http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&feedformat=atom&user=Xysj2028 2026-08-27T17:48:14Z User contributions MediaWiki 1.30.0 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0573500&diff=278005 2017-05-12T03:48:46Z

<p>Xysj2028: </p> <hr /> <div>The rice Os05g0573500 was reported as '''''OsHAP3C''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> [[File:Os01g0834400.png|right|thumb|427px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> ===Gene Symbol===<br /> *'''''Os05g0573500''''' '''''&lt;=&gt;''''' '''''OsHAP3C,HAP3C'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3C''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3C''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> * '''''OsHAP3C''''' was expressed in various organs including leaves.<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 5]]<br /> [[Category:Chromosome 5]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0573500&diff=278004 2017-05-12T03:47:14Z

<p>Xysj2028: </p> <hr /> <div>The rice Os05g0573500 was reported as '''''OsHAP3B''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> [[File:Os01g0834400.png|right|thumb|427px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> ===Gene Symbol===<br /> *'''''Os05g0573500''''' '''''&lt;=&gt;''''' '''''OsHAP3B,HAP3B'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 5]]<br /> [[Category:Chromosome 5]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0573500&diff=278003 2017-05-12T03:46:51Z

<p>Xysj2028: </p> <hr /> <div>The rice Os05g0573500 was reported as '''''OsHAP3B''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> [[File:Os01g0834400.png|right|thumb|427px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> ===Gene Symbol===<br /> *'''''Os01g0834400''''' '''''&lt;=&gt;''''' '''''OsHAP3A,HAP3A'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 5]]<br /> [[Category:Chromosome 5]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=RiceWiki:Curated_Genes&diff=278002 2017-05-12T03:40:55Z

