) 153(3): 1161–1174&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270776</id>
		<title>Os03g0646900</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0646900&amp;diff=270776"/>
				<updated>2016-06-23T07:33:09Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&lt;br /&gt;
== '''one sentence summary''' ==&lt;br /&gt;
 &lt;br /&gt;
&lt;br /&gt;
   GL3.1 encodes a protein phosphatase kelch (PPKL) family — Ser/Thr phosphatase and GL3.1 is a member of the large grain WY3 variety, which is associated with weaker dephosphorylation activity than the small grain FAZ1 variety GL3.1&lt;br /&gt;
&lt;br /&gt;
== '''Annotated Information''' ==&lt;br /&gt;
&lt;br /&gt;
'''2.1 Fine-mapping of a new QTL, GL3.1, which regulates rice grain yield'''&lt;br /&gt;
[[File:fig2.1.jpg|right|thumb|550px|''fig2.1 Map-based cloning of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
* Fengaizhan-1 (FAZ1) and Waiyin-3 (WY3) rice varieties were selected as parents to map the QTLs that affect grain length. FAZ1 is a small grain indica variety (1 000-grain weight: 20.18 ± 0.89 g), whereas WY3 is a larger grain japonica variety (1 000-grain weight: 43.40 ± 0.92 g; Figure 1A). We fine-mapped a new major QTL (GL3.1) for grain length to a 20-kb region between the L012 and L008 markers on chromosome 3 (25 036 192 bp to 25 060 567 bp at chromosome 3) (Figure 1B), which is distinct from other previously reported QTLs [35-38]. This region contains two genes: Os03g44510, which is a predicted transposon that was excluded from further analysis because the transcript was not detected in both parents, and the predicted phosphatase Os03g44500, which was expressed in both parents and considered as the GL3.1 candidate. Based on the mapping results, we developed a nearisogenic line (NIL) from BC4F2 generations that contained a 30-kb WY3 chromosomal region at the GL3.1 locus in a FAZ1 genetic background (Figure 1C; Supplementary information, Figure S1A-S1C). &lt;br /&gt;
* NIL had longer grains (+16.1%) than FAZ1 (10.71 ± 0.13 mm vs 9.22 ± 0.09 mm), but there were no significant differences in grain width or thickness (Figure 1D-1F), plant height or tiller number (Supplementary information, Figure S1DS1E). NIL had a significantly greater 1 000-grain weight than FAZ1 (+43.5%; Figure 1G) and reduced grain number per main panicle (21.3%, Supplementary information, Figure S1F). NIL exhibited an increase in the milk filling rate (Figure 1H-1I) and higher expression of milk filling-related genes (Supplementary information, Figure S1G). The plot grain yield was significantly increased in NIL (+ 11.1%; Figure 1J); however, the grain quality was not affected, as the packing density of starch granules was similar in the mature seeds of NIL and FAZ1 (Supplementary information, Figure S1H-S1I), and the chalky grain percentage and protein and amylose contents were similar between the NIL and FAZ1 grains (Supplementary information, Figure S1J-S1L). &lt;br /&gt;
* We crossed NIL with Huanghuazhan, which is a relatively high-yield elite indica variety that is widely cultivated in Southern China, and subsequently backcrossed the F1 generation with Huanghuazhan to obtain a Huanghuazhan (GL3.1) variety that exhibited a longer and heavier grain (Supplementary information, Figure S2A-S2E) and a higher grain yield than Huanghuazhan under field conditions (Supplementary information, Figure S2F). These findings confirmed that GL3.1 potentially increases grain yield. &lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
'''2.2 Confirmation of GL3.1 function'''&lt;br /&gt;
[[File:fig2.2.jpg|right|thumb|150px|''Figure 2.2 Transgenic analysis of GL3.1.(from reference &amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
GL3.1 contains a 3 012-bp open reading frame (ORF) that encodes 21 exons and 20 introns. The FAZ1 GL3.1 allele contains 4-bp differences when compared with the WY3 GL3.1 allele (FAZ1 to WY3: 1092C-A, 1495CT, 2643A-G, 2838T-C), which results in two amino acid substitutions (364 aspartic acid — glutamic acid (364DE), 499 histidine — tyrosine (499H-Y); Figure 2A). We sequenced GL3.1 in several large grain varieties and detected the japonica variety Nanyangzhan with a truncated GL3.1 allele as well as Jizi1560 and Jizi1581, which contained 15 additional amino acids at the C-terminus compared with FAZ1 and WY3. At the positions 364 and 499, Jizi1560 and Jizi1581 exhibited the same amino acid substitutions as WY3 (Supplementary information, Figure S3). Transgenic rice plants were generated to determine whether GL3.1 controls grain length. FAZ1 and WY3 failed to regenerate shoots from the callus, and therefore we used the small-grain japonica variety Zhonghua 11, which was easily regenerated [39]. We generated constructs containing the full-length GL3.1 ORFs from FAZ1 or WY3 under the CaMV 35S promoter. Some of the obtained transgenic lines that overexpressed the WY3 GL3.1 allele showed an increased grain length (GL3.1-WY3), whereas the grain length was not changed in all lines overexpressing the FAZ1 GL3.1 allele (GL3.1-FAZ1; data not shown). Only the GL3.1- WY3 line, which expressed relatively high levels of GL3.1-WY3, exhibited increases in grain length (Figure 2B-2D, Supplementary information, Figure S4A-S4B), which confirms that GL3.1 controls grain length. GL3.1- FAZ1 RNA interference (RNAi) and antisense transgenic plants were generated; however, no phenotypic changes in grain length were observed (data not shown). We also observed that GL3.1 was downregulated but not completely suppressed in these lines; therefore, we hypothesized that these lines retained adequate GL3.1 function, as GL3.1 was abundantly expressed.&lt;br /&gt;
GL3.1 is predicted to encode a Ser/Thr phosphatase of unknown function and with two predicted domains: a Kelch_1 protein interaction domain and a Ser/Thr phosphatase domain (Figure 2A). Transgenic plants were generated to investigate the effect of the GL3.1 point substitutions GL3.1-M1 (364E, 499H) and GL3.1-M2 (364D, 499Y) in FAZ1 and WY3. Both transgenic lines exhibited significant increases in grain length (Supplementary information, Figure S4C-S4H). Similar to the GL3.1-WY3 transgenic lines, only high levels of GL3.1- M1 or GL3.1-M2 overexpression led to enhanced grain length. These results suggest that the 364D-E and 499HY substitutions both influence the function of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.3 GL3.1 functions as a Ser/Thr phosphatase'''&lt;br /&gt;