<p>Xysj2028: </p> <hr /> <div>{|class=&quot;wikitable sortable&quot; style=&quot;width:90%;text-align:center&quot; <br /> |-<br /> !'''Gene Symbol'''<br /> !'''RAP-DB-ID'''<br /> !'''Total Contribution Score'''<br /> !'''Summed Edit Quantity'''<br /> !'''Averaged Edit Quality'''<br /> !'''Contributor Count'''<br /> !'''Edit Count*'''<br /> !'''Last Edit Time'''<br /> |-<br /> |[[Os09g0114500|'''''BC12''''']]<br /> |[[Os09g0114500]]<br /> | 14.854<br /> | 23746<br /> | 0.626<br /> | 3<br /> | 3<br /> | 2015/6/12 17:37<br /> |-<br /> |[[Os10g0405500|'''''PAIR3''''']]<br /> |[[Os10g0405500]]<br /> | 10.742<br /> | 10877<br /> | 0.988<br /> | 3<br /> | 3<br /> | 2014/6/8 23:39<br /> |-<br /> |[[Os09g0286400|'''''OsNHX5''''']]<br /> |[[Os09g0286400]]<br /> | 12.133<br /> | 24113<br /> | 0.503<br /> | 2<br /> | 2<br /> | 2015/6/12 17:39<br /> |-<br /> |[[Os09g0306400|'''''OsbZIP71''''']]<br /> |[[Os09g0306400]]<br /> | 7.71<br /> | 12551<br /> | 0.614<br /> | 2<br /> | 2<br /> | 2015/6/12 17:39<br /> |-<br /> |[[Os09g0417600|'''''OsWRKY76''''']]<br /> |[[Os09g0417600]]<br /> | 5.713<br /> | 10209<br /> | 0.56<br /> | 2<br /> | 2<br /> | 2015/6/12 17:41<br /> |-<br /> |[[Os09g0434200|'''''OsDSG1''''']]<br /> |[[Os09g0434200]]<br /> | 5.792<br /> | 11879<br /> | 0.488<br /> | 2<br /> | 2<br /> | 2015/6/12 17:42<br /> |-<br /> |[[Os10g0553300|'''''OsTPP2''''']]<br /> |[[Os10g0553300]]<br /> | 8.403<br /> | 35721<br /> | 0.235<br /> | 3<br /> | 3<br /> | 2015/6/13 16:57<br /> |-<br /> |[[Os10g0563600|'''''OsMSRA4.1''''']]<br /> |[[Os10g0563600]]<br /> | 7.778<br /> | 13380<br /> | 0.581<br /> | 3<br /> | 3<br /> | 2015/6/13 16:57<br /> |-<br /> |[[Os11g0127600|'''''ONAC045''''']]<br /> |[[Os11g0127600]]<br /> | 7.065<br /> | 12576<br /> | 0.562<br /> | 3<br /> | 3<br /> | 2015/6/13 17:01<br /> |-<br /> |[[Os11g0648000|'''''OsNHX3''''']]<br /> |[[Os11g0648000]]<br /> | 7.638<br /> | 15767<br /> | 0.484<br /> | 3<br /> | 3<br /> | 2015/6/13 17:09<br /> |-<br /> |[[Os12g0569700|'''''OsHsp23.7''''']]<br /> |[[Os12g0569700]]<br /> | 6.412<br /> | 13859<br /> | 0.463<br /> | 3<br /> | 3<br /> | 2015/6/13 17:18<br /> |-<br /> |[[Os12g0583700|'''''ZFP252''''']]<br /> |[[Os12g0583700]]<br /> | 8.489<br /> | 12862<br /> | 0.66<br /> | 3<br /> | 3<br /> | 2015/6/13 17:18<br /> |-<br /> |[[Os08g0139000|'''''OsDEG10''''']]<br /> |[[Os08g0139000]]<br /> | 4.811<br /> | 9008<br /> | 0.534<br /> | 2<br /> | 2<br /> | 2015/6/12 17:25<br /> |-<br /> |[[Os08g0323700|'''''OsCCC1''''']]<br /> |[[Os08g0323700]]<br /> | 6.709<br /> | 11315<br /> | 0.593<br /> | 2<br /> | 2<br /> | 2015/6/12 17:29<br /> |-<br /> |[[Os08g0441100|'''''OsCIPK06''''']]<br /> |[[Os08g0441100]]<br /> | 3.819<br /> | 7418<br /> | 0.515<br /> | 2<br /> | 2<br /> | 2015/6/12 17:31<br /> |-<br /> |[[Os08g0504700|'''''OsSAP11''''']]<br /> |[[Os08g0504700]]<br /> | 7.149<br /> | 10763<br /> | 0.664<br /> | 2<br /> | 2<br /> | 2015/6/12 17:32<br /> |-<br /> |[[Os08g0540400|'''''OsCPK21''''']]<br /> |[[Os08g0540400]]<br /> | 10.561<br /> | 19732<br /> | 0.535<br /> | 2<br /> | 2<br /> | 2015/6/12 17:34<br /> |-<br /> |[[Os08g0546800|'''''OsHsfB2b''''']]<br /> |[[Os08g0546800]]<br /> | 12.399<br /> | 23039<br /> | 0.538<br /> | 2<br /> | 2<br /> | 2015/6/12 17:34<br /> |-<br /> |[[Os07g0186000|'''''OsTRXh1''''']]<br /> |[[Os07g0186000]]<br /> | 7.817<br /> | 12275<br /> | 0.637<br /> | 2<br /> | 2<br /> | 2015/6/12 16:34<br /> |-<br /> |[[Os07g0556800|'''''OSRIP18''''']]<br /> |[[Os07g0556800]]<br /> | 8.473<br /> | 12924<br /> | 0.656<br /> | 2<br /> | 2<br /> | 2015/6/12 16:44<br /> |-<br /> |[[Os07g0666900|'''''OsNHX1''''']]<br /> |[[Os07g0666900]]<br /> | 11.455<br /> | 21522<br /> | 0.532<br /> | 2<br /> | 2<br /> | 2015/6/12 16:49<br /> |-<br /> |[[Os07g0678600|'''''OsCIPK2''''']]<br /> |[[Os07g0678600]]<br /> | 5.575<br /> | 11240<br /> | 0.496<br /> | 2<br /> | 2<br /> | 2015/6/12 16:49<br /> |-<br /> |[[Os07g0693800|'''''OsFAD8''''']]<br /> |[[Os07g0693800]]<br /> | 5.613<br /> | 11290<br /> | 0.497<br /> | 2<br /> | 2<br /> | 2015/6/12 16:50<br /> |-<br /> |[[Os06g0130100|'''''OsSIK1''''']]<br /> |[[Os06g0130100]]<br /> | 11.48<br /> | 22964<br /> | 0.5<br /> | 2<br /> | 2<br /> | 2015/6/12 16:04<br /> |-<br /> |[[Os06g0472000|'''''OsMSRB1.1''''']]<br /> |[[Os06g0472000]]<br /> | 6.592<br /> | 12098<br /> | 0.545<br /> | 2<br /> | 2<br /> | 2015/6/12 16:14<br /> |-<br /> |[[Os06g0561000|'''''OsMIOX''''']]<br /> |[[Os06g0561000]]<br /> | 6.249<br /> | 12468<br /> | 0.501<br /> | 2<br /> | 2<br /> | 2015/6/12 16:15<br /> |-<br /> |[[Os06g0603600|'''''OsSPX1''''']]<br /> |[[Os06g0603600]]<br /> | 7.774<br /> | 15383<br /> | 0.505<br /> | 2<br /> | 2<br /> | 2015/6/12 16:18<br /> |-<br /> |[[Os06g0612800|'''''OsiSAP8''''']]<br /> |[[Os06g0612800]]<br /> | 8.934<br /> | 14002<br /> | 0.638<br /> | 2<br /> | 2<br /> | 2015/6/12 16:19<br /> |-<br /> |[[Os06g0644200|'''''OVP1''''']]<br /> |[[Os06g0644200]]<br /> | 10.007<br /> | 15443<br /> | 0.648<br /> | 2<br /> | 2<br /> | 2015/6/12 16:20<br /> |-<br /> |[[Os06g0651100|'''''YK1''''']]<br /> |[[Os06g0651100]]<br /> | 8.803<br /> | 18547<br /> | 0.475<br /> | 2<br /> | 2<br /> | 2015/6/12 16:21<br /> |-<br /> |[[Os06g0662200|'''''OsbZIP52''''']]<br /> |[[Os06g0662200]]<br /> | 6.942<br /> | 12388<br /> | 0.56<br /> | 2<br /> | 2<br /> | 2015/6/12 16:22<br /> |-<br /> |[[Os06g0727200|'''''OsCATB''''']]<br /> |[[Os06g0727200]]<br /> | 6.864<br /> | 13184<br /> | 0.521<br /> | 2<br /> | 2<br /> | 2015/6/12 16:27<br /> |-<br /> |[[Os03g0117900|'''''HYR''''']]<br /> |[[Os03g0117900]]<br /> | 5.381<br /> | 8815<br /> | 0.61<br /> | 2<br /> | 2<br /> | 2015/6/12 12:59<br /> |-<br /> |[[Os09g0457900|'''''OsEATB''''']]<br /> |[[Os09g0457900]] <br /> | 42.219<br /> | 42219<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/6 14:12<br /> |-<br /> |[[Os06g0208800|'''''LYP6''''']]<br /> |[[Os06g0208800]]<br /> | 35.205<br /> | 40853<br /> | 0.862<br /> | 2<br /> | 2<br /> | 2015/6/12 16:09<br /> |-<br /> |'''''[[GW5]]'''''<br /> |<br /> | 31.812<br /> | 31817<br /> | 1<br /> | 2<br /> | 2<br /> | 2014/6/8 22:47<br /> |-<br /> |[[Os03g0122600|'''''OsMADS50''''']]<br /> |[[Os03g0122600]]<br /> | 31.778<br /> | 36672<br /> | 0.867<br /> | 2<br /> | 2<br /> | 2015/6/12 13:00<br /> |-<br /> |'''''[[Du1]]'''''<br /> |<br /> | 26.789<br /> | 26797<br /> | 1<br /> | 2<br /> | 2<br /> | 2014/6/5 11:51<br /> |-<br /> |[[Os01g0771200|'''''XB24''''']]<br /> |[[Os01g0771200]]<br /> | 25.112<br /> | 106499<br /> | 0.236<br /> | 3<br /> | 14<br /> | 2015/5/13 15:32<br /> |-<br /> |'''''[[IPA1]]'''''<br /> |<br /> | 22.636<br /> | 22636<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/1 14:57<br /> |-<br /> |'''''[[AB013448]]'''''<br /> |<br /> | 21.65<br /> | 21650<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/8 17:24<br /> |-<br /> |[[Os10g0542100|'''''MT''''']]<br /> |[[Os10g0542100]]<br /> | 21.515<br /> | 25382<br /> | 0.848<br /> | 3<br /> | 3<br /> | 2015/6/13 16:56<br /> |-<br /> |'''''[[MADS]]'''''<br /> |<br /> | 21.305<br /> | 21310<br /> | 1<br /> | 3<br /> | 3<br /> | 2014/6/7 19:11<br /> |-<br /> |'''''[[MYB]]'''''<br /> |<br /> | 21.082<br /> | 21418<br /> | 0.984<br /> | 2<br /> | 2<br /> | 2013/7/16 10:48<br /> |-<br /> |[[Os09g0272900|'''''PB''''']]<br /> |[[Os09g0272900]]<br /> | 21.033<br /> | 24405<br /> | 0.862<br /> | 2<br /> | 2<br /> | 2015/6/12 17:38<br /> |-<br /> |[[Os01g0848400|'''''qSH1''''']]<br /> |[[Os01g0848400]]<br /> | 20.688<br /> | 31733<br /> | 0.652<br /> | 2<br /> | 2<br /> | 2015/5/13 15:40<br /> |-<br /> |[[Os09g0441900|'''''OsDEP1''''']]<br /> |[[Os09g0441900]]<br /> | 18.815<br /> | 18855<br /> | 0.998<br /> | 5<br /> | 5<br /> | 2014/6/11 0:23<br /> |-<br /> |[[Os09g0240200|'''''CONSTANS''''']]<br /> |[[Os09g0240200]]<br /> | 18.077<br /> | 26433<br /> | 0.684<br /> | 2<br /> | 2<br /> | 2015/6/12 17:37<br /> |-<br /> |[[Os04g0271200|'''''SRT701''''']]<br /> |[[Os04g0271200]]<br /> | 18.041<br /> | 18413<br /> | 0.98<br /> | 5<br /> | 9<br /> | 2014/6/10 16:01<br /> |-<br /> |[[Os01g0678500|'''''OsTPC1''''']]<br /> |[[Os01g0678500]]<br /> | 17.989<br /> | 29118<br /> | 0.618<br /> | 6<br /> | 7<br /> | 2015/5/13 15:24<br /> |-<br /> |[[Os03g0332400|'''''OsGLYII-2''''']]<br /> |[[Os03g0332400]]<br /> | 17.603<br /> | 17603<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/12/27 21:46<br /> |-<br /> |[[Os06g0196700|'''''OsARF16'''''']]<br /> |[[Os06g0196700]]<br /> | 17.411<br /> | 28849<br /> | 0.604<br /> | 2<br /> | 2<br /> | 2015/6/12 16:08<br /> |-<br /> |[[Os07g0261200|'''''Ghd7''''']]<br /> |[[Os07g0261200]]<br /> | 17.077<br /> | 17414<br /> | 0.981<br /> | 2<br /> | 2<br /> | 2014/6/1 17:56<br /> |-<br /> |'''''[[Xa7]]'''''<br /> |<br /> | 16.58<br /> | 16580<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/30 14:34<br /> |-<br /> |[[Os03g0227700|'''''OsDWARF4''''']]<br /> |[[Os03g0227700]]<br /> | 16.238<br /> | 28577<br /> | 0.568<br /> | 4<br /> | 6<br /> | 2015/6/12 13:36<br /> |-<br /> |'''''[[Pb1]]'''''<br /> |<br /> | 15.987<br /> | 15987<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/3 15:06<br /> |-<br /> |[[Os12g0597000|'''''CBL''''']]<br /> |[[Os12g0597000]]<br /> | 15.897<br /> | 25737<br /> | 0.618<br /> | 3<br /> | 3<br /> | 2015/6/13 17:18<br /> |-<br /> |[[Os01g0841500|'''''OsMYB3R2''''']]<br /> |[[Os01g0841500]]<br /> | 15.635<br /> | 27885<br /> | 0.561<br /> | 3<br /> | 4<br /> | 2015/5/13 15:39<br /> |-<br /> |[[Os01g0182600|'''''GI''''']]<br /> |[[Os01g0182600]]<br /> | 14.75<br /> | 22705<br /> | 0.65<br /> | 2<br /> | 2<br /> | 2015/5/13 14:58<br /> |-<br /> |[[Os08g0162100|'''''ASP1''''']]<br /> |[[Os08g0162100]]<br /> | 14.743<br /> | 14743<br /> | 1<br /> | 1<br /> | 1<br /> | 2015/6/12 17:26<br /> |-<br /> |[[Os02g0738900|'''''OsDRP2B''''']]<br /> |[[Os02g0738900]]<br /> | 14.365<br /> | 21439<br /> | 0.67<br /> | 2<br /> | 2<br /> | 2015/5/14 13:58<br /> |-<br /> |[[Os01g57340|'''''Npi37''''']]<br /> |[[Os01g57340]]<br /> | 14.08<br /> | 14080<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/27 20:22<br /> |-<br /> |[[Os01g0718300|'''''OsBRI1''''']]<br /> |[[Os01g0718300]]<br /> | 14.008<br /> | 25923<br /> | 0.54<br /> | 3<br /> | 3<br /> | 2015/5/13 15:26<br /> |-<br /> |'''''[[Du2]]'''''<br /> |<br /> | 13.964<br /> | 13964<br /> | 1<br /> | 2<br /> | 2<br /> | 2014/6/5 11:53<br /> |-<br /> |'''''[[OsMYB103L]]'''''<br /> |<br /> | 13.96<br /> | 13960<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/11 16:14<br /> |-<br /> |[[Os01g0782100|''''' Pi-sh''''']]<br /> |[[Os01g0782100]]<br /> | 13.897<br /> | 27151<br /> | 0.512<br /> | 3<br /> | 3<br /> | 2015/5/13 15:34<br /> <br /> |-<br /> |[[Os06g0706400|'''''OsPTR9''''']]<br /> |[[Os06g0706400]]<br /> | 13.739<br /> | 20020<br /> | 0.686<br /> | 2<br /> | 2<br /> | 2015/6/12 16:26<br /> |-<br /> |[[Os08g0398400|'''''OsHIR1''''']]<br /> |[[Os08g0398400]]<br /> | 13.721<br /> | 13748<br /> | 0.998<br /> | 3<br /> | 6<br /> | 2014/6/3 16:40<br /> |-<br /> |[[Os02g0141300|'''''CAP1''''']]<br /> |[[Os02g0141300]]<br /> | 13.71<br /> | 28137<br /> | 0.487<br /> | 5<br /> | 10<br /> | 2015/5/14 13:21<br /> |-<br /> |[[Os07g0214100|'''''RAG1''''']]<br /> |[[Os07g0214100]]<br /> | 13.62<br /> | 31302<br /> | 0.435<br /> | 2<br /> | 2<br /> | 2015/6/12 16:36<br /> |-<br /> |'''''[[DWT1]]'''''<br /> |<br /> | 13.275<br /> | 13275<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/31 12:55<br /> |-<br /> |[[Os01g0797600|'''''OsERF3''''']]<br /> |[[Os01g0797600]]<br /> | 13.247<br /> | 13247<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/25 15:17<br /> |-<br /> |[[Os01g0883800|'''''semidwarf-1''''']]<br /> |[[Os01g0883800]]<br /> | 13.17<br /> | 24896<br /> | 0.529<br /> | 16<br /> | 41<br /> | 2016/6/17 17:22<br /> |-<br /> |[[Os08g0524100|'''''OsSRT1''''']]<br /> |[[Os08g0524100]]<br /> | 13.001<br /> | 18711<br /> | 0.695<br /> | 2<br /> | 2<br /> | 2015/6/12 17:33<br /> |-<br /> |[[Os08g0559300|'''''SPINDLY''''']]<br /> |[[Os08g0559300]]<br /> | 12.718<br /> | 21018<br /> | 0.605<br /> | 3<br /> | 6<br /> | 2015/6/12 17:35<br /> |-<br /> |[[Os11g0225300|'''''PAMP''''']]<br /> |[[Os11g0225300]]<br /> | 12.691<br /> | 23520<br /> | 0.54<br /> | 3<br /> | 3<br /> | 2015/6/13 17:04<br /> |-<br /> |[[Os07g0155600|'''''OsEIN2''''']]<br /> |[[Os07g0155600]]<br /> | 12.605<br /> | 18316<br /> | 0.688<br /> | 2<br /> | 2<br /> | 2015/6/12 16:33<br /> |-<br /> |[[Os01g0607200|'''''OsBAT1''''']]<br /> |[[Os01g0607200]]<br /> | 12.553<br /> | 19986<br /> | 0.628<br /> | 2<br /> | 2<br /> | 2015/5/13 15:17<br /> |-<br /> |[[Os07g0616800|'''''SUS''''']]<br /> |[[Os07g0616800]]<br /> | 12.42<br /> | 26693<br /> | 0.465<br /> | 2<br /> | 2<br /> | 2015/6/12 16:47<br /> |-<br /> |[[Os12g0102400|'''''OsRINGC2-2''''']]<br /> |[[Os12g0102400]]<br /> | 12.278<br /> | 17739<br /> | 0.692<br /> | 3<br /> | 3<br /> | 2015/6/13 17:13<br /> |-<br /> |'''''[[WRKY]]'''''<br /> |<br /> | 12.226<br /> | 12233<br /> | 0.999<br /> | 2<br /> | 2<br /> | 2014/5/31 12:44<br /> |-<br /> |[[Os10g0536100|'''''OsMADS50''''']]<br /> |[[Os10g0536100]]<br /> | 11.96<br /> | 19080<br /> | 0.627<br /> | 3<br /> | 3<br /> | 2015/6/13 16:52<br /> |-<br /> |[[Os02g0725900|'''''HAP3''''']]<br /> |[[Os02g0725900]]<br /> | 11.931<br /> | 16469<br /> | 0.724<br /> | 2<br /> | 2<br /> | 2015/5/14 13:55<br /> |-<br /> |[[Os01g0626400|'''''OsWRKY11''''']]<br /> |[[Os01g0626400]]<br /> | 11.902<br /> | 18881<br /> | 0.63<br /> | 2<br /> | 2<br /> | 2015/5/13 15:20<br /> |-<br /> |[[Os01g0726400|'''''CFO1''''']]<br /> |[[Os01g0726400]]<br /> | 11.891<br /> | 17625<br /> | 0.675<br /> | 2<br /> | 2<br /> | 2015/5/13 15:27<br /> |-<br /> |[[Os09g0422500|'''''OsCESA9''''']]<br /> |[[Os09g0422500]]<br /> | 11.747<br /> | 23511<br /> | 0.5<br /> | 2<br /> | 2<br /> | 2015/6/12 17:42<br /> |-<br /> |[[Os09g0250700|'''''OsABC1-12''''']]<br /> |[[Os09g0250700]]<br /> | 11.742<br /> | 15681<br /> | 0.749<br /> | 2<br /> | 2<br /> | 2015/6/12 17:38<br /> |-<br /> |[[Os06g0701300|'''''OsABC1-8''''']]<br /> |[[Os06g0701300]]<br /> | 11.604<br /> | 15691<br /> | 0.74<br /> | 2<br /> | 2<br /> | 2015/6/12 16:24<br /> |-<br /> |[[Os02g0126400|'''''OsCPK4''''']]<br /> |[[Os02g0126400]]<br /> | 11.6<br /> | 22962<br /> | 0.505<br /> | 2<br /> | 2<br /> | 2015/5/14 13:20<br /> |-<br /> |[[Os06g0570100|'''''d35 Tan-Ginbozu''''']]<br /> |[[Os06g0570100]]<br /> | 11.586<br /> | 15710<br /> | 0.737<br /> | 3<br /> | 3<br /> | 2015/6/12 16:16<br /> |-<br /> |[[Os03g0793500|'''''Hd16''''']]<br /> |[[Os03g0793500]]<br /> | 11.531<br /> | 15843<br /> | 0.728<br /> | 2<br /> | 2<br /> | 2015/5/15 13:43<br /> |-<br /> |[[Os01g0536000|'''''OsCIPK08''''']]<br /> |[[Os01g0536000]]<br /> | 11.52<br /> | 15150<br /> | 0.76<br /> | 2<br /> | 2<br /> | 2015/5/13 15:15<br /> |-<br /> |[[Os03g0848700|'''''Bph14''''']]<br /> |[[Os03g0848700]]<br /> | 11.486<br /> | 21573<br /> | 0.532<br /> | 4<br /> | 4<br /> | 2015/5/15 13:41<br /> |-<br /> |[[Os01g0907900|'''''PLA2''''']]<br /> |[[Os01g0907900]]<br /> | 11.483<br /> | 11485<br /> | 1<br /> | 2<br /> | 2<br /> | 2014/6/2 17:56<br /> |-<br /> |[[Os07g0459200|'''''OsABC1-10''''']]<br /> |[[Os07g0459200]]<br /> | 11.449<br /> | 15381<br /> | 0.744<br /> | 2<br /> | 2<br /> | 2015/6/12 16:39<br /> |-<br /> |[[Os07g0102300|'''''SRL1''''']]<br /> |[[Os07g0102300]]<br /> | 11.423<br /> | 22326<br /> | 0.512<br /> | 3<br /> | 3<br /> | 2015/6/12 16:30<br /> |-<br /> |[[Os07g0186200|'''''OsSIK2''''']]<br /> |[[Os07g0186200]]<br /> | 11.413<br /> | 20165<br /> | 0.566<br /> | 3<br /> | 3<br /> | 2015/6/12 16:34<br /> |-<br /> |[[Os03g0226800|'''''CMT3''''']]<br /> |[[Os03g0226800]]<br /> | 11.245<br /> | 21415<br /> | 0.525<br /> | 3<br /> | 3<br /> | 2015/6/12 13:36<br /> |-<br /> |[[Os08g0114200|'''''OsGLU3''''']]<br /> |[[Os08g0114200]]<br /> | 11.137<br /> | 17754<br /> | 0.627<br /> | 2<br /> | 2<br /> | 2015/6/12 17:23<br /> |-<br /> |[[Os07g0596300|'''''FH5''''']]<br /> |[[Os07g0596300]]<br /> | 11.085<br /> | 15490<br /> | 0.716<br /> | 2<br /> | 2<br /> | 2015/6/12 16:47<br /> |-<br /> |[[Os02g0178800|'''''OsGL1-2''''']]<br /> |[[Os02g0178800]]<br /> | 11.079<br /> | 14720<br /> | 0.753<br /> | 2<br /> | 2<br /> | 2015/5/14 13:23<br /> |-<br /> |[[Os03g0811100|''''' Chl1''''']]<br /> |[[Os03g0811100]]<br /> | 11.068<br /> | 14957<br /> | 0.74<br /> | 2<br /> | 2<br /> | 2015/5/15 13:42<br /> |-<br /> |[[Os09g0395300|'''''SLL1''''']]<br /> |[[Os09g0395300]]<br /> | 11.063<br /> | 16461<br /> | 0.672<br /> | 2<br /> | 2<br /> | 2015/6/12 17:41<br /> |-<br /> |[[Os03g03150|'''''TAD1''''']]<br /> |[[Os03g03150]]<br /> | 10.972<br /> | 10972<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 12:35<br /> |-<br /> |[[Os12g0189500|'''''OsYUC11''''']]<br /> |[[Os12g0189500]]<br /> | 10.931<br /> | 20645<br /> | 0.529<br /> | 7<br /> | 7<br /> | 2015/6/13 17:16<br /> |-<br /> |[[Os06g0211200|'''''OsAREB1''''']]<br /> |[[Os06g0211200]]<br /> | 10.925<br /> | 19995<br /> | 0.546<br /> | 5<br /> | 6<br /> | 2015/6/12 16:09<br /> |-<br /> |[[Os02g0100200|'''''HSP''''']]<br /> |[[Os02g0100200]]<br /> | 10.917<br /> | 21797<br /> | 0.501<br /> | 2<br /> | 2<br /> | 2015/5/14 13:17<br /> |-<br /> |'''''[[BHLH]]'''''<br /> |<br /> | 10.829<br /> | 10829<br /> | 1<br /> | 1<br /> | 1<br /> | 2013/7/21 20:47<br /> |-<br /> |[[Os11g0703900|'''''Hsp70''''']]<br /> |[[Os11g0703900]]<br /> | 10.813<br /> | 10898<br /> | 0.992<br /> | 4<br /> | 5<br /> | 2014/6/9 23:54<br /> |-<br /> |[[Os01g44260|'''''OsDfr''''']]<br /> |[[Os01g44260]]<br /> | 10.787<br /> | 10787<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 21:48<br /> |-<br /> |[[Os03g0815100|'''''SNAC1''''']]<br /> |[[Os03g0815100]]<br /> | 10.722<br /> | 15783<br /> | 0.679<br /> | 2<br /> | 2<br /> | 2015/5/15 13:42<br /> |-<br /> |[[Os10g0561400|'''''OsMYBS3''''']]<br /> |[[Os10g0561400]]<br /> | 10.656<br /> | 22236<br /> | 0.479<br /> | 3<br /> | 3<br /> | 2015/6/13 16:57<br /> |-<br /> |[[Os11g0523800|'''''OsARF1''''']]<br /> |[[Os11g0523800]]<br /> | 10.633<br /> | 21943<br /> | 0.485<br /> | 6<br /> | 6<br /> | 2015/6/13 17:08<br /> |-<br /> |[[Os07g0257200|'''''OsNRAMP5''''']]<br /> |[[Os07g0257200]]<br /> | 10.556<br /> | 10556<br /> | 1<br /> | 1<br /> | 1<br /> | 2015/6/12 16:38<br /> |-<br /> |[[Os02g0661100|'''''OsTPP1''''']]<br /> |[[Os02g0661100]]<br /> | 10.544<br /> | 18837<br /> | 0.56<br /> | 2<br /> | 2<br /> | 2015/5/14 13:51<br /> |-<br /> |[[Os07g0164000|'''''WAF1''''']]<br /> |[[Os07g0164000]]<br /> | 10.534<br /> | 11864<br /> | 0.888<br /> | 2<br /> | 2<br /> | 2015/6/12 16:33<br /> |-<br /> |[[Os12g0476200|'''''Xa25''''']]<br /> |[[Os12g0476200]]<br /> | 10.44<br /> | 17073<br /> | 0.611<br /> | 3<br /> | 3<br /> | 2015/6/13 17:17<br /> |-<br /> |[[Os10g0497300|'''''Rf1a''''']]<br /> |[[Os10g0497300]]<br /> | 10.431<br /> | 18232<br /> | 0.572<br /> | 3<br /> | 3<br /> | 2015/6/13 16:47<br /> |-<br /> |[[Os07g0108900|'''''OsMADS15''''']]<br /> |[[Os07g0108900]]<br /> | 10.425<br /> | 20545<br /> | 0.507<br /> | 4<br /> | 5<br /> | 2015/6/12 16:31<br /> |-<br /> |[[Os03g0215400|'''''MADS1''''']]<br /> |[[Os03g0215400]]<br /> | 10.412<br /> | 14715<br /> | 0.708<br /> | 2<br /> | 2<br /> | 2015/6/12 13:34<br /> |-<br /> |[[Os08g0174700|'''''OsSERK1''''']]<br /> |[[Os08g0174700]]<br /> | 10.335<br /> | 21519<br /> | 0.48<br /> | 2<br /> | 2<br /> | 2015/6/12 17:28<br /> |-<br /> |[[Os01g0121700|'''''OsWBC1''''']]<br /> |[[Os01g0121700]]<br /> | 10.278<br /> | 14300<br /> | 0.719<br /> | 2<br /> | 2<br /> | 2015/5/13 14:49<br /> |-<br /> |[[Os01g0201700|'''''OsMADS3''''']]<br /> |[[Os01g0201700]]<br /> | 10.276<br /> | 20440<br /> | 0.503<br /> | 2<br /> | 2<br /> | 2015/5/13 15:03<br /> |-<br /> |[[Os10g0577600|'''''JMJ706''''']]<br /> |[[Os10g0577600]]<br /> | 10.16<br /> | 18081<br /> | 0.562<br /> | 3<br /> | 3<br /> | 2015/6/13 16:59<br /> |-<br /> |[[Os01g0839100|'''''ZFP179''''']]<br /> |[[Os01g0839100]]<br /> | 10.128<br /> | 13298<br /> | 0.762<br /> | 2<br /> | 2<br /> | 2015/5/13 15:38<br /> |-<br /> |[[Os03g0237250|'''''LPA1''''']]<br /> |[[Os03g0237250]]<br /> | 10.125<br /> | 14184<br /> | 0.714<br /> | 2<br /> | 2<br /> | 2015/6/12 13:38<br /> |-<br /> |[[Os06g0133000|'''''Waxy''''']]<br /> |[[Os06g0133000]]<br /> | 10.084<br /> | 22204<br /> | 0.454<br /> | 3<br /> | 3<br /> | 2015/6/12 16:04<br /> |-<br /> |[[Os03g0805100|'''''SQS''']]<br /> |[[Os03g0805100]]<br /> | 10.051<br /> | 13542<br /> | 0.742<br /> | 2<br /> | 2<br /> | 2015/5/15 13:42<br /> |-<br /> |'''''[[AB013449]]'''''<br /> |<br /> | 10.03<br /> | 10030<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/10 22:14<br /> |-<br /> |[[Os07g0605200|'''''OsMADS18''''']]<br /> |[[Os07g0605200]]<br /> | 10.027<br /> | 19041<br /> | 0.527<br /> | 2<br /> | 2<br /> | 2015/6/12 16:47<br /> |-<br /> |[[Os06g0194900|'''''Sus''''']]<br /> |[[Os06g0194900]]<br /> | 10.026<br /> | 20580<br /> | 0.487<br /> | 2<br /> | 2<br /> | 2015/6/12 16:08<br /> |-<br /> |[[Os01g0764800|'''''GH3''''']]<br /> |[[Os01g0764800]]<br /> | 10.024<br /> | 18674<br /> | 0.537<br /> | 2<br /> | 2<br /> | 2015/5/13 15:32<br /> |-<br /> |[[Os03g0111300|'''''NsLTPs''''']]<br /> |[[Os03g0111300]]<br /> | 10.013<br /> | 12909<br /> | 0.776<br /> | 4<br /> | 4<br /> | 2015/6/12 12:57<br /> |-<br /> |[[Os10g0127900|'''''OsFbx352''''']]<br /> |[[Os10g0127900]]<br /> | 10.013<br /> | 20618<br /> | 0.486<br /> | 4<br /> | 8<br /> | 2015/6/13 16:43<br /> |-<br /> |[[Os06g0662000|'''''OsVHA-A''''']]<br /> |[[Os06g0662000]]<br /> | 9.949<br /> | 19796<br /> | 0.503<br /> | 2<br /> | 2<br /> | 2015/6/12 16:21<br /> |-<br /> |[[Os06g0254600|'''''CALEOSIN''''']]<br /> |[[Os06g0254600]]<br /> | 9.94<br /> | 12129<br /> | 0.82<br /> | 2<br /> | 2<br /> | 2015/6/12 16:12<br /> |-<br /> |[[Os06g0603000|'''''SE5''''']]<br /> |[[Os06g0603000]]<br /> | 9.889<br /> | 9889<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 17:03<br /> |-<br /> |[[Os08g0535200|'''''xa13''''']]<br /> |[[Os08g0535200]]<br /> | 9.858<br /> | 18774<br /> | 0.525<br /> | 3<br /> | 3<br /> | 2015/6/12 17:34<br /> |-<br /> |[[Os12g0281300|'''''Pi-ta''''']]<br /> |[[Os12g0281300]]<br /> | 9.857<br /> | 21855<br /> | 0.451<br /> | 4<br /> | 4<br /> | 2015/6/13 17:16<br /> |-<br /> |[[Os01g0919400|'''''SPS''''']]<br /> |[[Os01g0919400]]<br /> | 9.837<br /> | 9837<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/6 17:48<br /> |-<br /> |[[Os10g0573900|'''''OsNMD3''''']]<br /> |[[Os10g0573900]]<br /> | 9.818<br /> | 16399<br /> | 0.599<br /> | 3<br /> | 3<br /> | 2015/6/13 16:59<br /> |-<br /> |[[Os01g0197100|'''''dwarf2''''']]<br /> |[[Os01g0197100]]<br /> | 9.81<br /> | 19279<br /> | 0.509<br /> | 5<br /> | 6<br /> | 2015/5/13 14:59<br /> |-<br /> |[[Os11g0216300|'''''OsABC1-13''''']]<br /> |[[Os11g0216300]]<br /> | 9.795<br /> | 13761<br /> | 0.712<br /> | 3<br /> | 3<br /> | 2015/6/13 17:04<br /> |-<br /> |[[Os01g0102900|'''''Os-LIR1''''']]<br /> |[[Os01g0102900]]<br /> | 9.726<br /> | 9726<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/12 14:04<br /> |-<br /> |[[Os11g0249000|'''''NLS1''''']]<br /> |[[Os11g0249000]]<br /> | 9.718<br /> | 17393<br /> | 0.559<br /> | 3<br /> | 3<br /> | 2015/6/13 17:05<br /> |-<br /> |[[Os10g0467800|'''''OsCesA7''''']]<br /> |[[Os10g0467800]]<br /> | 9.68<br /> | 22133<br /> | 0.437<br /> | 5<br /> | 6<br /> | 2015/6/13 16:48<br /> |-<br /> |[[Os02g0682200|'''''MADS6''''']]<br /> |[[Os02g0682200]]<br /> | 9.577<br /> | 17192<br /> | 