[[File:fig2.3.jpg|right|thumb|150px|''Figure 3 Expression pattern and molecular function of GL3.1 (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
Although some nucleotides were different between the promoters of FAZ1 and WY3, the GL3.1 expression pattern remained similar (Supplementary information, Figure S5). GL3.1 was expressed in all organs and developmental stages tested in FAZ1 and NIL (Supplementary information, Figure S6A-S6C). Notably, expression of GL3.1 was higher in the panicle of NIL at the heading stage than in the panicle of FAZ1 (Figure 3A) and lower in the calluses from FAZ1 and NIL, which primarily con- sist of dividing cells (Supplementary information, Figure S6D). GL3.1 in both parents was detected throughout the entire cell (Figure 3B). Purified GL3.1-FAZ1 and GL3.1- WY3 dephosphorylated myelin basic protein (MyBP; a standard substrate) in vitro, which demonstrates that GL3.1 is a functional Ser/Thr phosphatase (Figure 3C); however, GL3.1-FAZ1 exhibited higher activity than GL3.1-WY3. In addition, GL3.1 from Nanyangzhan (GL3.1-NYZ) did not show dephosphorylation ability (Figure 3C). GL3.1 was insensitive to both okadaic acid (OA) and Inhibitor 2 (Figure 3D), which suggests that GL3.1 may encode a novel type of PPKL, as the PPKL and PP1 enzymes are generally sensitive to Inhibitor 2 [27], whereas the PPKL family member BSU1 is sensitive to OA [32]. Furthermore, we observed that the phosphatase domain of GL3.1 was also not sensitive to these two inhibitors (Supplementary information, Figure S6E). A comparative analysis of phosphatases that are typically sensitive to OA revealed that 929G in GL3.1 conferred resistance to OA (Supplementary information, Figure S7). According to a previous study [40] in rats, PP2Aα is sensitive to OA, but the Y267G mutant of this protein is resistant to OA, which indicates that Y267G is a key mutation for OA resistance. Alignment analysis revealed that 267Y in rat PP2Aα corresponds to 929G in GL3.1, which suggests that GL3.1 harbors a Y to G mutation at this key site that may be responsible for the OA insensitivity of GL3.1. &lt;br /&gt;
&lt;br /&gt;
'''2.4 GL3.1 regulates spikelet hull cell division'''&lt;br /&gt;
[[File:fig2.4.jpg|right|thumb|150px|''Figure 4 GL3.1 alters spikelet hull cell division to regulate grain length. &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
We measured the lemma cell length to determine whether GL3.1 regulates grain length. There were no significant differences in cell length at the central point of the lemma in the vertical orientation (Figure 4A-4B, Supplementary information, Figure S6F) and the distance between tubercles at the outer spikelet hull surface (Figure 4C-4D, Supplementary information, Figure S6G), which indicates that cell length is not responsible for the difference in grain length between FAZ1 and NIL. As the FAZ1 and NIL life cycles and heading days are similar, we hypothesized that an increased rate of cell division may be responsible for the longer spikelet hull in NIL. Therefore, we assessed the cell division rate during different developmental stages of the spikelet hull in the two parents. The detection points were set at the stages when the spikelet hull length reached 25%, 50%, 65%, 80% and 100% of the full spikelet hull length in FAZ1 and NIL, and the percentage of cells with 4C DNA content in the spikelet hull as well as the cell lengths at the central zone of the spikelet hull at these points were also recorded (Figure 4E, Supplementary information, Figure S6F). At the five detection points, the cell length in the vertical orientation was not different between FAZ1 and NIL. Notably, at 50% of full spikelet hull length, the percentage of cells with a 4C DNA content was significantly higher in NIL than in FAZ1 (Figure 4E). Consistent with this, the expression of cell cycle-related genes was significantly higher in the NIL than in the FAZ1 spikelet (Figure 4F). Therefore, we propose that rapid cell division occurs in NIL during spikelet hull development. Furthermore, we synchronized cells from FAZ1 and NIL using hydroxycarbamide, which blocks cell division at the G1/S boundary. 8 h after release from hydroxycarbamide, the expression of Histone H4 was maximal in FAZ1 and NIL (Supplementary information, Figure S6H), which suggests that the cells from FAZ1 and NIL had entered the S phase. In addition, a higher percentage of cells with 4C DNA content and a lower percentage of cells in S phase were observed in NIL when compared with FAZ1 (Figure 4G-4I), which implies that more cells from NIL completed DNA duplication. We also observed that the maximal expression of CYCD4;1, which was expressed from early G2 phase to M phase, was earlier in NIL (28 h after release) than in FAZ1 (32 h after release) (Supplementary information, Figure S6I), which implies faster entry into the G2 phase in NIL cells. Furthermore, we synchronized cells from FAZ1 and NIL using nocodazole, which blocks cell division at the G2/M boundary. The expression of CYCD3;1, which is specifically expressed at the G1/S stage, remained the same between FAZ1 and NIL (Supplementary information, Figure S6J), which implies that the transformation from the G2 phase to G1 phase was not different between the two parents. These results suggest that the transformation from G1 to G2 may be accelerated in NIL. Thus, our results collectively demonstrate that the GL3.1-WY3 allele increases the rate of cell division during spikelet hull development compared with the GL3.1-FAZ1 allele, which results in a longer spikelet hull. &lt;br /&gt;
&lt;br /&gt;
'''2.5 GL3.1 interacts with Cyclin-T1;3 to regulate grain length'''&lt;br /&gt;
[[File:fig2.5.jpg|right|thumb|150px|''Figure5 GL3.1 and Cyclin-T13 interact(from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
To determine the mechanism underlying the GL3.1- mediated regulation of grain size, a yeast two-hybrid system was used to screen a cDNA library constructed from Zhonghua 11 spikelets using GL3.1-FAZ1 as bait. We identified 23 interacting proteins, of which Os11g05850, annotated as Cyclin-T1;3, was selected for further analysis (Figure 5A). The expression of Cyclin-T1;3 was localized to the nucleus of Arabidopsis protoplasts (Figure 5B), which was consistent with the expression pattern observed in humans. When GL3.1 was co-expressed with Cyclin-T1;3, increased accumulation of GL3.1 was observed in the nuclei from both parents when compared with expression without Cyclin-T1;3 (Figures 5C and 3B). We confirmed that GL3.1 dephosphorylated Cyclin-T1;3 in vitro. GL3.1-FAZ1 exhibited stronger Cyclin-T1;3 dephosphorylation activity than GL3.1- WY3, GL3.1-M1 and GL3.1-M2 (Figure 5D), which was consistent with the effects observed for the common substrate MyBP (Figure 3C). As the kelch-repeat domain has demonstrated potential for protein interactions [41], we used a bimolecular fluorescence complementation (BiFC) assay to identify such interactions. GL3.1ΔP, which contains a kelch-repeat domain, interacted with Cyclin-T1;3 in the absence of the GL3.1 Ser/Thr phosphatase domain (Figure 5E). In addition, Cyclin-T1;3 was constitutively expressed in various tissues and organs in a pattern similar to that of GL3.1 (Supplementary information, Figure S8A-S8D). These results demonstrate that Cyclin-T1;3 interacts with GL3.1 and is dephosphorylated through GL3.1. &lt;br /&gt;
Real-time PCR was performed to analyze the expression of Cyclin-T1;3 after cell synchronization. In contrast to the high expression levels observed at 16 h and 32 h in FAZ1 cells, Cyclin-T1;3 showed increased expression at 8 h and 28 h in NIL cells (Figure 5F). At these two specific points, the cells were entering the S and G2 phases, respectively, which indicates that Cyclin-T1;3 may be involved in cell cycle control. Moreover, we used transgenic rice plants to determine whether Cyclin-T1;3 influences grain size. No obvious phenotype was observed when we overexpressed Cyclin-T1;3 in Zhonghua 11. However, antisense strands of Cyclin-T1;3 resulted in smaller grain sizes in the transgenic plants as well as reduced expression of CyclinT1;3 (Figure 5G-5I). Thus, our data indicate that Cyclin-T1;3 is involved in the GL3.1-mediated regulation of grain length.&lt;br /&gt;
&lt;br /&gt;
'''2.6 GL3.1 is a widespread gene that influences protein phosphorylation in vivo'''&lt;br /&gt;
[[File:fig2.6.jpg|right|thumb|150px|''Figure 6 GL3.1 influences protein phosphorylation status as a potential model for grain size control. (from reference &amp;lt;ref name=&amp;quot;ref1&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref2&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref3&amp;quot; /&amp;gt;&amp;lt;ref name=&amp;quot;ref4&amp;quot; /&amp;gt;).'']]&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
A quantitative proteomic analysis using two-dimensional difference gel electrophoresis (2-D DIGE) indicated that 21 proteins were differentially expressed in FAZ1 and NIL, of which 18 were upregulated in NIL (Supplementary information, Table S1). Mass spectrometry revealed that the 21 proteins were associated with cellular metabolic processes. Interestingly, actin was upregulated in NIL, which is consistent with the observation that GL3.1 influences the rate of cell proliferation. The phosphopeptides from the young spikelets of FAZ1 and NIL were enriched on the TiO2 beads and quantified using iTRAQ, which confirmed that GL3.1 is a phosphatase. 556 phosphopeptides were detected, and 464 of these molecules were quantified. Proteins showing a 1.5- fold difference between FAZ1 and NIL and demonstrating the same trend when quantified using two different labelling systems were chosen for further analysis. At least 130 proteins demonstrated a different phosphorylation status between FAZ1 and NIL during spikelet development (Figure 6A and Supplementary information, Table S2). Gene ontology analysis revealed that these proteins are primarily involved in processes related to nucleic acid metabolism and protein complex assembly (Figure 6B and Supplementary information, Table S3). The molecular functions of these proteins include nucleotide binding and the activities of phosphotransferases, helicases and the RNA polymerase II transcription factor. These results strongly suggest that GL3.1 could influence DNA duplication. Thus, we propose that GL3.1 regulates the expression and phosphorylation of a variety of genes involved in metabolism and cell division. Further phylogenetic analyzes based on genomic BLAST searches demonstrated the widespread existence of GL3.1 in plants (Supplementary information, Figure S9), which suggests that GL3.1 has an important conserved function in plants.&lt;br /&gt;
&lt;br /&gt;
== Labs working on this gene ==&lt;br /&gt;
*Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China&lt;br /&gt;
*State Key Laboratory of Crop Genetics and Germplasm Enhancement, Nanjing Agricultural University, Nanjing 210095, China&lt;br /&gt;
*Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi-110021, India&lt;br /&gt;
*RIKEN Plant Science Center (H.N., K.M., A.D., K.S.) and RIKEN Bioinformatics and Systems Engineering Division (Y.Y., T.T.), Tsurumi-ku, Yokohama 230–0045, Japan&lt;br /&gt;
*Institute for Advanced Biosciences, Keio University, Tsuruoka, Yamagata 997–0017, Japan (N.S., M.T., Y.I.)&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
== References ==&lt;br /&gt;