0.557<br /> | 3<br /> | 13<br /> | 2015/5/14 13:53<br /> |-<br /> |[[Os06g0569500|'''''GAs''''']]<br /> |[[Os06g0569500]]<br /> | 9.526<br /> | 18834<br /> | 0.506<br /> | 2<br /> | 2<br /> | 2015/6/12 16:15<br /> |-<br /> |[[Os09g0456800|'''''OsHsfs''''']]<br /> |[[Os09g0456800]]<br /> | 9.468<br /> | 13735<br /> | 0.689<br /> | 2<br /> | 2<br /> | 2015/6/12 17:45<br /> |-<br /> |[[Os02g0274900|'''''OsGMST1''''']]<br /> |[[Os02g0274900]]<br /> | 9.449<br /> | 18241<br /> | 0.518<br /> | 2<br /> | 2<br /> | 2015/5/14 13:38<br /> |-<br /> |[[Os06g0724900|'''''ILA1''''']]<br /> |[[Os06g0724900]]<br /> | 9.361<br /> | 19950<br /> | 0.469<br /> | 2<br /> | 2<br /> | 2015/6/12 16:26<br /> |-<br /> |[[Os01g0611100|'''''OsRAN1''''']]<br /> |[[Os01g0611100]]<br /> | 9.349<br /> | 15330<br /> | 0.61<br /> | 2<br /> | 2<br /> | 2015/5/13 15:18<br /> |-<br /> |[[Os08g0509600|'''''OsSPL14''''']]<br /> |[[Os08g0509600]]<br /> | 9.346<br /> | 17625<br /> | 0.53<br /> | 3<br /> | 4<br /> | 2015/6/12 17:32<br /> |-<br /> |[[Os07g0558000|'''''OsABC1-11''''']]<br /> |[[Os07g0558000]]<br /> | 9.337<br /> | 13289<br /> | 0.703<br /> | 2<br /> | 2<br /> | 2015/6/12 16:44<br /> |-<br /> |[[Os09g0449000|'''''PTC1''''']]<br /> |[[Os09g0449000]]<br /> | 9.33<br /> | 16966<br /> | 0.55<br /> | 2<br /> | 2<br /> | 2015/6/12 17:44<br /> |-<br /> |[[Os04g0415000|'''''BY240''''']]<br /> |[[Os04g0415000]]<br /> | 9.31<br /> | 9310<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/6 19:55<br /> |-<br /> |[[Os07g0471000|'''''OsIRE1''''']]<br /> |[[Os07g0471000]]<br /> | 9.278<br /> | 18586<br /> | 0.499<br /> | 2<br /> | 2<br /> | 2015/6/12 16:39<br /> |-<br /> |[[Os03g0170900|'''''OsSUT1''''']]<br /> |[[Os03g0170900]]<br /> | 9.272<br /> | 19337<br /> | 0.479<br /> | 2<br /> | 2<br /> | 2015/6/12 13:04<br /> |-<br /> |[[Os06g0610300|'''''MOC1''''']]<br /> |[[Os06g0610300]]<br /> | 9.171<br /> | 11979<br /> | 0.766<br /> | 2<br /> | 2<br /> | 2015/6/12 16:19<br /> |-<br /> |[[Os06g0583400|'''''OsHDAC702''''']]<br /> |[[Os06g0583400]]<br /> | 9.15<br /> | 11481<br /> | 0.797<br /> | 2<br /> | 2<br /> | 2015/6/12 16:16<br /> |-<br /> |[[Os02g0622100|'''''LTG1''''']]<br /> |[[Os02g0622100]]<br /> | 9.147<br /> | 12303<br /> | 0.743<br /> | 2<br /> | 2<br /> | 2015/5/14 13:47<br /> |-<br /> |[[Os03g0203200|'''''HTD2''''']]<br /> |[[Os03g0203200]]<br /> | 9.128<br /> | 17233<br /> | 0.53<br /> | 4<br /> | 4<br /> | 2015/6/12 13:06<br /> |-<br /> |[[Os06g0660200|'''''OsPIN2''''']]<br /> |[[Os06g0660200]]<br /> | 9.119<br /> | 20530<br /> | 0.444<br /> | 5<br /> | 6<br /> | 2015/6/12 16:21<br /> |-<br /> |[[Os10g0403000|'''''PLA1 ''''']]<br /> |[[Os10g0403000]]<br /> | 9.104<br /> | 15463<br /> | 0.589<br /> | 3<br /> | 3<br /> | 2015/6/13 16:44<br /> |-<br /> |[[Os03g0112700|'''''Ehd4''''']]<br /> |[[Os03g0112700]]<br /> | 9.094<br /> | 17122<br /> | 0.531<br /> | 3<br /> | 3<br /> | 2015/6/12 12:58<br /> |-<br /> |[[Os02g0799100|'''''Ossgo1''''']]<br /> |[[Os02g0799100]]<br /> | 9.068<br /> | 16095<br /> | 0.563<br /> | 3<br /> | 6<br /> | 2015/5/14 14:02<br /> |-<br /> |[[Os09g0307800|'''''SDG724''''']]<br /> |[[Os09g0307800]]<br /> | 9.029<br /> | 11279<br /> | 0.801<br /> | 4<br /> | 15<br /> | 2014/6/6 8:56<br /> |-<br /> |[[Os08g0424500|'''''Badh2''''']]<br /> |[[Os08g0424500]]<br /> | 9.021<br /> | 17768<br /> | 0.508<br /> | 3<br /> | 3<br /> | 2015/6/12 17:30<br /> |-<br /> |[[Os11g0184900|'''''OsNAC5''''']]<br /> |[[Os11g0184900]]<br /> | 9.016<br /> | 15182<br /> | 0.594<br /> | 3<br /> | 3<br /> | 2015/6/13 17:04<br /> |-<br /> |[[Os02g0203700|'''''SRZ1''''']]<br /> |[[Os02g0203700]]<br /> | 9.003<br /> | 12324<br /> | 0.731<br /> | 2<br /> | 2<br /> | 2015/5/14 13:26<br /> |-<br /> |[[Os06g0125000|'''''RPM1''''']]<br /> |[[Os06g0125000]]<br /> | 8.97<br /> | 12695<br /> | 0.707<br /> | 2<br /> | 2<br /> | 2015/6/12 16:02<br /> |-<br /> |[[Os03g0128700|'''''OsCDPK13''''']]<br /> |[[Os03g0128700]]<br /> | 8.928<br /> | 17882<br /> | 0.499<br /> | 2<br /> | 2<br /> | 2015/6/12 13:01<br /> |-<br /> |[[Os03g0215200|'''''DL''''']]<br /> |[[Os03g0215200]]<br /> | 8.927<br /> | 14196<br /> | 0.629<br /> | 3<br /> | 3<br /> | 2015/6/12 13:07<br /> |-<br /> |[[Os01g0952800|'''''OsIRO2''''']]<br /> |[[Os01g0952800]]<br /> | 8.922<br /> | 8922<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/10 21:52<br /> |-<br /> |[[Os06g0494100|'''''Pi-d2''''']]<br /> |[[Os06g0494100]]<br /> | 8.906<br /> | 12742<br /> | 0.699<br /> | 3<br /> | 3<br /> | 2015/6/12 16:14<br /> |-<br /> |[[Os03g0149100|'''''OsCrl1''''']]<br /> |[[Os03g0149100]]<br /> | 8.897<br /> | 13456<br /> | 0.661<br /> | 3<br /> | 4<br /> | 2015/6/12 11:15<br /> |-<br /> |'''''[[BZIP]]'''''<br /> |<br /> | 8.894<br /> | 8924<br /> | 0.997<br /> | 2<br /> | 2<br /> | 2013/7/21 21:01<br /> |-<br /> |[[Os06g0625900|'''''OsHAK10''''']]<br /> |[[Os06g0625900]]<br /> | 8.872<br /> | 13033<br /> | 0.681<br /> | 2<br /> | 2<br /> | 2015/6/12 16:20<br /> |-<br /> |[[Os06g0229800|'''''ALK''''']]<br /> |[[Os06g0229800]]<br /> | 8.835<br /> | 16807<br /> | 0.526<br /> | 2<br /> | 2<br /> | 2015/6/12 16:11<br /> |-<br /> |[[Os07g0232900|'''''OsHMA3''''']]<br /> |[[Os07g0232900]]<br /> | 8.79<br /> | 18004<br /> | 0.488<br /> | 3<br /> | 8<br /> | 2015/6/12 16:37<br /> |-<br /> |[[Os07g0129700|'''''OSH15''''']]<br /> |[[Os07g0129700]]<br /> | 8.789<br /> | 18504<br /> | 0.475<br /> | 3<br /> | 3<br /> | 2015/6/12 16:32<br /> |-<br /> |[[Os12g0641400|'''''OsSUT2''''']]<br /> |[[Os12g0641400]]<br /> | 8.735<br /> | 8735<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/12 13:56<br /> |-<br /> |[[Os08g0137100|'''''OsFIE2''''']]<br /> |[[Os08g0137100]]<br /> | 8.717<br /> | 8717<br /> | 1<br /> | 1<br /> | 1<br /> | 2015/6/12 17:25<br /> |-<br /> |'''''[[Htd1]]'''''<br /> |<br /> | 8.705<br /> | 8705<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/10 14:14<br /> |-<br /> |[[Os03g0707600|'''''GAI''''']]<br /> |[[Os03g0707600]]<br /> | 8.666<br /> | 16659<br /> | 0.52<br /> | 2<br /> | 5<br /> | 2014/5/28 0:43<br /> |-<br /> |'''''[[Xa23]]'''''<br /> |<br /> | 8.641<br /> | 8641<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/31 21:49<br /> |-<br /> |[[Os11g0235200|'''''SP1''''']]<br /> |[[Os11g0235200]]<br /> | 8.563<br /> | 17156<br /> | 0.499<br /> | 3<br /> | 3<br /> | 2015/6/13 17:05<br /> |-<br /> |[[Os07g0100600|'''''OsPTR1''''']]<br /> |[[Os07g0100600]]<br /> | 8.559<br /> | 15027<br /> | 0.57<br /> | 2<br /> | 2<br /> | 2015/6/12 16:30<br /> |-<br /> |[[Os06g0597000|'''''OsIAA23''''']]<br /> |[[Os06g0597000]]<br /> | 8.509<br /> | 16209<br /> | 0.525<br /> | 4<br /> | 11<br /> | 2014/5/19 22:42<br /> |-<br /> |[[Os02g0232100|'''''HEI10''''']]<br /> |[[Os02g0232100]]<br /> | 8.485<br /> | 15567<br /> | 0.545<br /> | 2<br /> | 2<br /> | 2015/5/14 13:36<br /> |-<br /> |[[Os04g0452500|'''''ZEP1''''']]<br /> |[[Os04g0452500]]<br /> | 8.484<br /> | 8484<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/31 16:56<br /> |-<br /> |[[Os09g0363900|'''''ONI3''''']]<br /> |[[Os09g0363900]]<br /> | 8.473<br /> | 12412<br /> | 0.683<br /> | 3<br /> | 3<br /> | 2015/6/12 17:40<br /> |-<br /> |[[Os09g0426800|'''''WSL2''''']]<br /> |[[Os09g0426800]]<br /> | 8.447<br /> | 9634<br /> | 0.877<br /> | 2<br /> | 2<br /> | 2015/6/12 17:42<br /> |-<br /> |[[Os01g0253300|'''''alpha-1a''''']]<br /> |[[Os01g0253300]]<br /> | 8.439<br /> | 17745<br /> | 0.476<br /> | 5<br /> | 5<br /> | 2015/5/13 15:07<br /> |-<br /> |[[Os06g0683400|'''''OsCCD1''''']]<br /> |[[Os06g0683400]]<br /> | 8.438<br /> | 8438<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/12 14:00<br /> |-<br /> |[[Os09g0522000|'''''OsDREB''''']]<br /> |[[Os09g0522000]]<br /> | 8.335<br /> | 8335<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/24 21:12<br /> |-<br /> |[[Os02g0580300|'''''GID2''''']]<br /> |[[Os02g0580300]]<br /> | 8.329<br /> | 15752<br /> | 0.529<br /> | 2<br /> | 2<br /> | 2015/5/14 13:44<br /> |-<br /> |[[Os08g0499300|'''''OsWRKY30''''']]<br /> |[[Os08g0499300]]<br /> | 8.324<br /> | 17032<br /> | 0.489<br /> | 2<br /> | 2<br /> | 2015/6/12 17:32<br /> |-<br /> |[[Os08g0445700|'''''TPS''''']]<br /> |[[Os08g0445700]]<br /> | 8.317<br /> | 10922<br /> | 0.761<br /> | 2<br /> | 2<br /> | 2015/6/12 17:31<br /> |-<br /> |[[Os10g0505700|'''''LTPs''''']]<br /> |[[Os10g0505700]]<br /> | 8.312<br /> | 16220<br /> | 0.512<br /> | 5<br /> | 6<br /> | 2015/6/13 16:46<br /> |-<br /> |[[Os11g0559200|'''''OsXa21''''']]<br /> |[[Os11g0559200]]<br /> | 8.294<br /> | 15586<br /> | 0.532<br /> | 6<br /> | 9<br /> | 2015/6/13 17:08<br /> |-<br /> |[[Os03g0179400|'''''GUDK''''']]<br /> |[[Os03g0179400]]<br /> | 8.292<br /> | 14840<br /> | 0.559<br /> | 2<br /> | 2<br /> | 2015/6/12 13:04<br /> |-<br /> |[[Os02g0553200|'''''OsAPx8''''']]<br /> |[[Os02g0553200]]<br /> | 8.204<br /> | 8204<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/8 16:03<br /> |-<br /> |[[Os01g0571300|'''''OsHsfA7''''']]<br /> |[[Os01g0571300]]<br /> | 8.184<br /> | 14946<br /> | 0.548<br /> | 2<br /> | 2<br /> | 2015/5/13 15:16<br /> |-<br /> |[[Os09g0401100|'''''STR1''''']]<br /> |[[Os09g0401100]]<br /> | 8.183<br /> | 17216<br /> | 0.475<br /> | 2<br /> | 2<br /> | 2015/6/12 17:41<br /> |-<br /> |[[Os02g0181300|'''''WRKY''''']]<br /> |[[Os02g0181300]]<br /> | 8.174<br /> | 13252<br /> | 0.617<br /> | 2<br /> | 2<br /> | 2015/5/14 13:24<br /> |-<br /> |[[Os05g0346200|'''''OsDREB2B2''''']]<br /> |[[Os05g0346200]]<br /> | 8.14<br /> | 8233<br /> | 0.989<br /> | 2<br /> | 3<br /> | 2014/6/5 17:14<br /> |-<br /> |[[Os09g0502100|'''''LGD1''''']]<br /> |[[Os09g0502100]]<br /> | 8.139<br /> | 15501<br /> | 0.525<br /> | 2<br /> | 2<br /> | 2015/6/12 22:35<br /> |-<br /> |[[Os03g0820300|'''''ZFP182''''']]<br /> |[[Os03g0820300]]<br /> | 8.137<br /> | 11604<br /> | 0.701<br /> | 2<br /> | 2<br /> | 2015/5/15 13:41<br /> |-<br /> |[[Os03g0230300|'''''OsSRO1c''''']]<br /> |[[Os03g0230300]]<br /> | 8.029<br /> | 15193<br /> | 0.528<br /> | 2<br /> | 2<br /> | 2015/6/12 13:37<br /> |-<br /> |[[Os07g0438800|'''''OsPHR2''''']]<br /> |[[Os07g0438800]]<br /> | 8.026<br /> | 15610<br /> | 0.514<br /> | 2<br /> | 2<br /> | 2015/6/12 16:39<br /> |-<br /> |[[Os02g0534400|'''''OsCIN1''''']]<br /> |[[Os02g0534400]]<br /> | 7.997<br /> | 16635<br /> | 0.481<br /> | 2<br /> | 2<br /> | 2015/5/14 13:41<br /> |-<br /> |[[Os06g0165600|'''''OsDREB1D''''']]<br /> |[[Os06g0165600]]<br /> | 7.982<br /> | 11937<br /> | 0.669<br /> | 2<br /> | 2<br /> | 2015/6/12 16:07<br /> |-<br /> |[[Os11g0490600|'''''LAZY1''''']]<br /> |[[Os11g0490600]]<br /> | 7.98<br /> | 16603<br /> | 0.481<br /> | 4<br /> | 5<br /> | 2015/6/13 17:07<br /> |-<br /> |[[Os07g0585700|'''''Sdr4''''']]<br /> |[[Os07g0585700]]<br /> | 7.966<br /> | 7966<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 23:14<br /> |-<br /> |[[Os01g0194300|'''''OsNPR1''''']]<br /> |[[Os01g0194300]]<br /> | 7.966<br /> | 11111<br /> | 0.717<br /> | 2<br /> | 2<br /> | 2015/5/13 14:59<br /> |-<br /> |[[Os01g0869900|'''''SNF1''''']]<br /> |[[Os01g0869900]]<br /> | 7.964<br /> | 16289<br /> | 0.489<br /> | 2<br /> | 2<br /> | 2015/5/13 15:42<br /> |-<br /> |[[Os06g0160700|'''''SSSl''''']]<br /> |[[Os06g0160700]]<br /> | 7.962<br /> | 15027<br /> | 0.53<br /> | 2<br /> | 2<br /> | 2015/6/12 16:07<br /> |-<br /> |[[Os09g0451500|'''''PDI''''']]<br /> |[[Os09g0451500]]<br /> | 7.903<br /> | 10040<br /> | 0.787<br /> | 2<br /> | 2<br /> | 2015/6/12 17:44<br /> |-<br /> |[[Os01g0759400|'''''OsCIPK12''''']]<br /> |[[Os01g0759400]]<br /> | 7.902<br /> | 15742<br /> | 0.502<br /> | 2<br /> | 2<br /> | 2015/5/13 15:30<br /> |-<br /> |[[Os06g0205100|'''''OsC1-Myb''''']]<br /> |[[Os06g0205100]]<br /> | 7.891<br /> | 12914<br /> | 0.611<br /> | 2<br /> | 2<br /> | 2015/6/12 16:08<br /> |-<br /> |[[Os09g0244900|'''''Ypt1p''''']]<br /> |[[Os09g0244900]]<br /> | 7.89<br /> | 11371<br /> | 0.694<br /> | 2<br /> | 2<br /> | 2015/6/12 17:38<br /> |-<br /> |'''''[[HTD2]]'''''<br /> |<br /> | 7.887<br /> | 7887<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/4 22:20<br /> |-<br /> |[[Os09g0482400|'''''HSP82''''']]<br /> |[[Os09g0482400]]<br /> | 7.873<br /> | 11843<br /> | 0.665<br /> | 2<br /> | 2<br /> | 2015/6/12 17:47<br /> |-<br /> |[[Os10g0478000|'''''TAW1''''']]<br /> |[[Os10g0478000]]<br /> | 7.871<br /> | 12275<br /> | 0.641<br /> | 4<br /> | 5<br /> | 2015/6/13 16:47<br /> |-<br /> |[[Os07g0258400|'''''OsNRAMP1''''']]<br /> |[[Os07g0258400]]<br /> | 7.866<br /> | 13708<br /> | 0.574<br /> | 2<br /> | 2<br /> | 2015/6/12 16:38<br /> |-<br /> |[[Os10g0445400|'''''OsHCI1''''']]<br /> |[[Os10g0445400]]<br /> | 7.848<br /> | 15652<br /> | 0.501<br /> | 6<br /> | 15<br /> | 2015/6/13 16:48<br /> |-<br /> |[[Os01g0273800|'''''OsYUC9''''']]<br /> |[[Os01g0273800]]<br /> | 7.843<br /> | 9988<br /> | 0.785<br /> | 2<br /> | 2<br /> | 2015/5/13 15:10<br /> |-<br /> |[[Os01g0643300|'''''OsPIN10a''''']]<br /> |[[Os01g0643300]]<br /> | 7.839<br /> | 16276<br /> | 0.482<br /> | 3<br /> | 3<br /> | 2015/5/13 15:22<br /> |-<br /> |[[Os06g0286700|'''''Pi9''''']]<br /> |[[Os06g0286700]]<br /> | 7.816<br /> | 16653<br /> | 0.469<br /> | 6<br /> | 9<br /> | 2015/6/12 16:13<br /> |-<br /> |[[Os11g0104300|'''''DWARF53''''']]<br /> |[[Os11g0104300]]<br /> | 7.791<br /> | 11682<br /> | 0.667<br /> | 4<br /> | 4<br /> | 2015/6/13 17:00<br /> |-<br /> |[[Os07g0150700|'''''Os-AKT1''''']]<br /> |[[Os07g0150700]]<br /> | 7.79<br /> | 15994<br /> | 0.487<br /> | 2<br /> | 2<br /> | 2015/6/12 16:32<br /> |-<br /> |[[Os09g0494200|'''''BC15''''']]<br /> |[[Os09g0494200]]<br /> | 7.776<br /> | 7776<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/3 23:51<br /> |-<br /> |[[Os03g0181500|'''''ONI1''''']]<br /> |[[Os03g0181500]]<br /> | 7.751<br /> | 12230<br /> | 0.634<br /> | 3<br /> | 4<br /> | 2015/6/12 13:05<br /> |-<br /> |[[Os02g0814200|'''''OsGL1-6''''']]<br /> |[[Os02g0814200]]<br /> | 7.743<br /> | 13379<br /> | 0.579<br /> | 2<br /> | 2<br /> | 2015/5/14 14:03<br /> |-<br /> |[[Os02g0103800|'''''OsLFNR1''''']]<br /> |[[Os02g0103800]]<br /> | 7.686<br /> | 7686<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/12 14:12<br /> |-<br /> |[[Os11g0225100|'''''Pia''''']]<br /> |[[Os11g0225100]]<br /> | 7.669<br /> | 12296<br /> | 0.624<br /> | 3<br /> | 3<br /> | 2015/6/13 17:04<br /> |-<br /> |'''''[[Pi1]]'''''<br /> |<br /> | 7.644<br /> | 7644<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/5 17:02<br /> |-<br /> |[[Os01g0307500|'''''SKC1''''']]<br /> |[[Os01g0307500]]<br /> | 7.639<br /> | 7639<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/7 21:57<br /> |-<br /> |'''''[[Chalk5]]'''''<br /> |<br /> | 7.635<br /> | 7635<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/29 11:10<br /> |-<br /> |[[Os08g0140300|'''''TDC''''']]<br /> |[[Os08g0140300]]<br /> | 7.633<br /> | 13769<br /> | 0.554<br /> | 2<br /> | 2<br /> | 2015/6/12 17:26<br /> |-<br /> |[[Os07g0622900|'''''DTM1''''']]<br /> |[[Os07g0622900]]<br /> | 7.632<br /> | 14288<br /> | 0.534<br /> | 2<br /> | 2<br /> | 2015/6/12 16:48<br /> |-<br /> |[[Os01g0292200|'''''OsCIPK1''''']]<br /> |[[Os01g0292200]]<br /> | 7.626<br /> | 12859<br /> | 0.593<br /> | 2<br /> | 2<br /> | 2015/5/13 15:11<br /> |-<br /> |[[Os03g0230500|'''''DSM3''''']]<br /> |[[Os03g0230500]]<br /> | 7.618<br /> | 14126<br /> | 0.539<br /> | 2<br /> | 2<br /> | 2015/6/12 13:37<br /> |-<br /> |[[Os12g0472500|'''''OsTDL1A''''']]<br /> |[[Os12g0472500]]<br /> | 7.581<br /> | 13819<br /> | 0.549<br /> | 4<br /> | 4<br /> | 2015/6/13 17:17<br /> |-<br /> |[[Os03g0262900|'''''glup6''''']]<br /> |[[Os03g0262900]]<br /> | 7.571<br /> | 15719<br /> | 0.482<br /> | 2<br /> | 2<br /> | 2015/6/12 13:38<br /> |-<br /> |[[Os06g0107700|'''''OsLFNR2''''']]<br /> |[[Os06g0107700]]<br /> | 7.533<br /> | 7533<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/6 9:33<br /> |-<br /> |[[Os02g57310|'''''Pib''''']]<br /> |[[Os02g57310]]<br /> | 7.531<br /> | 7531<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/6 14:27<br /> |-<br /> |[[Os09g0104200|'''''OsRAD51D''''']]<br /> |[[Os09g0104200]]<br /> | 7.502<br /> | 15399<br /> | 0.487<br /> | 3<br /> | 3<br /> | 2015/6/12 17:37<br /> |-<br /> |[[Os06g0142600|'''''Hd17''''']]<br /> |[[Os06g0142600]]<br /> | 7.492<br /> | 11545<br /> | 0.649<br /> | 3<br /> | 3<br /> | 2015/6/12 16:06<br /> |-<br /> |[[Os03g0788500|'''''OsCPK10''''']]<br /> |[[Os03g0788500]]<br /> | 7.454<br /> | 10159<br /> | 0.734<br /> | 2<br /> | 2<br /> | 2015/5/15 13:44<br /> |-<br /> |[[Os06g0139000|'''''F-box''''']]<br /> |[[Os06g0139000]]<br /> | 7.443<br /> | 15282<br /> | 0.487<br /> | 3<br /> | 4<br /> | 2015/6/12 16:05<br /> |-<br /> |[[Os03g0168600|'''''CYP704B2''''']]<br /> |[[Os03g0168600]]<br /> | 7.43<br /> | 12348<br /> | 0.602<br /> | 2<br /> | 2<br /> | 2015/6/12 13:03<br /> |-<br /> |[[Os11g0117400|'''''OsWRKY89''''']]<br /> |[[Os11g0117400]]<br /> | 7.353<br /> | 11607<br /> | 0.633<br /> | 3<br /> | 3<br /> | 2015/6/13 17:01<br /> |-<br /> |[[Os03g0223400|'''''OsGLN1_2''''']]<br /> |[[Os03g0223400]]<br /> | 7.313<br /> | 14417<br /> | 0.507<br /> | 3<br /> | 3<br /> | 2015/6/12 13:35<br /> |-<br /> |[[Os02g0731200|'''''MADS57''''']]<br /> |[[Os02g0731200]]<br /> | 7.311<br /> | 14927<br /> | 0.49<br /> | 2<br /> | 2<br /> | 2015/5/14 13:56<br /> |-<br /> |[[Os09g02650|'''''BC12''''']]<br /> |[[Os09g02650]]<br /> | 7.302<br /> | 7302<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/1 19:01<br /> |-<br /> |[[Os01g0859300|'''''OsABI5''''']]<br /> |[[Os01g0859300]]<br /> | 7.265<br /> | 12246<br /> | 0.593<br /> | 2<br /> | 2<br /> | 2015/5/13 15:41<br /> |-<br /> |[[Os08g0105000|'''''Ghd7''''']]<br /> |[[Os08g0105000]]<br /> | 7.237<br /> | 15311<br /> | 0.473<br /> | 4<br /> | 4<br /> | 2015/6/12 17:23<br /> |-<br /> |[[Os03g0110800|'''''OsDRM2''''']]<br /> |[[Os03g0110800]]<br /> | 7.203<br /> | 14838<br /> | 0.485<br /> | 2<br /> | 2<br /> | 2015/6/12 12:57<br /> |-<br /> |[[Os01g0367100|'''''PHD1''''']]<br /> |[[Os01g0367100]]<br /> | 7.2<br /> | 12561<br /> | 0.573<br /> | 3<br /> | 3<br /> | 2015/6/9 9:53<br /> |-<br /> |[[Os02g0191600|'''''OsbZIP16''''']]<br /> |[[Os02g0191600]]<br /> | 7.2<br /> | 13785<br /> | 0.522<br /> | 2<br /> | 2<br /> | 2015/5/14 13:25<br /> |-<br /> |[[Os08g0137250|'''''FIE1''''']]<br /> |[[Os08g0137250]]<br /> | 7.185<br /> | 14660<br /> | 0.49<br /> | 2<br /> | 2<br /> | 2015/6/12 17:25<br /> |-<br /> |[[Os02g0220400|'''''Cga1''''']]<br /> |[[Os02g0220400]]<br /> | 7.158<br /> | 17791<br /> | 0.402<br /> | 6<br /> | 8<br /> | 2015/5/14 13:36<br /> |-<br /> |[[Os10g0404500|'''''SUTs''''']]<br /> |[[Os10g0404500]]<br /> | 7.151<br /> | 7164<br /> | 0.998<br /> | 2<br /> | 2<br /> | 2014/6/7 23:34<br /> |-<br /> |[[Os10g0177200|'''''OsDSR-1''''']]<br /> |[[Os10g0177200]]<br /> | 7.15<br /> | 9017<br /> | 0.793<br /> | 3<br /> | 3<br /> | 2015/6/13 16:45<br /> |-<br /> |[[Os10g0496900|'''''OsPORB''''']]<br /> |[[Os10g0496900]]<br /> | 7.143<br /> | 14022<br /> | 0.509<br /> | 3<br /> | 3<br /> | 2015/6/13 16:47<br /> |-<br /> |[[Os02g0313400|'''''API5''''']]<br /> |[[Os02g0313400]]<br /> | 7.12<br /> | 14554<br /> | 0.489<br /> | 2<br /> | 2<br /> | 2015/5/14 13:39<br /> |-<br /> |[[Os08g0117000|'''''PSS1''''']]<br /> |[[Os08g0117000]]<br /> | 7.092<br /> | 8202<br /> | 0.865<br /> | 2<br /> | 2<br /> | 2015/6/12 17:24<br /> |-<br /> |[[Os08g0531700|'''''MADS-box''''']]<br /> |[[Os08g0531700]]<br /> | 7.054<br /> | 13276<br /> | 0.531<br /> | 2<br /> | 2<br /> | 2015/6/12 17:33<br /> |-<br /> |[[Os06g0499500|'''''GH3''''']]<br /> |[[Os06g0499500]]<br /> | 7.051<br /> | 12958<br /> | 0.544<br /> | 3<br /> | 4<br /> | 2015/6/12 16:15<br /> |-<br /> |[[Os03g0188400|'''''OsSRT1''''']]<br /> |[[Os03g0188400]]<br /> | 7.05<br /> | 12067<br /> | 0.584<br /> | 2<br /> | 2<br /> | 2015/6/12 13:06<br /> |-<br /> |[[Os02g0649900|'''''OsYSL2''''']]<br /> |[[Os02g0649900]]<br /> | 7.031<br /> | 12503<br /> | 0.562<br /> | 2<br /> | 2<br /> | 2015/5/14 13:48<br /> |-<br /> |[[Os09g0442700|'''''OsDDM1''''']]<br /> |[[Os09g0442700]]<br /> | 7.028<br /> | 10589<br /> | 0.664<br /> | 2<br /> | 2<br /> | 2015/6/12 17:44<br /> |-<br /> |[[Os12g0438600|'''''AtCLC-a''''']]<br /> |[[Os12g0438600]]<br /> | 7.022<br /> | 14835<br /> | 0.473<br /> | 3<br /> | 3<br /> | 2015/6/13 17:17<br /> |-<br /> |[[Os07g0124700|'''''CRL5''''']]<br /> |[[Os07g0124700]]<br /> | 6.998<br /> | 14469<br /> | 0.484<br /> | 2<br /> | 2<br /> | 2015/6/12 16:31<br /> |-<br /> |[[Os11g0639100|'''''Pi54''''']]<br /> |[[Os11g0639100]]<br /> | 6.934<br /> | 11269<br /> | 0.615<br /> | 4<br /> | 4<br /> | 2015/6/13 17:09<br /> |-<br /> |[[Os01g0615050|'''''OCPI1''''']]<br /> |[[Os01g0615050]]<br /> | 6.92<br /> | 9869<br /> | 0.701<br /> | 2<br /> | 2<br /> | 2015/5/13 15:18<br /> |-<br /> |[[Os12g0610200|'''''OsPIL11''''']]<br /> |[[Os12g0610200]]<br /> | 6.911<br /> | 12604<br /> | 0.548<br /> | 4<br /> | 4<br /> | 2015/6/13 17:18<br /> |-<br /> |[[Os03g0123300|'''''TAD1''''']]<br /> |[[Os03g0123300]]<br /> | 6.87<br /> | 15272<br /> | 0.45<br /> | 4<br /> | 8<br /> | 2015/6/12 13:00<br /> |-<br /> |[[Os07g0682800|'''''rth1''''']]<br /> |[[Os07g0682800]]<br /> | 6.853<br /> | 13550<br /> | 0.506<br /> | 2<br /> | 2<br /> | 2015/6/12 16:49<br /> |-<br /> |[[Os11g0446000|'''''RSS3''''']]<br /> |[[Os11g0446000]]<br /> | 6.838<br /> | 13942<br /> | 0.49<br /> | 5<br /> | 5<br /> | 2015/6/13 17:07<br /> |-<br /> |[[Os07g0182900|'''''OsMET1a''''']]<br /> |[[Os07g0182900]]<br /> | 6.821<br /> | 13295<br /> | 0.513<br /> | 5<br /> | 11<br /> | 2015/6/12 16:33<br /> |-<br /> |[[Os01g0205700|'''''OsGSK1''''']]<br /> |[[Os01g0205700]]<br /> | 6.813<br /> | 12490<br /> | 0.545<br /> | 2<br /> | 2<br /> | 2015/5/13 15:04<br /> |-<br /> |[[Os05g0333200|'''''GPA1''''']]<br /> |[[Os05g0333200]]<br /> | 6.778<br /> | 8703<br /> | 0.779<br /> | 2<br /> | 2<br /> | 2014/6/9 9:17<br /> |-<br /> |[[Os10g0167600|'''''OsCPDP''''']]<br /> |[[Os10g0167600]]<br /> | 6.756<br /> | 14570<br /> | 0.464<br /> | 4<br /> | 4<br /> | 2015/6/13 16:45<br /> |-<br /> |[[Os07g0227800|'''''OsABC1-9''''']]<br /> |[[Os07g0227800]]<br /> | 6.744<br /> | 10826<br /> | 0.623<br /> | 2<br /> | 2<br /> | 2015/6/12 16:37<br /> |-<br /> |[[Os10g0567400|'''''OsCAO1''''']]<br /> |[[Os10g0567400]]<br /> | 6.732<br /> | 13437<br /> | 0.501<br /> | 3<br /> | 3<br /> | 2015/6/13 16:58<br /> |-<br /> |'''''[[DEP2]]'''''<br /> |<br /> | 6.724<br /> | 6763<br /> | 0.994<br /> | 3<br /> | 7<br /> | 2014/6/10 22:30<br /> |-<br /> |[[Os07g0592600|'''''OsMGH3''''']]<br /> |[[Os07g0592600]]<br /> | 6.72<br /> | 15320<br /> | 0.439<br /> | 5<br /> | 11<br /> | 2015/6/12 16:46<br /> |-<br /> |[[Os11g0126900|'''''OsNAC10''''']]<br /> |[[Os11g0126900]]<br /> | 6.705<br /> | 6705<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/24 12:41<br /> |-<br /> |[[Os09g0561600|'''''OsDEES1''''']]<br /> |[[Os09g0561600]]<br /> | 6.699<br /> | 11352<br /> | 0.59<br /> | 2<br /> | 2<br /> | 2015/6/13 16:42<br /> |-<br /> |'''''[[Sub1A]]'''''<br /> |<br /> | 6.679<br /> | 6679<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/4 16:03<br /> |-<br /> |[[Os08g0126300|'''''OsGAPDH''''']]<br /> |[[Os08g0126300]]<br /> | 6.658<br /> | 13730<br /> | 0.485<br /> | 2<br /> | 2<br /> | 2015/6/12 17:24<br /> |-<br /> |[[Os10g0533600|'''''OsMPK6''''']]<br /> |[[Os10g0533600]]<br /> | 6.522<br /> | 8207<br /> | 0.795<br /> | 3<br /> | 3<br /> | 2015/6/13 16:46<br /> |-<br /> |[[Os10g0397400|'''''dwarf2''''']]<br /> |[[Os10g0397400]]<br /> | 6.52<br /> | 11105<br /> | 0.587<br /> | 3<br /> | 3<br /> | 2015/6/13 16:44<br /> |-<br /> |[[Os06g0712700|'''''OsMADS16''''']]<br /> |[[Os06g0712700]]<br /> | 6.51<br /> | 7624<br /> | 0.854<br /> | 2<br /> | 2<br /> | 2014/6/9 16:43<br /> |-<br /> |[[Os08g0237000|'''''OsXTH8''''']]<br /> |[[Os08g0237000]]<br /> | 6.46<br /> | 6460<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 18:44<br /> |-<br /> |[[Os02g0811000|'''''TH1''''']]<br /> |[[Os02g0811000]]<br /> | 6.453<br /> | 11487<br /> | 0.562<br /> | 2<br /> | 2<br /> | 2015/5/14 14:02<br /> |-<br /> |[[Os07g0505200|'''''OsSPL13''''']]<br /> |[[Os07g0505200]]<br /> | 6.444<br /> | 6444<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/13 9:49<br /> |-<br /> |[[Os11g0247300|'''''Srs5''''']]<br /> |[[Os11g0247300]]<br /> | 6.442<br /> | 13081<br /> | 0.492<br /> | 4<br /> | 4<br /> | 2015/6/13 17:05<br /> |-<br /> |[[AY986492|'''''Xa27''''']]<br /> |[[AY986492]]<br /> | 6.408<br /> | 6408<br /> | 1<br /> | 2<br /> | 2<br /> | 2014/6/10 21:12<br /> |-<br /> |[[Os06g0700700|'''''OsHMA2''''']]<br /> |[[Os06g0700700]]<br /> | 6.404<br /> | 6404<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/3 20:16<br /> |-<br /> |[[Os02g0771400|'''''OsPFA-DSP2''''']]<br /> |[[Os02g0771400]]<br /> | 6.399<br /> | 6702<br /> | 0.955<br /> | 2<br /> | 3<br /> | 2014/5/12 16:03<br /> |-<br /> |[[Os06g0127800|'''''DLT''''']]<br /> |[[Os06g0127800]]<br /> | 6.393<br /> | 10797<br /> | 0.592<br /> | 2<br /> | 2<br /> | 2015/6/12 16:03<br /> |-<br /> |[[Os02g0120500|'''''OsTDR''''']]<br /> |[[Os02g0120500]]<br /> | 6.372<br /> | 6372<br /> | 1<br /> | 1<br /> | 1<br /> | 2015/5/14 13:19<br /> |-<br /> |[[Os03g0854500|'''''OsHsfs''''']]<br /> |[[Os03g0854500]]<br /> | 6.367<br /> | 10086<br /> | 0.631<br /> | 2<br /> | 2<br /> | 2015/5/15 13:40<br /> |-<br /> |[[Os06g0275000|'''''Hd1''''']]<br /> |[[Os06g0275000]]<br /> | 6.307<br /> | 11994<br /> | 0.526<br /> | 2<br /> | 2<br /> | 2015/6/12 16:12<br /> |-<br /> |[[Os02g0759800|'''''OsSKIPa''''']]<br /> |[[Os02g0759800]]<br /> | 6.249<br /> | 12883<br /> | 0.485<br /> | 2<br /> | 2<br /> | 2015/5/14 14:00<br /> |-<br /> |[[Os08g0101000|'''''IDEF1''''']]<br /> |[[Os08g0101000]]<br /> | 6.239<br /> | 10862<br /> | 0.574<br /> | 2<br /> | 2<br /> | 2015/6/12 17:22<br /> |-<br /> |[[Os09g0456200|'''''OsbZIP72''''']]<br /> |[[Os09g0456200]]<br /> | 6.23<br /> | 10901<br /> | 0.572<br /> | 2<br /> | 2<br /> | 2015/6/12 17:45<br /> |-<br /> |[[Os12g0101600|'''''leaf2''''']]<br /> |[[Os12g0101600]]<br /> | 6.221<br /> | 35095<br /> | 0.177<br /> | 2<br /> | 3<br /> | 2014/5/31 21:22<br /> |-<br /> |[[Os06g0695800|'''''STAR1''''']]<br /> |[[Os06g0695800]]<br /> | 6.213<br /> | 8582<br /> | 0.724<br /> | 2<br /> | 2<br /> | 2015/6/12 16:24<br /> |-<br /> |[[Os02g0606700|'''''RSS1''''']]<br /> |[[Os02g0606700]]<br /> | 6.198<br /> | 12432<br /> | 0.499<br /> | 2<br /> | 2<br /> | 2015/5/14 13:44<br /> |-<br /> |[[Os11g0210300|'''''Adh1''''']]<br /> |[[Os11g0210300]]<br /> | 6.196<br /> | 12384<br /> | 0.5<br /> | 3<br /> | 3<br /> | 2015/6/13 17:04<br /> |-<br /> |[[Os02g0736400|'''''OsDHODH''''']]<br /> |[[Os02g0736400]]<br /> | 6.183<br /> | 11839<br /> | 0.522<br /> | 2<br /> | 2<br /> | 2015/5/14 13:57<br /> |-<br /> |[[Os08g0549100|'''''OsAPx4''''']]<br /> |[[Os08g0549100]]<br /> | 6.175<br /> | 10093<br /> | 0.612<br /> | 2<br /> | 2<br /> | 2015/6/12 17:35<br /> |-<br /> |[[Os09g0452200|'''''LYP4''''']]<br /> |[[Os09g0452200]]<br /> | 6.171<br /> | 11987<br /> | 0.515<br /> | 2<br /> | 2<br /> | 2015/6/12 17:45<br /> |-<br /> |[[Os02g0170300|'''''OsMADS29''''']]<br /> |[[Os02g0170300]]<br /> | 6.166<br /> | 12582<br /> | 0.49<br /> | 3<br /> | 4<br /> | 2015/5/14 13:23<br /> |-<br /> |[[Os03g0224700|'''''Hsfs''''']]<br /> |[[Os03g0224700]]<br /> | 6.166<br /> | 11925<br /> | 0.517<br /> | 4<br /> | 4<br /> | 2015/6/12 13:35<br /> |-<br /> |[[Os07g0558500|'''''THF1''''']]<br /> |[[Os07g0558500]]<br /> | 6.078<br /> | 12744<br /> | 0.477<br /> | 5<br /> | 9<br /> | 2015/6/12 16:45<br /> |-<br /> |[[Os09g0511000|'''''OsCERK1''''']]<br /> |[[Os09g0511000]]<br /> | 6.076<br /> | 12097<br /> | 0.502<br /> | 2<br /> | 2<br /> | 2015/6/12 22:35<br /> |-<br /> |'''''[[OsWRKY13]]'''''<br /> |<br /> | 6.069<br /> | 6101<br /> | 0.995<br /> | 2<br /> | 3<br /> | 2014/6/4 20:18<br /> |-<br /> |[[Os06g0308100|'''''OsIBR5''''']]<br /> |[[Os06g0308100]]<br /> | 6.062<br /> | 12455<br /> | 0.487<br /> | 2<br /> | 2<br /> | 2015/6/12 16:13<br /> |-<br /> |[[Os11g0113700|'''''OsCIPK15''''']]<br /> |[[Os11g0113700]]<br /> | 5.961<br /> | 12261<br /> | 0.486<br /> | 3<br /> | 3<br /> | 2015/6/13 17:00<br /> |-<br /> |[[Os02g0656600|'''''GPA3''''']]<br /> |[[Os02g0656600]]<br /> | 5.915<br /> | 10022<br /> | 0.59<br /> | 2<br /> | 2<br /> | 2015/5/14 13:50<br /> |-<br /> |[[Os01g0733200|'''''OsHsfC1b''''']]<br /> |[[Os01g0733200]]<br /> | 5.889<br /> | 5889<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/31 11:56<br /> |-<br /> |[[Os01g0785400|'''''GH3''''']]<br /> |[[Os01g0785400]]<br /> | 5.864<br /> | 10600<br /> | 0.553<br /> | 2<br /> | 2<br /> | 2015/5/13 15:34<br /> |-<br /> |[[Os04g0541700|'''''Oshox22''''']]<br /> |[[Os04g0541700]]<br /> | 5.857<br /> | 6037<br /> | 0.97<br /> | 2<br /> | 3<br /> | 2014/6/8 16:10<br /> |-<br /> |[[Os08g0140500|'''''TDC-3''''']]<br /> |[[Os08g0140500]]<br /> | 5.829<br /> | 11343<br /> | 0.514<br /> | 2<br /> | 2<br /> | 2015/6/12 17:26<br /> |-<br /> |'''''[[IPK1]]'''''<br /> |<br /> | 5.803<br /> | 5803<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/8 16:55<br /> |-<br /> |[[Os09g0522100|'''''CBF''''']]<br /> |[[Os09g0522100]]<br /> | 5.713<br /> | 9270<br /> | 0.616<br /> | 2<br /> | 2<br /> | 2015/6/12 22:36<br /> |-<br /> |[[Os01g0177900|'''''OsABCG31''''']]<br /> |[[Os01g0177900]]<br /> | 5.693<br /> | 11327<br /> | 0.503<br /> | 2<br /> | 2<br /> | 2015/5/13 14:58<br /> |-<br /> |[[Os02g0149800|'''''OsPP18''''']]<br /> |[[Os02g0149800]]<br /> | 5.681<br /> | 11452<br /> | 0.496<br /> | 2<br /> | 2<br /> | 2015/5/14 13:22<br /> |-<br /> |[[Os01g0831000|'''''LAX''''']]<br /> |[[Os01g0831000]]<br /> | 5.68<br /> | 9517<br /> | 0.597<br /> | 2<br /> | 2<br /> | 2015/5/13 15:37<br /> |-<br /> |[[Os05g0580500|'''''OsRAD21-4''''']]<br /> |[[Os05g0580500]]<br /> | 5.66<br /> | 5660<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/23 11:03<br /> |-<br /> |'''''[[OsCERK1]]'''''<br /> |<br /> | 5.61<br /> | 5610<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/1 18:31<br /> |-<br /> |[[Os11g0116200|'''''LTPs''''']]<br /> |[[Os11g0116200]]<br /> | 5.602<br /> | 7206<br /> | 0.777<br /> | 3<br /> | 3<br /> | 2015/6/13 17:00<br /> |-<br /> |[[Os09g0567800|'''''Lipase''''']]<br /> |[[Os09g0567800]]<br /> | 5.558<br /> | 5558<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/6 16:24<br /> |-<br /> |[[Os06g0610350|'''''OsMOC1''''']]<br /> |[[Os06g0610350]]<br /> | 5.547<br /> | 5547<br /> | 1<br /> | 1<br /> | 1<br /> | 2016/6/12 13:57<br /> |-<br /> |[[Os02g0657000|'''''ARAG1''''']]<br /> |[[Os02g0657000]]<br /> | 5.536<br /> | 9210<br /> | 0.601<br /> | 2<br /> | 2<br /> | 2015/5/14 13:51<br /> |-<br /> |'''''[[Wbph8]]'''''<br /> |<br /> | 5.531<br /> | 5531<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/10 18:50<br /> |-<br /> |[[Os07g0563300|'''''GD1''''']]<br /> |[[Os07g0563300]]<br /> | 5.487<br /> | 11105<br /> | 0.494<br /> | 2<br /> | 2<br /> | 2015/6/12 16:45<br /> |-<br /> |[[Os06g0701700|'''''OsHKT2;1''''']]<br /> |[[Os06g0701700]]<br /> | 5.432<br /> | 8295<br /> | 0.655<br /> | 2<br /> | 2<br /> | 2015/6/12 16:26<br /> |-<br /> |[[Os10g0419200|'''''RID1''''']]<br /> |[[Os10g0419200]]<br /> | 5.432<br /> | 9118<br /> | 0.596<br /> | 3<br /> | 3<br /> | 2015/6/13 16:44<br /> |-<br /> |'''''[[OsCEBiP]]'''''<br /> |<br /> | 5.419<br /> | 5419<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/8 12:32<br /> |-<br /> |'''''[[Xa10]]'''''<br /> |<br /> | 5.416<br /> | 5416<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/1 16:52<br /> |-<br /> |[[Os03g0272300|'''''OsSDIR1''''']]<br /> |[[Os03g0272300]]<br /> | 5.41<br /> | 9862<br /> | 0.549<br /> | 2<br /> | 2<br /> | 2015/6/12 13:39<br /> |-<br /> |[[Os10g0528300|'''''GSTs''''']]<br /> |[[Os10g0528300]]<br /> | 5.364<br /> | 9566<br /> | 0.561<br /> | 3<br /> | 3<br /> | 2015/6/13 16:46<br /> |-<br /> |'''''[[Badh2]]'''''<br /> |<br /> | 5.363<br /> | 5363<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/8 19:38<br /> |-<br /> |[[Os03g0233900|'''''Hbs''''']]<br /> |[[Os03g0233900]]<br /> | 5.348<br /> | 9011<br /> | 0.593<br /> | 2<br /> | 2<br /> | 2015/6/12 13:38<br /> |-<br /> |'''''[[Xa21]]'''''<br /> |<br /> | 5.345<br /> | 5345<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/1 13:37<br /> |-<br /> |'''''[[Bls1]]'''''<br /> |<br /> | 5.308<br /> | 5308<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/24 15:17<br /> |-<br /> |[[Os06g0157700|'''''Hd3''''']]<br /> |[[Os06g0157700]]<br /> | 5.304<br /> | 10277<br /> | 0.516<br /> | 2<br /> | 2<br /> | 2015/6/12 16:06<br /> |-<br /> |[[Os02g0260200|'''''LP''''']]<br /> |[[Os02g0260200]]<br /> | 5.302<br /> | 7745<br /> | 0.685<br /> | 2<br /> | 2<br /> | 2015/5/14 13:37<br /> |-<br /> |[[Os03g0232600|'''''TUD1''''']]<br /> |[[Os03g0232600]]<br /> | 5.249<br /> | 10595<br /> | 0.495<br /> | 2<br /> | 2<br /> | 2015/6/12 13:37<br /> |-<br /> |[[Os03g0125100|'''''OsHYD3''''']]<br /> |[[Os03g0125100]]<br /> | 5.183<br /> | 10331<br /> | 0.502<br /> | 2<br /> | 2<br /> | 2015/6/12 13:01<br /> |-<br /> |[[Os06g0212900|'''''ORF3''''']]<br /> |[[Os06g0212900]]<br /> | 5.175<br /> | 6651<br /> | 0.778<br /> | 3<br /> | 3<br /> | 2015/6/12 16:09<br /> |-<br /> |[[Os02g0491300|'''''MTR1''''']]<br /> |[[Os02g0491300]]<br /> | 5.166<br /> | 10047<br /> | 0.514<br /> | 2<br /> | 2<br /> | 2015/5/14 13:40<br /> |-<br /> |[[Os09g0470500|'''''Oshox4''''']]<br /> |[[Os09g0470500]]<br /> | 5.144<br /> | 9661<br /> | 0.532<br /> | 2<br /> | 2<br /> | 2015/6/12 17:46<br /> |-<br /> |[[Os09g0439800|'''''DRO1''''']]<br /> |[[Os09g0439800]]<br /> | 5.122<br /> | 8022<br /> | 0.638<br /> | 3<br /> | 4<br /> | 2015/6/12 17:43<br /> |-<br /> |[[Os12g0555500|'''''PBZ1''''']]<br /> |[[Os12g0555500]]<br /> | 5.108<br /> | 8929<br /> | 0.572<br /> | 3<br /> | 3<br /> | 2015/6/13 17:17<br /> |-<br /> |[[Os11g0508600|'''''Os-11N3''''']]<br /> |[[Os11g0508600]]<br /> | 5.066<br /> | 7754<br /> | 0.653<br /> | 3<br /> | 3<br /> | 2015/6/13 17:07<br /> |-<br /> |[[Os08g0174500|'''''OsDTH8''''']]<br /> |[[Os08g0174500]]<br /> | 5.017<br /> | 9397<br /> | 0.534<br /> | 3<br /> | 3<br /> | 2015/6/12 17:28<br /> |-<br /> |[[Os03g0267200|'''''sHSP17.7''''']]<br /> |[[Os03g0267200]]<br /> | 5.008<br /> | 7991<br /> | 0.627<br /> | 2<br /> | 2<br /> | 2015/6/12 13:39<br /> |-<br /> |[[Os06g0622700|'''''OsbZIP50 ''''']]<br /> |[[Os06g0622700]]<br /> | 5<br /> | 9868<br /> | 0.507<br /> | 2<br /> | 2<br /> | 2015/6/12 16:19<br /> |-<br /> |'''''[[SBP]]'''''<br /> |<br /> | 4.997<br /> | 4997<br /> | 1<br /> | 1<br /> | 1<br /> | 2013/7/21 18:43<br /> |-<br /> |[[Os05g0465800|'''''PI3K''''']]<br /> |[[Os05g0465800]]<br /> | 4.939<br /> | 4939<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/6 16:19<br /> |-<br /> |[[Os10g0491000|'''''BSP''''']]<br /> |[[Os10g0491000]]<br /> | 4.912<br /> | 8991<br /> | 0.546<br /> | 3<br /> | 3<br /> | 2015/6/13 16:47<br /> |-<br /> |[[Os01g0206700|'''''OsCIPK05''''']]<br /> |[[Os01g0206700]]<br /> | 4.909<br /> | 9664<br /> | 0.508<br /> | 2<br /> | 2<br /> | 2015/5/13 15:05<br /> |-<br /> |[[Os06g0643300|'''''RISBZ1''''']]<br /> |[[Os06g0643300]]<br /> | 4.869<br /> | 7953<br /> | 0.612<br /> | 2<br /> | 2<br /> | 2015/6/12 16:20<br /> |-<br /> |[[Os03g0180800|'''''OsTIFY11a''''']]<br /> |[[Os03g0180800]]<br /> | 4.859<br /> | 8158<br /> | 0.596<br /> | 2<br /> | 2<br /> | 2015/6/12 13:04<br /> |-<br /> |'''''[[BPH_gene]]'''''<br /> |<br /> | 4.857<br /> | 4857<br /> | 1<br /> | 2<br /> | 2<br /> | 2014/6/11 11:14<br /> |-<br /> |[[Os01g0805600|'''''CycB1''''']]<br /> |[[Os01g0805600]]<br /> | 4.842<br /> | 4842<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/5 18:11<br /> |-<br /> |[[Os06g0701600|'''''HKT''''']]<br /> |[[Os06g0701600]]<br /> | 4.831<br /> | 7482<br /> | 0.646<br /> | 2<br /> | 2<br /> | 2015/6/12 16:25<br /> |-<br /> |[[Os08g0531600|'''''OsSPL16''''']]<br /> |[[Os08g0531600]]<br /> | 4.818<br /> | 4825<br /> | 0.999<br /> | 2<br /> | 2<br /> | 2014/5/27 23:11<br /> |-<br /> |[[Os06g0254700|'''''OsCLO-6''''']]<br /> |[[Os06g0254700]]<br /> | 4.802<br /> | 7514<br /> | 0.639<br /> | 2<br /> | 2<br /> | 2015/6/12 16:12<br /> |-<br /> |[[Os01g0615100|'''''OCPI2''''']]<br /> |[[Os01g0615100]]<br /> | 4.794<br /> | 7379<br /> | 0.65<br /> | 2<br /> | 2<br /> | 2015/5/13 15:19<br /> |-<br /> |'''''[[HSF]]'''''<br /> |<br /> | 4.772<br /> | 4781<br /> | 0.998<br /> | 2<br /> | 2<br /> | 2013/7/21 20:57<br /> |-<br /> |[[Os06g0125800|'''''OsBBI1''''']]<br /> |[[Os06g0125800]]<br /> | 4.629<br /> | 9410<br /> | 0.492<br /> | 2<br /> | 2<br /> | 2015/6/12 16:02<br /> |-<br /> |[[Os07g0628500|'''''OsbHLH1''''']]<br /> |[[Os07g0628500]]<br /> | 4.606<br /> | 8573<br /> | 0.537<br /> | 2<br /> | 2<br /> | 2015/6/12 16:48<br /> |-<br /> |[[Os07g0694700|'''''APX''''']]<br /> |[[Os07g0694700]]<br /> | 4.569<br /> | 8480<br /> | 0.539<br /> | 2<br /> | 2<br /> | 2015/6/12 16:50<br /> |-<br /> |[[Os01g0293100|'''''TIP2''''']]<br /> |[[Os01g0293100]]<br /> | 4.568<br /> | 8480<br /> | 0.539<br /> | 2<br /> | 2<br /> | 2015/5/13 15:12<br /> |-<br /> |'''''[[Rl14]]'''''<br /> |<br /> | 4.564<br /> | 4764<br /> | 0.958<br /> | 2<br /> | 2<br /> | 2014/6/10 11:19<br /> |-<br /> |'''''[[OsRPA2]]'''''<br /> |<br /> | 4.552<br /> | 4552<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/6 9:13<br /> |-<br /> |[[Os06g0604000|'''''OsWR2''''']]<br /> |[[Os06g0604000]]<br /> | 4.53<br /> | 8229<br /> | 0.55<br /> | 2<br /> | 2<br /> | 2015/6/12 16:18<br /> |-<br /> |[[Os01g0192000|'''''OsDOS''''']]<br /> |[[Os01g0192000]]<br /> | 4.527<br /> | 4527<br /> | 1<br /> | 1<br /> | 1<br /> | 2015/7/30 23:13<br /> |-<br /> |[[Os01g0922800|'''''OsMADS51''''']]<br /> |[[Os01g0922800]]<br /> | 4.506<br /> | 4506<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/24 18:45<br /> |-<br /> |[[Os02g0787300|'''''OsRac1''''']]<br /> |[[Os02g0787300]]<br /> | 4.483<br /> | 6886<br /> | 0.651<br /> | 2<br /> | 2<br /> | 2015/5/14 14:01<br /> |-<br /> |[[Os09g0439200|'''''OsJAZ8''''']]<br /> |[[Os09g0439200]]<br /> | 4.477<br /> | 8745<br /> | 0.512<br /> | 2<br /> | 2<br /> | 2015/6/12 17:42<br /> |-<br /> |[[Os01g0822900|'''''Dwarf1''''']]<br /> |[[Os01g0822900]]<br /> | 4.447<br /> | 7550<br /> | 0.589<br /> | 3<br /> | 4<br /> | 2015/5/13 15:36<br /> |-<br /> |[[Os08g0167500|'''''CRR6''''']]<br /> |[[Os08g0167500]]<br /> | 4.432<br /> | 8906<br /> | 0.498<br /> | 2<br /> | 2<br /> | 2015/6/12 17:27<br /> |-<br /> |'''''[[Sucrose_synthase]]'''''<br /> |<br /> | 4.428<br /> | 4436<br /> | 0.998<br /> | 2<br /> | 2<br /> | 2013/7/18 11:20<br /> |-<br /> |'''''[[CL971152]]'''''<br /> |<br /> | 4.417<br /> | 4472<br /> | 0.988<br /> | 2<br /> | 2<br /> | 2014/6/10 21:51<br /> |-<br /> |[[Os12g0603700|'''''OsCIPK04''''']]<br /> |[[Os12g0603700]]<br /> | 4.375<br /> | 9322<br /> | 0.469<br /> | 3<br /> | 3<br /> | 2015/6/13 17:18<br /> |-<br /> |[[Os02g0618400|'''''OsMPS''''']]<br /> |[[Os02g0618400]]<br /> | 4.347<br /> | 8707<br /> | 0.499<br /> | 2<br /> | 2<br /> | 2015/5/14 13:45<br /> |-<br /> |[[Os03g0182800|'''''OsDERF1''''']]<br /> |[[Os03g0182800]]<br /> | 4.322<br /> | 6519<br /> | 0.663<br /> | 2<br /> | 2<br /> | 2015/6/12 13:05<br /> |-<br /> |'''''[[ARF]]'''''<br /> |<br /> | 4.308<br /> | 4308<br /> | 1<br /> | 1<br /> | 1<br /> | 2013/7/21 20:46<br /> |-<br /> |[[Os03g0183000|'''''OsRAF''''']]<br /> |[[Os03g0183000]]<br /> | 4.286<br /> | 4286<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 20:10<br /> |-<br /> |[[Os02g0654700|'''''AP59''''']]<br /> |[[Os02g0654700]]<br /> | 4.285<br /> | 8306<br /> | 0.516<br /> | 2<br /> | 2<br /> | 2015/5/14 13:49<br /> |-<br /> |[[Os09g0466400|'''''OsZHD1''''']]<br /> |[[Os09g0466400]]<br /> | 4.265<br /> | 8095<br /> | 0.527<br /> | 2<br /> | 2<br /> | 2015/6/12 17:46<br /> |-<br /> |[[Os03g0103300|'''''qLTG3''''']]<br /> |[[Os03g0103300]]<br /> | 4.188<br /> | 7457<br /> | 0.562<br /> | 2<br /> | 2<br /> | 2015/6/12 12:56<br /> |-<br /> |[[Os01g0834400|'''''OsHAP3A''''']]<br /> |[[Os01g0834400]]<br /> | 4.109<br /> | 4109<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/31 19:19<br /> |-<br /> |[[Os05g0573500|'''''OsHAP3C''''']]<br /> |[[Os05g0573500]]<br /> | 4.109<br /> | 4109<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/31 19:19<br /> |-<br /> |[[Os07g0512200|'''''OsAtg8''''']]<br /> |[[Os07g0512200]]<br /> | 4.095<br /> | 7690<br /> | 0.533<br /> | 4<br /> | 4<br /> | 2015/6/12 16:43<br /> |-<br /> |'''''[[Bph9]]'''''<br /> |<br /> | 4.084<br /> | 4084<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 12:23<br /> |-<br /> |[[Os06g0181700|'''''OsWR1''''']]<br /> |[[Os06g0181700]]<br /> | 4.083<br /> | 7433<br /> | 0.549<br /> | 2<br /> | 2<br /> | 2015/6/12 16:07<br /> |-<br /> |[[Os06g0157500|'''''RFT1''''']]<br /> |[[Os06g0157500]]<br /> | 4.013<br /> | 7888<br /> | 0.509<br /> | 3<br /> | 3<br /> | 2015/6/12 16:06<br /> |-<br /> |[[Os09g0537700|'''''OsRNS4''''']]<br /> |[[Os09g0537700]]<br /> | 3.992<br /> | 6731<br /> | 0.593<br /> | 2<br /> | 2<br /> | 2015/6/12 22:36<br /> |-<br /> |[[Os02g0610500|'''''OsCOL4''''']]<br /> |[[Os02g0610500]]<br /> | 3.946<br /> | 3946<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/20 11:57<br /> |-<br /> |[[Os07g0529600|'''''OsDR8''''']]<br /> |[[Os07g0529600]]<br /> | 3.915<br /> | 6908<br /> | 0.567<br /> | 2<br /> | 2<br /> | 2015/6/12 16:44<br /> |-<br /> |[[Os09g0106700|'''''AKT1''''']]<br /> |[[Os09g0106700]]<br /> | 3.845<br /> | 6498<br /> | 0.592<br /> | 2<br /> | 2<br /> | 2015/6/12 17:37<br /> |-<br /> |[[Os07g0568700|'''''OsFOR1''''']]<br /> |[[Os07g0568700]]<br /> | 3.845<br /> | 6600<br /> | 0.583<br /> | 2<br /> | 2<br /> | 2015/6/12 16:46<br /> |-<br /> |'''''[[Pik-p]]'''''<br /> |<br /> | 3.816<br /> | 3816<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/6 10:16<br /> |-<br /> |[[Os06g0493100|'''''Bphi008a''''']]<br /> |[[Os06g0493100]]<br /> | 3.804<br /> | 7241<br /> | 0.525<br /> | 2<br /> | 2<br /> | 2015/6/12 16:14<br /> |-<br /> |[[Os02g0552700|'''''OsZFP6''''']]<br /> |[[Os02g0552700]]<br /> | 3.779<br /> | 6604<br /> | 0.572<br /> | 2<br /> | 2<br /> | 2015/5/14 13:43<br /> |-<br /> |[[Os12g0100500|'''''COG2267''''']]<br /> |[[Os12g0100500]]<br /> | 3.729<br /> | 5669<br /> | 0.658<br /> | 3<br /> | 3<br /> | 2015/6/13 17:09<br /> |-<br /> |[[Os07g0129200|'''''OsPR1''''']]<br /> |[[Os07g0129200]]<br /> | 3.716<br /> | 6629<br /> | 0.561<br /> | 2<br /> | 2<br /> | 2015/6/12 16:32<br /> |-<br /> |[[Os10g0558900|'''''RL14''''']]<br /> |[[Os10g0558900]]<br /> | 3.699<br /> | 7398<br /> | 0.5<br /> | 5<br /> | 9<br /> | 2015/6/13 16:57<br /> |-<br /> |[[Os01g0177400|'''''OsGA3ox2''''']]<br /> |[[Os01g0177400]]<br /> | 3.693<br /> | 6293<br /> | 0.587<br /> | 3<br /> | 3<br /> | 2015/5/13 14:57<br /> |-<br /> |[[Os09g0380200|'''''YLC1''''']]<br /> |[[Os09g0380200]]<br /> | 3.69<br /> | 6890<br /> | 0.536<br /> | 3<br /> | 3<br /> | 2015/6/12 17:40<br /> |-<br /> |[[Os08g0163400|'''''OsSIG1''''']]<br /> |[[Os08g0163400]]<br /> | 3.662<br /> | 3662<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 20:52<br /> |-<br /> |[[Os09g0396900|'''''OsVIT2''''']]<br /> |[[Os09g0396900]]<br /> | 3.437<br /> | 6527<br /> | 0.527<br /> | 2<br /> | 2<br /> | 2015/6/12 17:41<br /> |-<br /> |[[Os03g0786400|'''''OsCKX2''''']]<br /> |[[Os03g0786400]]<br /> | 3.372<br /> | 3372<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/20 0:08<br /> |-<br /> |'''''[[Bhp-3]]'''''<br /> |<br /> | 3.33<br /> | 3330<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/31 23:33<br /> |-<br /> |[[Os05g0489900|'''''OsCCaMK''''']]<br /> |[[Os05g0489900]]<br /> | 3.212<br /> | 6389<br /> | 0.503<br /> | 2<br /> | 2<br /> | 2015/6/12 16:49<br /> |-<br /> |[[Os07g0549600|'''''UDT1''''']]<br /> |[[Os07g0549600]]<br /> | 3.204<br /> | 5875<br /> | 0.545<br /> | 2<br /> | 2<br /> | 2015/6/12 16:44<br /> |-<br /> |[[Os11g0582500|'''''OsC6''''']]<br /> |[[Os11g0582500]]<br /> | 3.13<br /> | 5666<br /> | 0.552<br /> | 3<br /> | 3<br /> | 2015/6/13 17:09<br /> |-<br /> |[[Os03g0135700|'''''RAI1''''']]<br /> |[[Os03g0135700]]<br /> | 3.126<br /> | 3126<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/7 0:43<br /> |-<br /> |[[Os09g0459200|'''''SG1''''']]<br /> |[[Os09g0459200]]<br /> | 3.094<br /> | 5090<br /> | 0.608<br /> | 2<br /> | 2<br /> | 2015/6/12 17:46<br /> |-<br /> |[[Os11g0523700|'''''OsICE1''''']]<br /> |[[Os11g0523700]]<br /> | 3.071<br /> | 3079<br /> | 0.997<br /> | 2<br /> | 2<br /> | 2014/6/3 13:41<br /> |-<br /> |[[Os01g0928000|'''''OsICE2''''']]<br /> |[[Os01g0928000]]<br /> | 3.071<br /> | 3079<br /> | 0.997<br /> | 2<br /> | 2<br /> | 2014/6/3 13:41<br /> |-<br /> |[[Os09g0522200|'''''OsDREB1A''''']]<br /> |[[Os09g0522200]]<br /> | 3.031<br /> | 5920<br /> | 0.512<br /> | 3<br /> | 3<br /> | 2015/6/12 22:36<br /> |-<br /> |[[Os06g0127100|'''''OsDREB1C''''']]<br /> |[[Os06g0127100]]<br /> | 3.015<br /> | 5846<br /> | 0.516<br /> | 3<br /> | 3<br /> | 2015/6/12 16:02<br /> |-<br /> |[[Os10g0573400|'''''OsPYL10''''']]<br /> |[[Os10g0573400]]<br /> | 3.009<br /> | 6148<br /> | 0.489<br /> | 4<br /> | 4<br /> | 2015/6/13 16:58<br /> |-<br /> |[[Os01g0274800|'''''CSA''''']]<br /> |[[Os01g0274800]]<br /> | 2.805<br /> | 2805<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/28 21:34<br /> |-<br /> |[[BGIOSGA033504|'''''csld4''''']]<br /> |[[BGIOSGA033504]]<br /> | 2.803<br /> | 2818<br /> | 0.995<br /> | 2<br /> | 2<br /> | 2014/6/3 16:43<br /> |-<br /> |[[Os11g0454000|'''''rab16c''''']]<br /> |[[Os11g0454000]]<br /> | 2.786<br /> | 5342<br /> | 0.522<br /> | 3<br /> | 3<br /> | 2015/6/13 17:07<br /> |-<br /> |[[Os10g0148000|'''''OsDIL''''']]<br /> |[[Os10g0148000]]<br /> | 2.697<br /> | 5106<br /> | 0.528<br /> | 3<br /> | 3<br /> | 2015/6/13 16:44<br /> |-<br /> |[[Os08g0566600|'''''PGR5''''']]<br /> |[[Os08g0566600]]<br /> | 2.632<br /> | 4314<br /> | 0.61<br /> | 2<br /> | 2<br /> | 2015/6/12 17:35<br /> |-<br /> |[[Os03g0150200|'''''OsAP23''''']]<br /> |[[Os03g0150200]]<br /> | 2.621<br /> | 5115<br /> | 0.512<br /> | 2<br /> | 2<br /> | 2015/6/12 13:03<br /> |-<br /> |[[Os05g0341600|'''''RAB21''''']]<br /> |[[Os05g0341600]]<br /> | 2.592<br /> | 2640<br /> | 0.982<br /> | 2<br /> | 3<br /> | 2014/6/1 17:02<br /> |-<br /> |[[Os07g0191600|'''''STR2''''']]<br /> |[[Os07g0191600]]<br /> | 2.541<br /> | 2541<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/11 19:08<br /> |-<br /> |[[Os05g0107700|'''''xa5''''']]<br /> |[[Os05g0107700]]<br /> | 2.152<br /> | 2152<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/8 17:23<br /> |-<br /> |[[Os07g0492000|'''''OsNDPK1''''']]<br /> |[[Os07g0492000]]<br /> | 1.777<br /> | 1777<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/6/9 23:45<br /> |-<br /> |[[Os03g0741100|'''''OsbHLH148''''']]<br /> |[[Os03g0741100]]<br /> | 1.578<br /> | 1578<br /> | 1<br /> | 1<br /> | 1<br /> | 2014/5/19 3:18<br /> |}</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0463800&diff=278001 2017-05-12T03:36:46Z