&amp;lt;references&amp;gt;&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref1&amp;quot;&amp;gt;Peng Qi, You-Shun Lin, Xian-Jun Song.et al. The novel quantitative trait locus GL3.1 controls rice grain size and yield by regulating Cyclin-T1; 3. Cell Research (2012) 22:1666-1680.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref2&amp;quot;&amp;gt;Xiaojun Zhang, Jianfei Wang, Ji Huang, Hongxia Lan, Cailin Wang, Congfei Yin, Yunyu Wu, Haijuan Tang, Qian Qian, Jiayang Li, Hongsheng Zhang. Rare allele of OsPPKL1 associated with grain length causes extra-large grain and a significant yield increase in rice. Proc Natl Acad Sci (2012)52: 21534–21539..&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref3&amp;quot;&amp;gt;Amarjeet Singh, Jitender Giri, Sanjay Kapoor, Akhilesh K Tyagi, Girdhar K Pandey .Protein phosphatase complement in rice: genome-wide identification and transcriptional analysis under abiotic stress conditions and reproductive development. BMC Genomics(2010)11: 435.&amp;lt;/ref&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;ref name=&amp;quot;ref4&amp;quot;&amp;gt;Hirofumi Nakagami, Naoyuki Sugiyama, Keiichi Mochida, Arsalan Daudi, Yuko Yoshida, Tetsuro Toyoda, Masaru Tomita, Yasushi Ishihama, Ken Shirasu .Large-Scale Comparative Phosphoproteomics Identifies Conserved Phosphorylation Sites in Plant.Plant Physiol(2010) 153(3): 1161–1174&amp;lt;/ref&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R004-lncRNA-2016-26860696&amp;diff=270774</id>
		<title>IC4R004-lncRNA-2016-26860696</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R004-lncRNA-2016-26860696&amp;diff=270774"/>
				<updated>2016-06-23T06:40:20Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* The Background of This Project */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Project Title ==&lt;br /&gt;
'''Functional analysis of long intergenic non-coding RNAs in phosphate-starved rice using competing endogenous RNA network '''&lt;br /&gt;
&lt;br /&gt;
==The Background of This Project==&lt;br /&gt;
* Long intergenic non-coding RNAs (lincRNAs) may play widespread roles in gene regulation and other biological processes, however, a systematic examination of the functions of lincRNAs in the biological responses of rice to phosphate (Pi) starvation has not been performed. Here, we used a computational method to predict the functions of lincRNAs in Pi-starved rice. Overall, 3,170 lincRNA loci were identified using RNA sequencing data from the roots and shoots of control and Pi-starved rice.&lt;br /&gt;
* Inorganic phosphate (Pi) is essential for the growth and productivity of plants; however, those in agricultural environments can be exposed to Pi starvation 1 . Understanding the biological responses of plants to Pi starvation is vital for improving the efficiency of Pi use and maintaining an acceptable yield 2 . A number of studies have attempted to investigate the complex mechanisms regulating Pi homeostasis in rice, and have reported regulation at the transcript level 3–6 . Long integrate non-coding RNAs (lincRNAs) exist in both mammalian and plants and may play widespread roles in gene regulation and other biological processes 7–9 , however, the function of lincRNAs that response to Pi starvation are poorly understood.&lt;br /&gt;
* The competing endogenous RNA (ceRNA) theory has been proved and is now acknowledged widely 10,11 . This theory states that ceRNAs, including mRNA, lincRNAs, pseudogenes, and other microRNAs (miRNA) sponges, share common miRNA binding sites and can act as molecular sponges because the amount of a given miRNAs is limited 11 . LincRNAs compete with other miRNA sponges to play important roles in both plants and animals 9,12–15 . In addition, ceRNA networks are useful for studying cancer biology and other biological problems 16–19 . However, to our knowledge, ceRNA networks have not yet been used to study the functions of lincRNAs in plants such as Arabidopsis and rice.&lt;br /&gt;
[[File:IC4R004-lncRNA-2016-26860696-2.PNG|500px|thumb|left|'''Figure 1''' ''The basic characteristics of lincRNAs in rice.'']]&lt;br /&gt;
[[File:IC4R004-lncRNA-2016-26860696-1.PNG|370px|thumb|center|'''Figure 2''' ''The ceRNA network of the rice root and shoot.'']]&lt;br /&gt;
&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Research Findings==&lt;br /&gt;
* The pipeline shown in '''Figure. 1a''' was used to identify lincRNAs from the RNA-seq data of rice undergoing Pi starvation 6 . In brief, if a longer-than-200 nt transcript with no coding capability is located in the intergenic regions and is not similar to known protein-coding genes, it is identified as a candidate lincRNA. The details of the pipeline are shown as follow.&lt;br /&gt;
&lt;br /&gt;
* We compared the genomic features of the identified lincRNAs with those of protein-coding genes in rice. The mean exon length of the lincRNA was larger than that of the mRNA ('''Figure. 1b'''), while more than 70% of the lincRNAs, but less than 10% of the mRNAs, contained only one exon (Fig. 1c). In the meanwhile, lincRNAs in rice have fewer, but longer, exons than mRNAs 9 . The GC content of the lincRNAs was also lower than that of the mRNAs ('''Figure. 1d''').&lt;br /&gt;
&lt;br /&gt;
== Labs working on this Project ==&lt;br /&gt;
* National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China&lt;br /&gt;
* College of Informatics, Agricultural Bioinformatics Key Laboratory of Hubei Province, Huazhong Agricultural University, Wuhan 430070, P.R. China&lt;br /&gt;
&lt;br /&gt;
==Corresponding Author==&lt;br /&gt;
* '''LingLing Chen '''(llchen@mail.hzau.edu.cn)&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R004-lncRNA-2016-26860696&amp;diff=270773</id>
		<title>IC4R004-lncRNA-2016-26860696</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R004-lncRNA-2016-26860696&amp;diff=270773"/>
				<updated>2016-06-23T06:40:06Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* The Background of This Project */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Project Title ==&lt;br /&gt;
'''Functional analysis of long intergenic non-coding RNAs in phosphate-starved rice using competing endogenous RNA network '''&lt;br /&gt;
&lt;br /&gt;
==The Background of This Project==&lt;br /&gt;
* Long intergenic non-coding RNAs (lincRNAs) may play widespread roles in gene regulation and other biological processes, however, a systematic examination of the functions of lincRNAs in the biological responses of rice to phosphate (Pi) starvation has not been performed. Here, we used a computational method to predict the functions of lincRNAs in Pi-starved rice. Overall, 3,170 lincRNA loci were identified using RNA sequencing data from the roots and shoots of control and Pi-starved rice.&lt;br /&gt;
* Inorganic phosphate (Pi) is essential for the growth and productivity of plants; however, those in agricultural environments can be exposed to Pi starvation 1 . Understanding the biological responses of plants to Pi starvation is vital for improving the efficiency of Pi use and maintaining an acceptable yield 2 . A number of studies have attempted to investigate the complex mechanisms regulating Pi homeostasis in rice, and have reported regulation at the transcript level 3–6 . Long integrate non-coding RNAs (lincRNAs) exist in both mammalian and plants and may play widespread roles in gene regulation and other biological processes 7–9 , however, the function of lincRNAs that response to Pi starvation are poorly understood.&lt;br /&gt;
* The competing endogenous RNA (ceRNA) theory has been proved and is now acknowledged widely 10,11 . This theory states that ceRNAs, including mRNA, lincRNAs, pseudogenes, and other microRNAs (miRNA) sponges, share common miRNA binding sites and can act as molecular sponges because the amount of a given miRNAs is limited 11 . LincRNAs compete with other miRNA sponges to play important roles in both plants and animals 9,12–15 . In addition, ceRNA networks are useful for studying cancer biology and other biological problems 16–19 . However, to our knowledge, ceRNA networks have not yet been used to study the functions of lincRNAs in plants such as Arabidopsis and rice.&lt;br /&gt;
[[File:IC4R004-lncRNA-2016-26860696-2.PNG|500px|thumb|left|'''Figure 1''' ''The basic characteristics of lincRNAs in rice.'']]&lt;br /&gt;
[[File:IC4R004-lncRNA-2016-26860696-1.PNG|300px|thumb|center|'''Figure 2''' ''The ceRNA network of the rice root and shoot.'']]&lt;br /&gt;
&lt;br /&gt;
==Research Findings==&lt;br /&gt;
* The pipeline shown in '''Figure. 1a''' was used to identify lincRNAs from the RNA-seq data of rice undergoing Pi starvation 6 . In brief, if a longer-than-200 nt transcript with no coding capability is located in the intergenic regions and is not similar to known protein-coding genes, it is identified as a candidate lincRNA. The details of the pipeline are shown as follow.&lt;br /&gt;
&lt;br /&gt;
* We compared the genomic features of the identified lincRNAs with those of protein-coding genes in rice. The mean exon length of the lincRNA was larger than that of the mRNA ('''Figure. 1b'''), while more than 70% of the lincRNAs, but less than 10% of the mRNAs, contained only one exon (Fig. 1c). In the meanwhile, lincRNAs in rice have fewer, but longer, exons than mRNAs 9 . The GC content of the lincRNAs was also lower than that of the mRNAs ('''Figure. 1d''').&lt;br /&gt;
&lt;br /&gt;
== Labs working on this Project ==&lt;br /&gt;
* National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China&lt;br /&gt;
* College of Informatics, Agricultural Bioinformatics Key Laboratory of Hubei Province, Huazhong Agricultural University, Wuhan 430070, P.R. China&lt;br /&gt;
&lt;br /&gt;
==Corresponding Author==&lt;br /&gt;
* '''LingLing Chen '''(llchen@mail.hzau.edu.cn)&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R004-lncRNA-2016-26860696&amp;diff=270772</id>
		<title>IC4R004-lncRNA-2016-26860696</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R004-lncRNA-2016-26860696&amp;diff=270772"/>
				<updated>2016-06-23T06:39:54Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Project Title ==&lt;br /&gt;
'''Functional analysis of long intergenic non-coding RNAs in phosphate-starved rice using competing endogenous RNA network '''&lt;br /&gt;
&lt;br /&gt;
==The Background of This Project==&lt;br /&gt;
* Long intergenic non-coding RNAs (lincRNAs) may play widespread roles in gene regulation and other biological processes, however, a systematic examination of the functions of lincRNAs in the biological responses of rice to phosphate (Pi) starvation has not been performed. Here, we used a computational method to predict the functions of lincRNAs in Pi-starved rice. Overall, 3,170 lincRNA loci were identified using RNA sequencing data from the roots and shoots of control and Pi-starved rice.&lt;br /&gt;
* Inorganic phosphate (Pi) is essential for the growth and productivity of plants; however, those in agricultural environments can be exposed to Pi starvation 1 . Understanding the biological responses of plants to Pi starvation is vital for improving the efficiency of Pi use and maintaining an acceptable yield 2 . A number of studies have attempted to investigate the complex mechanisms regulating Pi homeostasis in rice, and have reported regulation at the transcript level 3–6 . Long integrate non-coding RNAs (lincRNAs) exist in both mammalian and plants and may play widespread roles in gene regulation and other biological processes 7–9 , however, the function of lincRNAs that response to Pi starvation are poorly understood.&lt;br /&gt;
* The competing endogenous RNA (ceRNA) theory has been proved and is now acknowledged widely 10,11 . This theory states that ceRNAs, including mRNA, lincRNAs, pseudogenes, and other microRNAs (miRNA) sponges, share common miRNA binding sites and can act as molecular sponges because the amount of a given miRNAs is limited 11 . LincRNAs compete with other miRNA sponges to play important roles in both plants and animals 9,12–15 . In addition, ceRNA networks are useful for studying cancer biology and other biological problems 16–19 . However, to our knowledge, ceRNA networks have not yet been used to study the functions of lincRNAs in plants such as Arabidopsis and rice.&lt;br /&gt;
[[File:IC4R004-lncRNA-2016-26860696-2.PNG|500px|thumb|left|'''Figure 1''' ''The basic characteristics of lincRNAs in rice.'']]&lt;br /&gt;
[[File:IC4R004-lncRNA-2016-26860696-1.PNG|500px|thumb|center|'''Figure 2''' ''The ceRNA network of the rice root and shoot.'']]&lt;br /&gt;
&lt;br /&gt;
==Research Findings==&lt;br /&gt;
* The pipeline shown in '''Figure. 1a''' was used to identify lincRNAs from the RNA-seq data of rice undergoing Pi starvation 6 . In brief, if a longer-than-200 nt transcript with no coding capability is located in the intergenic regions and is not similar to known protein-coding genes, it is identified as a candidate lincRNA. The details of the pipeline are shown as follow.&lt;br /&gt;
&lt;br /&gt;