<p>Xysj2028: /* Evolution */</p> <hr /> <div>The rice '''''Os05g0463800''''' was reported as '''''OsNF-YB3''''' in 2016 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os05g0463800''''' '''''&lt;=&gt;''''' '''''OsNF-YB3'''''<br /> ===Function===<br /> * Nuclear factor γ (NF-γ) is a ubiquitous transcription factor that regulates important physiological and developmental processes.&lt;ref name=&quot;ref1&quot; /&gt; <br /> * In plants, the roles of NF-γ were identified in regulation of embryogenesis, flowering time, chloroplast biogenesis, seed germination and stress tolerance.&lt;ref name=&quot;ref1&quot; /&gt; &lt;ref name=&quot;ref2&quot; /&gt; <br /> ===Expression===<br /> * Expression profile analysis covering the whole life cycle revealed that transcripts of OsNF-γ differentially accumulated in a tissue-specific preferential or constitutive manner.&lt;ref name=&quot;ref1&quot; /&gt; <br /> * Analysis of expression correlation and Gene Ontology annotation suggested that OsNF-Y genes were co-expressed with genes that participated in stress, accumulation of seed storage reserves, and plant development.<br /> * Co-expression analysis also revealed that OsNF-Y genes might interact with each other, suggesting that NF-γ subunits formed complexes that take part in transcriptional regulation.&lt;ref name=&quot;ref1&quot; /&gt; <br /> ===Evolution===<br /> * NF-γ is a heterotrimeric complex composed of three subunits: NF-γA (CBF-B/HAP2), NF-γB (CBF-A/HAP3), and NF-γC (CBF-C/HAP5). <br /> * NF-γ complexes are CCAAT-specific transcription factors that bind to CCAAT sites in DNA to control the expression of target genes&lt;ref name=&quot;ref1&quot; /&gt; .<br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * College of Life Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China<br /> * College of Plant Science and Technology, Huazhong Agricultural University, Wuhan, 430070, China<br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Yang, W., Lu, Z., Xiong, Y., &amp; Yao, J. (2016). Genome-wide identification and co-expression network analysis of the OsNF-γ gene family in rice. The Crop Journal.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref2&quot;&gt;<br /> Laloum T, De Mita S, Gamas P, Baudin M, Niebel A. CCAAT-box binding<br /> transcription factors in plants: Y so many? Trends Plant Sci. 2013<br /> Mar;18(3):157-66. doi: 10.1016/j.tplants.2012.07.004. Epub 2012 Aug 30. Review.<br /> Erratum in: Trends Plant Sci. 2013 Oct;18(10):594-5. PubMed PMID: 22939172.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> ==Structured Information==<br /> [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 5]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0834400&diff=278000 2017-05-12T03:35:31Z

<p>Xysj2028: /* Expression */</p> <hr /> <div>The rice Os01g0834400 was reported as '''''OsHAP3A''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> [[File:Os01g0834400.png|right|thumb|427px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> ===Gene Symbol===<br /> *'''''Os01g0834400''''' '''''&lt;=&gt;''''' '''''OsHAP3A,HAP3A'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 1]]<br /> [[Category:Chromosome 1]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0834400&diff=277999 2017-05-12T03:35:17Z

<p>Xysj2028: </p> <hr /> <div>The rice Os01g0834400 was reported as '''''OsHAP3A''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> [[File:Os01g0834400.png|right|thumb|427px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> ===Gene Symbol===<br /> *'''''Os01g0834400''''' '''''&lt;=&gt;''''' '''''OsHAP3A,HAP3A'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> <br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 1]]<br /> [[Category:Chromosome 1]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0834400&diff=277998 2017-05-12T03:34:54Z

<p>Xysj2028: /* Expression */</p> <hr /> <div>The rice Os01g0834400 was reported as '''''OsHAP3A''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os01g0834400''''' '''''&lt;=&gt;''''' '''''OsHAP3A,HAP3A'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> [[File:Os01g0834400.png|center|thumb|527px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 1]]<br /> [[Category:Chromosome 1]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0834400&diff=277997 2017-05-12T03:34:43Z

<p>Xysj2028: </p> <hr /> <div>The rice Os01g0834400 was reported as '''''OsHAP3A''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os01g0834400''''' '''''&lt;=&gt;''''' '''''OsHAP3A,HAP3A'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> [[File:Os01g0834400.png|center|thumb|727px|'''Figure 2.''' ''Figure 2. Expression patterns of OsHAP3 genes.&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 1]]<br /> [[Category:Chromosome 1]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Os01g0834400.png&diff=277996 2017-05-12T03:34:29Z

<p>Xysj2028: </p> <hr /> <div></div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0834400&diff=277995 2017-05-12T03:31:49Z

<p>Xysj2028: </p> <hr /> <div>The rice Os01g0834400 was reported as '''''OsHAP3A''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os01g0834400''''' '''''&lt;=&gt;''''' '''''OsHAP3A,HAP3A'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> [[File:Expression.png|top|thumb|350px| '''Figure. 1''' ''(from reference &lt;ref name=&quot;ref1&quot; /&gt;)'']]]]<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 1]]<br /> [[Category:Chromosome 1]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0834400&diff=277994 2017-05-12T03:30:47Z

<p>Xysj2028: </p> <hr /> <div>The rice Os01g0834400 was reported as '''''OsHAP3A''''' in 2003 by researchers from Japan,. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os01g0834400''''' '''''&lt;=&gt;''''' '''''OsHAP3A,HAP3A'''''<br /> <br /> ===Function===<br /> * '''''OsHAP3A''''' encode a HAP3/nuclear factor-YB (NF-YB)/CCAAT binding factor-A (CBF-A) subunit of a CCAAT-box binding complex in rice (Oryza sativa)<br /> * '''''OsHAP3A''''' genes regulate chloroplast biogenesis in rice.<br /> [[File:1.png|right|thumb|350px| '''Figure. 1''' ''(from reference &lt;ref name=&quot;ref1&quot; /&gt;)'']]<br /> <br /> ===Phenotypic analysis===<br /> * In the transgenic rice plants with antisense or RNAi construct of OsHAP3A, reduced expression of not only '''''OsHAP3A''''' but also '''''OsHAP3B''''' and '''''OsHAP3C''''' was observed. These plants had pale green leaves, in which the amount of chloro- phyll was reduced and chloroplasts were degenerated. <br /> * Lamella was not well developed and accumulation of starch was not detected. <br /> * The degenerated chloroplast formation was accompanied by reduced expression of nuclear-encoded photosynthesis genes such as RBCS and CAB, while expression of chloroplast-encoded genes was not affected or rather increased.<br /> <br /> ===Expression===<br /> [[File:Expression.png|top|thumb|350px| '''Figure. 1''' ''(from reference &lt;ref name=&quot;ref1&quot; /&gt;)'']]]]<br /> * '''''OsHAP3A''''' was expressed in various organs including leaves.<br /> <br /> ==Labs working on this gene==<br /> 1.Plant Genetics Laboratory, National Institute of Genetics, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.&lt;br&gt;<br /> 2.Department of Life Science, Graduate University for Advanced Studies, 1111 Yata, Mishima, Shizuoka-ken 411-8540, Japan.<br /> <br /> ==References==<br /> &lt;references&gt;&lt;ref name=&quot;ref1&quot;&gt; Kazumaru Miyoshi;Yukihiro Ito;Akiko Serizawa;Nori Kurata, OsHAP3 genes regulate chloroplast biogenesis in rice, The Plant Journal, 2003, 36(4): 532-540.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt; Thiruvengadam Thirumurugan,Yukihiro Ito,Takahiko Kubo,Akiko Serizawa,Nori Kurata, Identification, characterization and interaction of HAP family genes in rice, Molecular Genetics and Genomics, 2008, 279(3): 279-289.&lt;/ref&gt;<br /> &lt;/references&gt;<br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 1]]<br /> [[Category:Chromosome 1]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0512200&diff=277993 2017-05-12T03:22:26Z