* We compared the genomic features of the identified lincRNAs with those of protein-coding genes in rice. The mean exon length of the lincRNA was larger than that of the mRNA ('''Figure. 1b'''), while more than 70% of the lincRNAs, but less than 10% of the mRNAs, contained only one exon (Fig. 1c). In the meanwhile, lincRNAs in rice have fewer, but longer, exons than mRNAs 9 . The GC content of the lincRNAs was also lower than that of the mRNAs ('''Figure. 1d''').&lt;br /&gt;
&lt;br /&gt;
== Labs working on this Project ==&lt;br /&gt;
* National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, P.R. China&lt;br /&gt;
* College of Informatics, Agricultural Bioinformatics Key Laboratory of Hubei Province, Huazhong Agricultural University, Wuhan 430070, P.R. China&lt;br /&gt;
&lt;br /&gt;
==Corresponding Author==&lt;br /&gt;
* '''LingLing Chen '''(llchen@mail.hzau.edu.cn)&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270713</id>
		<title>Test</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270713"/>
				<updated>2016-06-23T01:41:33Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;html&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;width: 600px; height: 400px; padding-bottom: 30px;&amp;quot;&amp;gt;&lt;br /&gt;
&amp;lt;script src=&amp;quot;http://cdn.tagul.com/embed/tc86pr9cqqh1&amp;quot;&amp;gt;&amp;lt;/script&amp;gt;&lt;br /&gt;
&amp;lt;!-- Please don't remove attribution to Tagul.com --&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;display: table; margin: 0 auto;&amp;quot;&amp;gt;&amp;lt;a href=&amp;quot;http://tagul.com/&amp;quot;&amp;gt;Created with Tagul.com&amp;lt;/a&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/html&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270712</id>
		<title>Test</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270712"/>
				<updated>2016-06-23T01:41:13Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;html&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;width: 400px; height: 300px; padding-bottom: 30px;&amp;quot;&amp;gt;&lt;br /&gt;
&amp;lt;script src=&amp;quot;http://cdn.tagul.com/embed/tc86pr9cqqh1&amp;quot;&amp;gt;&amp;lt;/script&amp;gt;&lt;br /&gt;
&amp;lt;!-- Please don't remove attribution to Tagul.com --&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;display: table; margin: 0 auto;&amp;quot;&amp;gt;&amp;lt;a href=&amp;quot;http://tagul.com/&amp;quot;&amp;gt;Created with Tagul.com&amp;lt;/a&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/html&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270711</id>
		<title>Test</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270711"/>
				<updated>2016-06-23T01:32:07Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;html&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;width: 400px; height: 300px; padding-bottom: 30px;&amp;quot;&amp;gt;&lt;br /&gt;
&amp;lt;script src=&amp;quot;http://cdn.tagul.com/embed/ieom6dkmhnnb&amp;quot;&amp;gt;&amp;lt;/script&amp;gt;&lt;br /&gt;
&amp;lt;!-- Please don't remove attribution to Tagul.com --&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;display: table; margin: 0 auto;&amp;quot;&amp;gt;&amp;lt;a href=&amp;quot;http://tagul.com/&amp;quot;&amp;gt;Created with Tagul.com&amp;lt;/a&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/html&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270710</id>
		<title>Test</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Test&amp;diff=270710"/>
				<updated>2016-06-23T01:05:51Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: Created page with &amp;quot;&amp;lt;html&amp;gt; &amp;lt;div style=&amp;quot;width: 400px; height: 400px; padding-bottom: 30px;&amp;quot;&amp;gt; &amp;lt;script src=&amp;quot;http://cdn.tagul.com/embed/ieom6dkmhnnb&amp;quot;&amp;gt;&amp;lt;/script&amp;gt; &amp;lt;!-- Please don't remove attribution to...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;html&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;width: 400px; height: 400px; padding-bottom: 30px;&amp;quot;&amp;gt;&lt;br /&gt;
&amp;lt;script src=&amp;quot;http://cdn.tagul.com/embed/ieom6dkmhnnb&amp;quot;&amp;gt;&amp;lt;/script&amp;gt;&lt;br /&gt;
&amp;lt;!-- Please don't remove attribution to Tagul.com --&amp;gt;&lt;br /&gt;
&amp;lt;div style=&amp;quot;display: table; margin: 0 auto;&amp;quot;&amp;gt;&amp;lt;a href=&amp;quot;http://tagul.com/&amp;quot;&amp;gt;Created with Tagul.com&amp;lt;/a&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;/html&amp;gt;&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R006-Microarray-2014-24913626&amp;diff=270562</id>
		<title>IC4R006-Microarray-2014-24913626</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R006-Microarray-2014-24913626&amp;diff=270562"/>
				<updated>2016-06-22T09:13:59Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* Plant Materials &amp;amp; Treatment */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Project Title ==&lt;br /&gt;
'''Microarray analysis of laser-microdissected tissues indicates the biosynthesis of suberin in the outer part of roots during formation of a barrier to radial oxygen loss in rice (Oryza sativa)'''&lt;br /&gt;
&lt;br /&gt;
==The Background of This Project==&lt;br /&gt;
* Root growth into hypoxic or anoxic waterlogged substrates relies on internal diffusion of oxygen (Armstrong, 1979). The roots of waterlogging-tolerant species, such as rice (Oryza sativa), typically contain a large volume of aerenchyma. The aerenchyma provides a low-resistance pathway for diffusion of oxygen from the shoot base to the root tip (Armstrong, 1979). The roots of some wetland species, including rice, also possess a barrier to radial oxygen loss (ROL) within the basal zones (Armstrong, 1971; Visser et  al., 2000; Colmer, 2003a; Garthwaite et al., 2003; Garthwaite et al., 2008; Abiko et al., 2012), so that ROL occurs predominately from short lateral roots (Armstrong and Armstrong, 2005) and the apical few centimetres of the main axes of adventitious roots (Fig. 1A). A barrier to ROL prevents loss of oxygen from the basal part of roots, which can enhance oxygen transport via the aerenchyma to the root tip. In the roots with an ROL barrier, oxygen at the root tip can be maintained at a higher level to allow root elongation into hypoxic/anoxic soil. The barrier might also impede entry of phytotoxins from chemically reduced water- logged soil.&lt;br /&gt;