<p>Xysj2028: /* References */</p> <hr /> <div>The rice Os07g0512200 was reported as Atg8 in 2006 by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os07g0512200''''' '''''&lt;=&gt;''''' '''''APG8, Atg8, Atg8a, OsATG8a, OsAtg8'''''<br /> <br /> ===Function===<br /> * Atg8 conjugation pathway is conserved in rice and may play important roles in rice autophagy.<br /> <br /> ===Phenotypic analysis===<br /> * Mutation analysis revealed that the con- served Gly117 residue of OsAtg8 was essential for its characteristic C-terminal cleavage as similar to that found in mammalian and yeast Atg8.<br /> <br /> ===Expression===<br /> * OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]<br /> <br /> ===Evolution===<br /> * The formation of the autophagosome is carried out by a set of autophagy-related proteins (Atg), highly conserved from yeast to mammals. The Atg8s play an essential role in autophagosome biogenesis. This family of proteins comprises a single member in yeast and several mammalian homologues.[3]<br /> * A recent genome-wide search revealed significant conservation among autophagy genes (Atgs) in yeast and Arabidopsis, indicating that the molecular basis of autophagy is well conserved in yeast and plants. In Arabidopsis, 25 Atg genes that are homologous to 12 of yeast Atg genes were found [4]. Among them, AtAtg7 and AtAtg9 have been shown to be involved in Arabidopsis autophagy [5], AtAtg8 and AtAtg4 are essential for Arabidopsis autophagy [6].<br /> <br /> ==Labs working on this gene==<br /> * Institute of Genetics, State Key Laboratory of Genetic Engineering, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China<br /> <br /> ==References==<br /> * [1]Wei Su ,Haijie Ma ,etc.(2006)Identification and characterization of two rice autophagy associated genes, OsAtg8 and OsAtg4.Mol Biol Rep (2006) 33:273–278<br /> <br /> * [2]Beth Levine and Guido Kroemer.(2008)Autophagy in the Pathogenesis of Disease.Cell 132, January 11, 2008<br /> <br /> * [3]Slobodkin MR1, Elazar Z.(2013)The Atg8 family: multifunctional ubiquitin-like key regulators of autophagy.Essays Biochem. 2013;55:51-64.<br /> <br /> * [4]Hanaoka H, Noda T, Shirano Y, Kato T, Hayashi H, Shibata D, Tabata S, Ohsumi Y (2002) Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene. Plant Physiol 129:1181–1193<br /> <br /> * [5]Doelling JH, Walker JM, Friedman EM, Thompson AR, Vierstra RD (2002) The APG8/12-activating enzyme APG7 is required for proper nutrient recycling and senescence in Arabidopsis thaliana. J Biol Chem 277:33105–33114<br /> <br /> * [6]Yoshimoto K, Hanaoka H, Sato S, Kato T, Tabata S, Noda T, Ohsumi Y (2004) Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for plant autophagy. Plant Cell 16:2967–2983<br /> <br /> * [7]Minibayeva F, Dmitrieva S, Ponomareva A, et al. Oxidative stress-induced autophagy in plants: The role of mitochondria[J]. Plant Physiology and Biochemistry, 2012, 59: 11-19.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 7]]<br /> [[Category:Chromosome 7]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0512200&diff=277992 2017-05-12T03:22:13Z

<p>Xysj2028: /* References */</p> <hr /> <div>The rice Os07g0512200 was reported as Atg8 in 2006 by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os07g0512200''''' '''''&lt;=&gt;''''' '''''APG8, Atg8, Atg8a, OsATG8a, OsAtg8'''''<br /> <br /> ===Function===<br /> * Atg8 conjugation pathway is conserved in rice and may play important roles in rice autophagy.<br /> <br /> ===Phenotypic analysis===<br /> * Mutation analysis revealed that the con- served Gly117 residue of OsAtg8 was essential for its characteristic C-terminal cleavage as similar to that found in mammalian and yeast Atg8.<br /> <br /> ===Expression===<br /> * OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]<br /> <br /> ===Evolution===<br /> * The formation of the autophagosome is carried out by a set of autophagy-related proteins (Atg), highly conserved from yeast to mammals. The Atg8s play an essential role in autophagosome biogenesis. This family of proteins comprises a single member in yeast and several mammalian homologues.[3]<br /> * A recent genome-wide search revealed significant conservation among autophagy genes (Atgs) in yeast and Arabidopsis, indicating that the molecular basis of autophagy is well conserved in yeast and plants. In Arabidopsis, 25 Atg genes that are homologous to 12 of yeast Atg genes were found [4]. Among them, AtAtg7 and AtAtg9 have been shown to be involved in Arabidopsis autophagy [5], AtAtg8 and AtAtg4 are essential for Arabidopsis autophagy [6].<br /> <br /> ==Labs working on this gene==<br /> * Institute of Genetics, State Key Laboratory of Genetic Engineering, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China<br /> <br /> ==References==<br /> * [1]Wei Su ,Haijie Ma ,etc.(2006)Identification and characterization of two rice autophagy associated genes, OsAtg8 and OsAtg4.Mol Biol Rep (2006) 33:273–278<br /> <br /> * [2]Beth Levine and Guido Kroemer.(2008)Autophagy in the Pathogenesis of Disease.Cell 132, January 11, 2008<br /> <br /> * [3]Slobodkin MR1, Elazar Z.(2013)The Atg8 family: multifunctional ubiquitin-like key regulators of autophagy.Essays Biochem. 2013;55:51-64.<br /> <br /> * [4]Hanaoka H, Noda T, Shirano Y, Kato T, Hayashi H, Shibata D, Tabata S, Ohsumi Y (2002) Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene. Plant Physiol 129:1181–1193<br /> <br /> * [5]Doelling JH, Walker JM, Friedman EM, Thompson AR, Vierstra RD (2002) The APG8/12-activating enzyme APG7 is required for proper nutrient recycling and senescence in Arabidopsis thaliana. J Biol Chem 277:33105–33114<br /> <br /> * [6]Yoshimoto K, Hanaoka H, Sato S, Kato T, Tabata S, Noda T, Ohsumi Y (2004) Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for<br /> plant autophagy. Plant Cell 16:2967–2983<br /> <br /> * [7]Minibayeva F, Dmitrieva S, Ponomareva A, et al. Oxidative stress-induced autophagy in plants: The role of mitochondria[J]. Plant Physiology and Biochemistry, 2012, 59: 11-19.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 7]]<br /> [[Category:Chromosome 7]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0512200&diff=277991 2017-05-12T03:21:35Z

<p>Xysj2028: </p> <hr /> <div>The rice Os07g0512200 was reported as Atg8 in 2006 by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os07g0512200''''' '''''&lt;=&gt;''''' '''''APG8, Atg8, Atg8a, OsATG8a, OsAtg8'''''<br /> <br /> ===Function===<br /> * Atg8 conjugation pathway is conserved in rice and may play important roles in rice autophagy.<br /> <br /> ===Phenotypic analysis===<br /> * Mutation analysis revealed that the con- served Gly117 residue of OsAtg8 was essential for its characteristic C-terminal cleavage as similar to that found in mammalian and yeast Atg8.<br /> <br /> ===Expression===<br /> * OsAtg8 could be detected from mature leaves, young leaves, mature roots, young roots, leaf sheaths, and spikes which indicated they are constitutive expressed gene and maybe have important role in rice.[1]<br /> <br /> ===Evolution===<br /> * The formation of the autophagosome is carried out by a set of autophagy-related proteins (Atg), highly conserved from yeast to mammals. The Atg8s play an essential role in autophagosome biogenesis. This family of proteins comprises a single member in yeast and several mammalian homologues.[3]<br /> * A recent genome-wide search revealed significant conservation among autophagy genes (Atgs) in yeast and Arabidopsis, indicating that the molecular basis of autophagy is well conserved in yeast and plants. In Arabidopsis, 25 Atg genes that are homologous to 12 of yeast Atg genes were found [4]. Among them, AtAtg7 and AtAtg9 have been shown to be involved in Arabidopsis autophagy [5], AtAtg8 and AtAtg4 are essential for Arabidopsis autophagy [6].<br /> <br /> ==Labs working on this gene==<br /> * Institute of Genetics, State Key Laboratory of Genetic Engineering, School of Life Sciences, Fudan University, 220 Handan Road, Shanghai 200433, China<br /> <br /> ==References==<br /> [1]Wei Su ,Haijie Ma ,etc.(2006)Identification and characterization of two rice autophagy associated genes, OsAtg8 and OsAtg4.Mol Biol Rep (2006) 33:273–278<br /> <br /> [2]Beth Levine and Guido Kroemer.(2008)Autophagy in the Pathogenesis of Disease.Cell 132, January 11, 2008<br /> <br /> [3]Slobodkin MR1, Elazar Z.(2013)The Atg8 family: multifunctional ubiquitin-like key regulators of autophagy.Essays Biochem. 2013;55:51-64.<br /> <br /> [4]Hanaoka H, Noda T, Shirano Y, Kato T, Hayashi H, Shibata D, Tabata S, Ohsumi Y (2002) Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene. Plant Physiol 129:1181–1193<br /> <br /> [5]Doelling JH, Walker JM, Friedman EM, Thompson AR, Vierstra RD (2002) The APG8/12-activating enzyme APG7 is required for proper nutrient recycling and senescence in Arabidopsis thaliana. J Biol Chem 277:33105–33114<br /> <br /> [6]Yoshimoto K, Hanaoka H, Sato S, Kato T, Tabata S, Noda T, Ohsumi Y (2004) Processing of ATG8s, ubiquitin-like proteins, and their deconjugation by ATG4s are essential for<br /> plant autophagy. Plant Cell 16:2967–2983<br /> <br /> [7]Minibayeva F, Dmitrieva S, Ponomareva A, et al. Oxidative stress-induced autophagy in plants: The role of mitochondria[J]. Plant Physiology and Biochemistry, 2012, 59: 11-19.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 7]]<br /> [[Category:Chromosome 7]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0610500&diff=277990 2017-05-12T03:18:52Z

<p>Xysj2028: /* Expression */</p> <hr /> <div><br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.<br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os02g0610500''''' '''''&lt;=&gt;''''' '''''OsBBX5, OsCCT06, OsCOL4, OsCOL4/OsD, OsD'''''<br /> ===function===<br /> [[File:Figure1.jpg|right|thumb|275px|'''Figure 1.''' '' Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> <br /> * OsCOL4 is a member of the CONSTANS-like (COL) family in rice.<br /> * OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. <br /> <br /> ===Phenotypic analysis===<br /> * In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. <br /> * Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants.<br /> * By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.<br /> * In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Evolution===<br /> <br /> * Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor&lt;ref name=&quot;ref1&quot; /&gt;s. <br /> * In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression&lt;ref name=&quot;ref2&quot; /&gt;. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end&lt;ref name=&quot;ref3&quot; /&gt; .<br /> * In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes &lt;ref name=&quot;ref4&quot; /&gt;. Among them, Hd1 was identified first via QTL analyses &lt;ref name=&quot;ref5&quot; /&gt;. <br /> * Two groups of rice COL proteins differ from those in Arabidopsis &lt;ref name=&quot;ref4&quot; /&gt;.<br /> <br /> ==Labs working on this gene==<br /> *Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea<br /> *Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea<br /> *Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea<br /> *Gyeongsang National University, Korea<br /> *the Plant Functional Genomics Laboratory at the POSTECH<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;（2010）OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 2]]<br /> [[Category:Chromosome 2]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0181700&diff=277989 2017-05-12T03:15:03Z

<p>Xysj2028: /* References */</p> <hr /> <div>The rice '''''Os06g0181700''''' was reported as '''''OsERF#002''''' in 2006 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from Japan. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os06g0181700''''' '''''&lt;=&gt;''''' '''''OsERF#002'''''<br /> <br /> ===Function===<br /> * Genes in the ERF family encode transcriptional regulators with a variety of functions involved in the developmental and physiological processes in plants.<br /> * It has been demonstrated that the AP2/ERF proteins have important functions in the transcriptional regulation of a variety of biological processes related to growth and development, as well as various responses to environmental stimuli.<br /> * Genes in the AP2 family have been shown to participate in the regulation of developmental processes, e.g. flower development (Elliott et al., 1996), spikelet meristem determinacy (Chuck et al., 1998), leaf epidermal cell identity (Moose and Sisco, 1996), and embryo development (Boutilier et al., 2002).&lt;ref name=&quot;ref2&quot; /&gt;<br /> <br /> ===Evolution===<br /> * The ERF family is a large gene family of transcription factors and is part of the AP2/ERF superfamily, which also contains the AP2 and RAV families<br /> * The AP2/ERF superfamily is defined by the AP2/ERF domain, which consists of about 60 to 70 amino acids and is involved in DNA binding.<br /> * The AP2 family proteins contain two repeated AP2/ERF domains, the ERF family proteins contain a single AP2/ERF domain, and the RAV family proteins contain a B3 domain, which is a DNA-binding domain conserved in other plant-specific transcription factors, including VP1/ABI3, in addition to the single AP2/ERF domain.<br /> * The expansion of the ERF family in plants might have been due to chromosomal/segmental duplication and tandem duplication, as well as more ancient transposition and homing.<br /> * Since rice is a cultivated species, selection either during domestication from its wild ancestor or during agricultural improvement in the subsequent time may also have been important for the evolution of rice ERF family.&lt;ref name=&quot;ref3&quot; /&gt;<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * Molecular and Cellular Breeding Research Group, Institute for Biological Resources and Functions, National Institute of Advanced Industrial Science and Technology, Tsukuba, Ibaraki 305–8566, Japan (T.N., K.S., H.S.); <br /> * Graduate School of Life and Environmental Sciences, University of Tsukuba, Tsukuba, Ibaraki 305–8672, Japan (T.N., T.F.)<br /> <br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Nakano T, Suzuki K, Fujimura T, Shinshi H. Genome-wide analysis of the ERF<br /> gene family in Arabidopsis and rice. Plant Physiol. 2006 Feb;140(2):411-32.<br /> PubMed PMID: 16407444; PubMed Central PMCID: PMC1361313.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref2&quot;&gt;<br /> Chuck G, Muszynski M, Kellogg E, Hake S, Schmidt RJ. The control of spikelet<br /> meristem identity by the branched silkless1 gene in maize. Science. 2002 Nov<br /> 8;298(5596):1238-41. PubMed PMID: 12424380.<br /> &lt;/ref&gt;<br /> * &lt;ref name=&quot;ref3&quot;&gt;<br /> Riechmann JL, Meyerowitz EM. The AP2/EREBP family of plant transcription<br /> factors. Biol Chem. 1998 Jun;379(6):633-46. Review. PubMed PMID: 9687012.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0157500&diff=277988 2017-05-12T03:14:31Z

<p>Xysj2028: /* Annotated Information */</p> <hr /> <div>The rice '''''Os06g0157500''''' was reported as '''''RFT1''''' in 2009 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:Fig. 2. A model for the photoperiodic control of flowering in rice.jpg|right|thumb|427px|'''Fig.2''' ''A model for the photoperiodic control of flowering in rice. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> ===Gene Symbol===<br /> *'''''Os06g0157500''''' '''''&lt;=&gt;''''' ''''' OsFTL3, OsRFT1, RFT'''''<br /> <br /> ===Function===<br /> * RFT1 promotes flowering in the absence of Hd3a, and that both Hd3a and RFT1 are essential for flowering under SD conditions. &lt;ref name=&quot;ref1&quot; /&gt;.<br /> * RFT1 is essential for LD flowering.<br /> * Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.<br /> <br /> ===Mutation===<br /> * Mutants in OsMADS50, a rice ortholog of Arabidopsis SUPPRESOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) did not flower up to 300 days after sowing under LD conditions, indicating that OsMADS50, which acts upstream of RFT1, promotes flowering under LD conditions.<br /> * A rice ortholog of Arabidopsis APETALA1, OsMADS14, was expressed in the floral meristem in wild-type but not in RFT1 RNAi plants, suggesting that OsMADS14 is activated by RFT1 protein in the SAM after the transition to flowering.<br /> <br /> ===Expression===<br /> * Transcript levels of RFT1 were very low in wild-type plants throughout development. The similarity of Hd3a and RFT1 expression patterns under SD and LD conditions, and in vascular tissues, suggests that RFT1 could function redundantly with Hd3a in promoting floral transition under SD conditions[3].<br /> <br /> ===Subcellular localization===<br /> * An RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions, suggesting that RFT1 is a florigen gene in rice.<br /> <br /> ===Evolution===<br /> * RFT1 is the closest homolog of 13 FT-like genes in rice to Hd3a, with 91% identity in their deduced amino acid sequences and is located only 11.5 kb from Hd3a on chromosome 6<br /> <br /> ==Labs working on this gene==<br /> *Genetic Resources Center, National Institute of Agrobiological Sciences, Kannondai Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Institute of Crop Sciences, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Iwate Agricultural Research Center, Narita, Kitakami, Iwate, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *National Institute of Genetics, 111-1 Yata, Mishima 411-8540,Japan &lt;ref name=&quot;ref1&quot; /&gt;. <br /> *Faculty of Agriculture, Iwate University, Morioka 020-8550, Japan &lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Reina Komiya*, Shuji Yokoi and Ko Shimamoto. A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice<br /> .Development 136, 3443-3450 (2009) doi:10.1242/dev.040170.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Ogiso-Tanaka E, Matsubara K, Yamamoto S-i, Nonoue Y, Wu J, et al. (2013) Natural Variation of the RICE FLOWERING LOCUS T 1 Contributes to Flowering Time Divergence in Rice. PLoS ONE 8(10): e75959. doi:10.1371/journal.pone.0075959&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0157500&diff=277987 2017-05-12T03:14:03Z