* Another key feature contributing to waterlogging tolerance is aerenchyma formation. In rice roots, aerenchyma is formed constitutively, but the amount can be enhanced by soil water-logging (Armstrong, 1971; Pradhan et al., 1973; Jackson and Armstrong, 1999), low oxygen (Colmer et al., 2006), and ethylene (Justin and Armstrong, 1991; Colmer et al., 2006). On the other hand, the barrier to ROL is inducible in rice roots, forming in stagnant or waterlogged conditions, but not (or only weakly) in well-drained or aerated conditions (Colmer et al., 1998; Colmer, 2003a; Colmer et al., 2006; Insalud et al., 2006; Kotula et al., 2009; Shiono et al., 2011). Interestingly, low oxygen, ethylene, and elevated CO 2 , which arise from natural waterlogged soil, are not involved in triggering for- mation of the barrier to ROL in roots of rice (Colmer et al., 2006). &lt;br /&gt;
* The signal that triggers formation of the barrier to ROL is not known yet, but it may involve root exudates, cellular degradation products (Armstrong and Armstrong, 2001; Voesenek and Sasidharan, 2013) or phytotoxins present in chemically reduced waterlogged soils (e.g. Fe 2+ , sulphide, and microbial metabolites; Armstrong, 1979; Armstrong and Armstrong, 2005; Mongon et al., 2014). Aerenchyma and the barrier to ROL in roots are regarded as key features contrib- uting to long-distance oxygen transport and waterlogging tolerance in many wetland species (Armstrong, 1979; Jackson and Drew, 1984; Justin and Armstrong, 1987; Colmer, 2003b; Colmer and Voesenek, 2009; Nishiuchi et al., 2012). However, the molecular mechanism of ROL barrier formation is poorly understood (Shiono et al., 2008).&lt;br /&gt;
&lt;br /&gt;
==Plant Materials &amp;amp; Treatment==&lt;br /&gt;
* Lowland rice (O. sativa L. cv. Nipponbare) was grown in a nutrient solution of the same composition as used in earlier studies of rice (Colmer, 2003a; Shiono et al., 2011). Plants were supported at the stem base in pots (light-shielding pots so roots were in darkness) within a controlled-environment chamber (24-h light, 28 °C, relative humidity over 50%, photosynthetic photon flux density at 214 μmol m –2 s –1 ). In each experiment, seeds were soaked for 30 min in 0.6% (w/v) sodium hypochlorite for surface sterilization. Seeds were then washed thoroughly with deionized water, and then the seeds were placed in Petri dishes containing about 5 mm deionized water for 2 d in darkness at 30 °C. After 2 d imbibition, germinated seeds were placed on stainless mesh floating on aerated quarter-strength nutrient solution and exposed to light. After 6 d imbibition, each seedling was held with soft sponge floating on aerated full-strength nutrient solution. After 9 d imbibition, seedlings were transferred to 5-l pots (height 250 mm, width 120 mm, breadth 180 mm) containing aerated full-strength nutrient solution. Solutions were renewed every 7 d. &lt;br /&gt;
* In each experiment, pots were arranged in a completely randomized design. 23-d-old plants were either continued in aerated solution or transplanted into N 2 -flushed or stagnant deoxygenated solution for 9 h (Fig. 1C). In N 2 -flushed nutrient solution, oxygen level was kept hypoxic (dissolved oxygen &amp;lt;1.0 mg l –1 ). Stagnant solution contained 0.1% (w/v) dissolved agar and was deoxygenated (dissolved oxygen &amp;lt;1.0 mg l –1 ) prior to use by preflushing with N 2 gas. The dilute agar prevents convective movements in solution (‘stagnant’ treatment) so this treatment mimics better than other solution culture methods the changes in gas composition found in waterlogged soils (e.g. decreased oxygen, increased ethylene) (Wiengweera et al., 1997). &lt;br /&gt;
* Adventitious roots of 23-d-old plants were classified as short (65–85 mm) or long (115–135 mm), based on the length of the main axis at commencement of treatments. Selected short and long adventitious roots were marked near the base using small loops of sewing cotton, so these could be recognized over time.&lt;br /&gt;
&lt;br /&gt;
== Labs working on this Project ==&lt;br /&gt;
* Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka-Kenjyojima, Eiheiji, Fukui 910-1195, Japan.&lt;br /&gt;
* Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa, Nagoya 464-8601, Japan.&lt;br /&gt;
* Graduate School of Agriculture and Life Sciences, University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo 113-8657, Japan.&lt;br /&gt;
* Department of Chemical and Biomolecular Engineering, National University of Singapore, Singapore 117585, Singapore.&lt;br /&gt;
* School of Plant Biology and Institute of Agriculture, The University of Western Australia, 35 Stirling Highway, Crawley, WA 6009, Australia.&lt;br /&gt;
* National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan.&lt;br /&gt;
* Research Institute for Bioresources and Biotechnology, Ishikawa Prefectural University, 1–308 Nonoichimachi, Ishikawa 921-8836, Japan.&lt;br /&gt;
&lt;br /&gt;
==Corresponding Author==&lt;br /&gt;
'''Katsuhiro Shiono''' (email: shionok@fpu.ac.jp ) &amp;amp; '''Mikio Nakazono''' (email:nakazono@agr.nagoya-u.ac.jp)&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R006-Microarray-2014-24913626&amp;diff=270561</id>
		<title>IC4R006-Microarray-2014-24913626</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=IC4R006-Microarray-2014-24913626&amp;diff=270561"/>
				<updated>2016-06-22T09:13:42Z</updated>
		
		<summary type="html">&lt;p&gt;Xysj1990: /* The Background of This Project */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;== Project Title ==&lt;br /&gt;
'''Microarray analysis of laser-microdissected tissues indicates the biosynthesis of suberin in the outer part of roots during formation of a barrier to radial oxygen loss in rice (Oryza sativa)'''&lt;br /&gt;
&lt;br /&gt;
==The Background of This Project==&lt;br /&gt;
* Root growth into hypoxic or anoxic waterlogged substrates relies on internal diffusion of oxygen (Armstrong, 1979). The roots of waterlogging-tolerant species, such as rice (Oryza sativa), typically contain a large volume of aerenchyma. The aerenchyma provides a low-resistance pathway for diffusion of oxygen from the shoot base to the root tip (Armstrong, 1979). The roots of some wetland species, including rice, also possess a barrier to radial oxygen loss (ROL) within the basal zones (Armstrong, 1971; Visser et  al., 2000; Colmer, 2003a; Garthwaite et al., 2003; Garthwaite et al., 2008; Abiko et al., 2012), so that ROL occurs predominately from short lateral roots (Armstrong and Armstrong, 2005) and the apical few centimetres of the main axes of adventitious roots (Fig. 1A). A barrier to ROL prevents loss of oxygen from the basal part of roots, which can enhance oxygen transport via the aerenchyma to the root tip. In the roots with an ROL barrier, oxygen at the root tip can be maintained at a higher level to allow root elongation into hypoxic/anoxic soil. The barrier might also impede entry of phytotoxins from chemically reduced water- logged soil.&lt;br /&gt;
* Another key feature contributing to waterlogging tolerance is aerenchyma formation. In rice roots, aerenchyma is formed constitutively, but the amount can be enhanced by soil water-logging (Armstrong, 1971; Pradhan et al., 1973; Jackson and Armstrong, 1999), low oxygen (Colmer et al., 2006), and ethylene (Justin and Armstrong, 1991; Colmer et al., 2006). On the other hand, the barrier to ROL is inducible in rice roots, forming in stagnant or waterlogged conditions, but not (or only weakly) in well-drained or aerated conditions (Colmer et al., 1998; Colmer, 2003a; Colmer et al., 2006; Insalud et al., 2006; Kotula et al., 2009; Shiono et al., 2011). Interestingly, low oxygen, ethylene, and elevated CO 2 , which arise from natural waterlogged soil, are not involved in triggering for- mation of the barrier to ROL in roots of rice (Colmer et al., 2006). &lt;br /&gt;
* The signal that triggers formation of the barrier to ROL is not known yet, but it may involve root exudates, cellular degradation products (Armstrong and Armstrong, 2001; Voesenek and Sasidharan, 2013) or phytotoxins present in chemically reduced waterlogged soils (e.g. Fe 2+ , sulphide, and microbial metabolites; Armstrong, 1979; Armstrong and Armstrong, 2005; Mongon et al., 2014). Aerenchyma and the barrier to ROL in roots are regarded as key features contrib- uting to long-distance oxygen transport and waterlogging tolerance in many wetland species (Armstrong, 1979; Jackson and Drew, 1984; Justin and Armstrong, 1987; Colmer, 2003b; Colmer and Voesenek, 2009; Nishiuchi et al., 2012). However, the molecular mechanism of ROL barrier formation is poorly understood (Shiono et al., 2008).&lt;br /&gt;
&lt;br /&gt;
==Plant Materials &amp;amp; Treatment==&lt;br /&gt;
* Lowland rice (O. sativa L. cv. Nipponbare) was grown in a nutrient solution of the same composition as used in earlier studies of rice (Colmer, 2003a; Shiono et al., 2011). Plants were supported at the stem base in pots (light-shielding pots so roots were in darkness) within a controlled-environment chamber (24-h light, 28 °C, relative humidity over 50%, photosynthetic photon flux density at 214 μmol m –2 s –1 ). In each experiment, seeds were soaked for 30 min in 0.6% (w/v) sodium hypochlorite for surface sterilization. Seeds were then washed thoroughly with deionized water, and then the seeds were placed in Petri dishes containing about 5 mm deionized water for 2 d in darkness at 30 °C. After 2 d imbibition, germinated seeds were placed on stainless mesh floating on aerated quarter-strength nutrient solution and exposed to light. After 6 d imbibition, each seedling was held with soft sponge floating on aerated full-strength nutrient solution. After 9 d imbibition, seedlings were transferred to 5-l pots (height 250 mm, width 120 mm, breadth 180 mm) containing aerated full-strength nutrient solution. Solutions were renewed every 7 d. &lt;br /&gt;
* In each experiment, pots were arranged in a completely randomized design. 23-d-old plants were either continued in aerated solution or transplanted into N 2 -flushed or stagnant deoxygenated solution for 9 h (Fig. 1C). In N 2 -flushed nutrient solution, oxygen level was kept hypoxic (dissolved oxygen &amp;lt;1.0 mg l –1 ). Stagnant solution contained 0.1% (w/v) dissolved agar and was deoxygenated (dissolved oxygen &amp;lt;1.0 mg l –1 ) prior to use by preflushing with N 2 gas. The dilute agar prevents convective movements in solution (‘stagnant’ treatment) so this treatment mimics better than other solution culture methods the changes in gas composition found in waterlogged soils (e.g.&lt;br /&gt;
decreased oxygen, increased ethylene) (Wiengweera et al., 1997). &lt;br /&gt;
* Adventitious roots of 23-d-old plants were classified as short (65–85 mm) or long (115–135 mm), based on the length of the main axis at commencement of treatments. Selected short and long adventitious roots were marked near the base using small loops of sewing cotton, so these could be recognized over time.&lt;br /&gt;
&lt;br /&gt;
== Labs working on this Project ==&lt;br /&gt;
* Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka-Kenjyojima, Eiheiji, Fukui 910-1195, Japan.&lt;br /&gt;
* Graduate School of Bioagricultural Sciences, Nagoya University, Furo-cho, Chikusa, Nagoya 464-8601, Japan.&lt;br /&gt;
* Graduate School of Agriculture and Life Sciences, University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo 113-8657, Japan.&lt;br /&gt;
* Department of Chemical and Biomolecular Engineering, National University of Singapore, Singapore 117585, Singapore.&lt;br /&gt;
* School of Plant Biology and Institute of Agriculture, The University of Western Australia, 35 Stirling Highway, Crawley, WA 6009, Australia.&lt;br /&gt;
* National Institute of Agrobiological Sciences, 2-1-2 Kannondai, Tsukuba, Ibaraki 305-8602, Japan.&lt;br /&gt;
* Research Institute for Bioresources and Biotechnology, Ishikawa Prefectural University, 1–308 Nonoichimachi, Ishikawa 921-8836, Japan.&lt;br /&gt;
&lt;br /&gt;
==Corresponding Author==&lt;br /&gt;
'''Katsuhiro Shiono''' (email: shionok@fpu.ac.jp ) &amp;amp; '''Mikio Nakazono''' (email:nakazono@agr.nagoya-u.ac.jp)&lt;/div&gt;</summary>
		<author><name>Xysj1990</name></author>	</entry>

	</feed>