<p>Xysj2028: /* Annotated Information */</p> <hr /> <div>The rice '''''Os06g0157500''''' was reported as '''''RFT1''''' in 2009 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:Fig. 2. A model for the photoperiodic control of flowering in rice.jpg|right|thumb|427px|'''Fig.2.''' ''. A model for the photoperiodic control of flowering in rice. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> ===Gene Symbol===<br /> *'''''Os06g0157500''''' '''''&lt;=&gt;''''' ''''' OsFTL3, OsRFT1, RFT'''''<br /> <br /> ===Function===<br /> * RFT1 promotes flowering in the absence of Hd3a, and that both Hd3a and RFT1 are essential for flowering under SD conditions. &lt;ref name=&quot;ref1&quot; /&gt;.<br /> * RFT1 is essential for LD flowering.<br /> * Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.<br /> <br /> ===Mutation===<br /> * Mutants in OsMADS50, a rice ortholog of Arabidopsis SUPPRESOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) did not flower up to 300 days after sowing under LD conditions, indicating that OsMADS50, which acts upstream of RFT1, promotes flowering under LD conditions.<br /> * A rice ortholog of Arabidopsis APETALA1, OsMADS14, was expressed in the floral meristem in wild-type but not in RFT1 RNAi plants, suggesting that OsMADS14 is activated by RFT1 protein in the SAM after the transition to flowering.<br /> <br /> ===Expression===<br /> * Transcript levels of RFT1 were very low in wild-type plants throughout development. The similarity of Hd3a and RFT1 expression patterns under SD and LD conditions, and in vascular tissues, suggests that RFT1 could function redundantly with Hd3a in promoting floral transition under SD conditions[3].<br /> <br /> ===Subcellular localization===<br /> * An RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions, suggesting that RFT1 is a florigen gene in rice.<br /> <br /> ===Evolution===<br /> * RFT1 is the closest homolog of 13 FT-like genes in rice to Hd3a, with 91% identity in their deduced amino acid sequences and is located only 11.5 kb from Hd3a on chromosome 6<br /> <br /> ==Labs working on this gene==<br /> *Genetic Resources Center, National Institute of Agrobiological Sciences, Kannondai Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Institute of Crop Sciences, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Iwate Agricultural Research Center, Narita, Kitakami, Iwate, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *National Institute of Genetics, 111-1 Yata, Mishima 411-8540,Japan &lt;ref name=&quot;ref1&quot; /&gt;. <br /> *Faculty of Agriculture, Iwate University, Morioka 020-8550, Japan &lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Reina Komiya*, Shuji Yokoi and Ko Shimamoto. A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice<br /> .Development 136, 3443-3450 (2009) doi:10.1242/dev.040170.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Ogiso-Tanaka E, Matsubara K, Yamamoto S-i, Nonoue Y, Wu J, et al. (2013) Natural Variation of the RICE FLOWERING LOCUS T 1 Contributes to Flowering Time Divergence in Rice. PLoS ONE 8(10): e75959. doi:10.1371/journal.pone.0075959&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0157500&diff=277986 2017-05-12T03:13:50Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os06g0157500''''' was reported as '''''RFT1''''' in 2009 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:Fig. 2. A model for the photoperiodic control of flowering in rice.jpg|right|thumb|527px|'''Fig.2.''' ''. A model for the photoperiodic control of flowering in rice. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> ===Gene Symbol===<br /> *'''''Os06g0157500''''' '''''&lt;=&gt;''''' ''''' OsFTL3, OsRFT1, RFT'''''<br /> <br /> ===Function===<br /> * RFT1 promotes flowering in the absence of Hd3a, and that both Hd3a and RFT1 are essential for flowering under SD conditions. &lt;ref name=&quot;ref1&quot; /&gt;.<br /> * RFT1 is essential for LD flowering.<br /> * Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.<br /> <br /> ===Mutation===<br /> * Mutants in OsMADS50, a rice ortholog of Arabidopsis SUPPRESOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) did not flower up to 300 days after sowing under LD conditions, indicating that OsMADS50, which acts upstream of RFT1, promotes flowering under LD conditions.<br /> * A rice ortholog of Arabidopsis APETALA1, OsMADS14, was expressed in the floral meristem in wild-type but not in RFT1 RNAi plants, suggesting that OsMADS14 is activated by RFT1 protein in the SAM after the transition to flowering.<br /> <br /> ===Expression===<br /> * Transcript levels of RFT1 were very low in wild-type plants throughout development. The similarity of Hd3a and RFT1 expression patterns under SD and LD conditions, and in vascular tissues, suggests that RFT1 could function redundantly with Hd3a in promoting floral transition under SD conditions[3].<br /> <br /> ===Subcellular localization===<br /> * An RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions, suggesting that RFT1 is a florigen gene in rice.<br /> <br /> ===Evolution===<br /> * RFT1 is the closest homolog of 13 FT-like genes in rice to Hd3a, with 91% identity in their deduced amino acid sequences and is located only 11.5 kb from Hd3a on chromosome 6<br /> <br /> ==Labs working on this gene==<br /> *Genetic Resources Center, National Institute of Agrobiological Sciences, Kannondai Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Institute of Crop Sciences, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Iwate Agricultural Research Center, Narita, Kitakami, Iwate, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *National Institute of Genetics, 111-1 Yata, Mishima 411-8540,Japan &lt;ref name=&quot;ref1&quot; /&gt;. <br /> *Faculty of Agriculture, Iwate University, Morioka 020-8550, Japan &lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Reina Komiya*, Shuji Yokoi and Ko Shimamoto. A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice<br /> .Development 136, 3443-3450 (2009) doi:10.1242/dev.040170.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Ogiso-Tanaka E, Matsubara K, Yamamoto S-i, Nonoue Y, Wu J, et al. (2013) Natural Variation of the RICE FLOWERING LOCUS T 1 Contributes to Flowering Time Divergence in Rice. PLoS ONE 8(10): e75959. doi:10.1371/journal.pone.0075959&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0157500&diff=277985 2017-05-12T03:13:07Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os06g0157500''''' was reported as '''''RFT1''''' in 2009 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os06g0157500''''' '''''&lt;=&gt;''''' ''''' OsFTL3, OsRFT1, RFT'''''<br /> <br /> ===Function===<br /> * RFT1 promotes flowering in the absence of Hd3a, and that both Hd3a and RFT1 are essential for flowering under SD conditions. &lt;ref name=&quot;ref1&quot; /&gt;.<br /> * RFT1 is essential for LD flowering.<br /> * Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice.<br /> <br /> [[File:Fig.1. RFT1 encodes LD florigen.jpg|right|thumb|200px|''Fig.1'''' ''. RFT1 encodes LD florigen. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> [[File:Fig. 2. A model for the photoperiodic control of flowering in rice.jpg|center|thumb|450px|'''Fig.2.''' ''. A model for the photoperiodic control of flowering in rice. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> [http://www.ricedata.cn/reference/list/2537.htm]<br /> <br /> ===Mutation===<br /> * Mutants in OsMADS50, a rice ortholog of Arabidopsis SUPPRESOR OF OVEREXPRESSION OF CONSTANS 1 (SOC1) did not flower up to 300 days after sowing under LD conditions, indicating that OsMADS50, which acts upstream of RFT1, promotes flowering under LD conditions.<br /> * A rice ortholog of Arabidopsis APETALA1, OsMADS14, was expressed in the floral meristem in wild-type but not in RFT1 RNAi plants, suggesting that OsMADS14 is activated by RFT1 protein in the SAM after the transition to flowering.<br /> <br /> ===Expression===<br /> * Transcript levels of RFT1 were very low in wild-type plants throughout development. The similarity of Hd3a and RFT1 expression patterns under SD and LD conditions, and in vascular tissues, suggests that RFT1 could function redundantly with Hd3a in promoting floral transition under SD conditions[3].<br /> <br /> ===Subcellular localization===<br /> * An RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions, suggesting that RFT1 is a florigen gene in rice.<br /> <br /> ===Evolution===<br /> * RFT1 is the closest homolog of 13 FT-like genes in rice to Hd3a, with 91% identity in their deduced amino acid sequences and is located only 11.5 kb from Hd3a on chromosome 6<br /> <br /> ==Labs working on this gene==<br /> *Genetic Resources Center, National Institute of Agrobiological Sciences, Kannondai Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Institute of Crop Sciences, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Iwate Agricultural Research Center, Narita, Kitakami, Iwate, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *National Institute of Genetics, 111-1 Yata, Mishima 411-8540,Japan &lt;ref name=&quot;ref1&quot; /&gt;. <br /> *Faculty of Agriculture, Iwate University, Morioka 020-8550, Japan &lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Reina Komiya*, Shuji Yokoi and Ko Shimamoto. A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice<br /> .Development 136, 3443-3450 (2009) doi:10.1242/dev.040170.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Ogiso-Tanaka E, Matsubara K, Yamamoto S-i, Nonoue Y, Wu J, et al. (2013) Natural Variation of the RICE FLOWERING LOCUS T 1 Contributes to Flowering Time Divergence in Rice. PLoS ONE 8(10): e75959. doi:10.1371/journal.pone.0075959&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0610500&diff=277984 2017-05-12T03:04:05Z

<p>Xysj2028: </p> <hr /> <div><br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.<br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os02g0610500''''' '''''&lt;=&gt;''''' '''''OsBBX5, OsCCT06, OsCOL4, OsCOL4/OsD, OsD'''''<br /> ===function===<br /> [[File:Figure1.jpg|right|thumb|275px|'''Figure 1.''' '' Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> <br /> * OsCOL4 is a member of the CONSTANS-like (COL) family in rice.<br /> * OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. <br /> <br /> ===Phenotypic analysis===<br /> * In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants. By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Evolution===<br /> <br /> * Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor&lt;ref name=&quot;ref1&quot; /&gt;s. <br /> * In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression&lt;ref name=&quot;ref2&quot; /&gt;. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end&lt;ref name=&quot;ref3&quot; /&gt; .<br /> * In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes &lt;ref name=&quot;ref4&quot; /&gt;. Among them, Hd1 was identified first via QTL analyses &lt;ref name=&quot;ref5&quot; /&gt;. <br /> * Two groups of rice COL proteins differ from those in Arabidopsis &lt;ref name=&quot;ref4&quot; /&gt;.<br /> <br /> ==Labs working on this gene==<br /> *Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea<br /> *Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea<br /> *Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea<br /> *Gyeongsang National University, Korea<br /> *the Plant Functional Genomics Laboratory at the POSTECH<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;（2010）OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 2]]<br /> [[Category:Chromosome 2]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0126900&diff=277983 2017-05-09T13:38:51Z

<p>Xysj2028: /* Evolution */</p> <hr /> <div>The rice ''Os11g0126900'' was reported as ''NAC'' (an acronym for ''NAM'' [No Apical Meristem], ''ATAF1-2'', and ''CUC2'' [Cup-Shaped Cotyledon]) domain gene, ''OsNAC10'',in 2010 by Korean researchers.<br /> ==Annotated Information==<br /> ===Function===<br /> [[Image:finger.jpg|320px|thumb|right||'''Figure 1.'''''Difference in root growth of RCc3:OsNAC10 and GOS2:OsNAC10 plants. &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> '''''OsNAC10''''' plays important role in enhancing stress tolerance when overexpressed in rice.<br /> In Jeong, J. S's et al. research, they constructed two types of transgenic plants,'''''RCc3:OsNAC10''', '''GOS2:OsNAC10'''''.A phenotype evaluation of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'' and NT control plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the ''GOS2:OsNAC10'' plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the ''GOS2:OsNAC10'' plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, ''RCc3:OsNAC10'' plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, ''RCc3:OsNAC10'' plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, ''GOS2:OsNAC10'' plants remain similar total grain weight with NT controls under drought condition. Root volume, length, dry weight, and diameter of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'', and NT plants were measured after growth to the stage of reproduction. Root diameter of the RCc3:OsNAC10 plants was thicker than that of the GOS2:OsNAC10 and NT plants. The increase in root diameter of the ''RCc3:OsNAC10'' plants appears to be caused by an increase in cell number rather than cell size, as evidenced by the similar size of epidermal and exodermal cells between NT and ''RCc3:OsNAC10'' roots.(finger 1)&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * '''''OsNAC10''''' is expressed predominantly in roots and panicles&lt;ref name=&quot;ref1&quot; /&gt; (finger 2 A).[[Image:os1.jpg|320px|thumb|right||'''Figure 2.'''''Expression analyses of OsNAC10(from reference &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> <br /> * The expression of '''''OsNAC10''''' is induced by drought, high salinity, and ABA but not by low temperature&lt;ref name=&quot;ref1&quot; /&gt;.(finger 2 B) <br /> <br /> * 34 root-specific and 40 leaf-specific target genes were up-regulated when '''''OsNAC10''''' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [''P450'', ''Zn-finger'', ''HAK5'', ''2OG-Fe(Ⅱ)'',''NCED'', ''NAC'', and ''KUP3''] were increased in transgenic roots. Expression of two leaf-specific target genes, ''LRR'' and ''Peroxidase'', was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, ''F-box'' and ''Muts4'', was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Evolution===<br /> * According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, '''OsNAC10''' is in the subgroup Ⅰ&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Knowledge Extension===<br /> *Name of NAC. It derives from the three genes first described as containing the domain, no apical meristem (''NAM'') gene of ''Petunia'' &lt;ref name=&quot;ref2&quot; /&gt; and the ''ATAF1'', ''ATAF2'' and ''CUC'' (cup-shaped cotyledon) genes of Arabidopsis &lt;ref name=&quot;ref3&quot; /&gt;. <br /> <br /> *Structure of NAC. NAC proteins share a well conserved N-terminal NAC domain (∼150 amino acids; aa) and a diversified C-terminal transcription regulatory (TR) region.(finger 4a)&lt;ref name=&quot;ref4&quot; /&gt;The DB ability of NAC TFs is confined to the NAC domain which can be divided into five subdomains.(A–E;Figure 3a (i))The highly conserved positively charged subdomains C and D bind to DNA, whereas subdomain A may be involved in the formation of a functional dimer, and the divergent subdomains B and E may be responsible for the functional diversity of NAC genes.&lt;ref name=&quot;ref5&quot; /&gt;&lt;ref name=&quot;ref6&quot; /&gt;&lt;ref name=&quot;ref7&quot; /&gt;&lt;ref name=&quot;ref8&quot; /&gt;The TRR, generally lying at the highly diverged C-terminal [Figure 3a (i)], can either activate or repress transcription.&lt;ref name=&quot;ref4&quot; /&gt;<br /> <br /> *Regulation of NAC TFs. Expression of stress-responsive NACs may be tightly regulated by several stress-responsive cis-acting elements contained in the promoter region ( Figure 4b).&lt;ref name=&quot;ref4&quot; /&gt;These include the ABREs (ABA-responsive elements), DREs, LTREs (Low-temperature responsive elements), MYB (Myeloblastosis) and MYC (Myelocytomatosis) binding sites, W-Box, jasmonic acid responsive element and salicylic acid responsive element<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea. <br /> <br /> * National Academy of Agricultural Science, Suwon 441–707, Korea.<br /> <br /> * School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.<br /> <br /> * CropDesign NV, B–9052 Ghent, Belgium<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;<br /> Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). &quot;Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions.&quot; Plant Physiol 153(1): 185-197.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;<br /> Souer E, van Houwelingen A, Kloos D,et al. (1996).&quot;The no apical meristem gene of Petunia is required for pattern formation in embryos and flowers and is expressed at meristem and primordia boundaries.&quot;Cell 85(2):159–170&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;<br /> Aida M, Ishida T, Fukaki H,et al. (1997).&quot;Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.&quot; Plant Cell 9(6):841–857&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;<br /> Puranik, S.,Sahu, PP. Srivastava,PS.,et al. (2012). &quot;NAC proteins: regulation and role in stress tolerance.&quot; Trends Plant Sci 17(6): 369-381.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;<br /> Ernst HA, Olsen AN, Larsen S,et al.(2004).&quot;Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.&quot;EMBO Rep.5(3):297–303&lt;/ref&gt;<br /> &lt;ref name=&quot;ref6&quot;&gt;<br /> Jensen MK, Kjaersgaard T, Nielsen MM, et al.(2010).&quot;The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.&quot; Biochem J.426(2):183-96&lt;/ref&gt;<br /> &lt;ref name=&quot;ref7&quot;&gt;<br /> Chen Q, Wang Q, Xiong L, et al.(2011)&quot;A structural view of the conserved domain of rice stress-responsive NAC1.&quot; Protein Cell,2(1):55–63&lt;/ref&gt;<br /> &lt;ref name=&quot;ref8&quot;&gt;<br /> Ooka H, Satoh K, Doi K,et al.(2003).&quot;Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.&quot;DNA Res., 10（6):239–247&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 11]]<br /> [[Category:Chromosome 11]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0126900&diff=277982 2017-05-09T13:38:26Z

<p>Xysj2028: </p> <hr /> <div>The rice ''Os11g0126900'' was reported as ''NAC'' (an acronym for ''NAM'' [No Apical Meristem], ''ATAF1-2'', and ''CUC2'' [Cup-Shaped Cotyledon]) domain gene, ''OsNAC10'',in 2010 by Korean researchers.<br /> ==Annotated Information==<br /> ===Function===<br /> [[Image:finger.jpg|320px|thumb|right||'''Figure 1.'''''Difference in root growth of RCc3:OsNAC10 and GOS2:OsNAC10 plants. &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> '''''OsNAC10''''' plays important role in enhancing stress tolerance when overexpressed in rice.<br /> In Jeong, J. S's et al. research, they constructed two types of transgenic plants,'''''RCc3:OsNAC10''', '''GOS2:OsNAC10'''''.A phenotype evaluation of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'' and NT control plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the ''GOS2:OsNAC10'' plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the ''GOS2:OsNAC10'' plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, ''RCc3:OsNAC10'' plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, ''RCc3:OsNAC10'' plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, ''GOS2:OsNAC10'' plants remain similar total grain weight with NT controls under drought condition. Root volume, length, dry weight, and diameter of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'', and NT plants were measured after growth to the stage of reproduction. Root diameter of the RCc3:OsNAC10 plants was thicker than that of the GOS2:OsNAC10 and NT plants. The increase in root diameter of the ''RCc3:OsNAC10'' plants appears to be caused by an increase in cell number rather than cell size, as evidenced by the similar size of epidermal and exodermal cells between NT and ''RCc3:OsNAC10'' roots.(finger 1)&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * '''''OsNAC10''''' is expressed predominantly in roots and panicles&lt;ref name=&quot;ref1&quot; /&gt; (finger 2 A).[[Image:os1.jpg|320px|thumb|right||'''Figure 2.'''''Expression analyses of OsNAC10(from reference &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> <br /> * The expression of '''''OsNAC10''''' is induced by drought, high salinity, and ABA but not by low temperature&lt;ref name=&quot;ref1&quot; /&gt;.(finger 2 B) <br /> <br /> * 34 root-specific and 40 leaf-specific target genes were up-regulated when '''''OsNAC10''''' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [''P450'', ''Zn-finger'', ''HAK5'', ''2OG-Fe(Ⅱ)'',''NCED'', ''NAC'', and ''KUP3''] were increased in transgenic roots. Expression of two leaf-specific target genes, ''LRR'' and ''Peroxidase'', was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, ''F-box'' and ''Muts4'', was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Evolution===<br /> According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, '''OsNAC10''' is in the subgroup Ⅰ(finger 3)&lt;ref name=&quot;ref1&quot; /&gt;.<br /> ===Knowledge Extension===<br /> *Name of NAC. It derives from the three genes first described as containing the domain, no apical meristem (''NAM'') gene of ''Petunia'' &lt;ref name=&quot;ref2&quot; /&gt; and the ''ATAF1'', ''ATAF2'' and ''CUC'' (cup-shaped cotyledon) genes of Arabidopsis &lt;ref name=&quot;ref3&quot; /&gt;. <br /> <br /> *Structure of NAC. NAC proteins share a well conserved N-terminal NAC domain (∼150 amino acids; aa) and a diversified C-terminal transcription regulatory (TR) region.(finger 4a)&lt;ref name=&quot;ref4&quot; /&gt;The DB ability of NAC TFs is confined to the NAC domain which can be divided into five subdomains.(A–E;Figure 3a (i))The highly conserved positively charged subdomains C and D bind to DNA, whereas subdomain A may be involved in the formation of a functional dimer, and the divergent subdomains B and E may be responsible for the functional diversity of NAC genes.&lt;ref name=&quot;ref5&quot; /&gt;&lt;ref name=&quot;ref6&quot; /&gt;&lt;ref name=&quot;ref7&quot; /&gt;&lt;ref name=&quot;ref8&quot; /&gt;The TRR, generally lying at the highly diverged C-terminal [Figure 3a (i)], can either activate or repress transcription.&lt;ref name=&quot;ref4&quot; /&gt;<br /> <br /> *Regulation of NAC TFs. Expression of stress-responsive NACs may be tightly regulated by several stress-responsive cis-acting elements contained in the promoter region ( Figure 4b).&lt;ref name=&quot;ref4&quot; /&gt;These include the ABREs (ABA-responsive elements), DREs, LTREs (Low-temperature responsive elements), MYB (Myeloblastosis) and MYC (Myelocytomatosis) binding sites, W-Box, jasmonic acid responsive element and salicylic acid responsive element<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea. <br /> <br /> * National Academy of Agricultural Science, Suwon 441–707, Korea.<br /> <br /> * School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.<br /> <br /> * CropDesign NV, B–9052 Ghent, Belgium<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;<br /> Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). &quot;Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions.&quot; Plant Physiol 153(1): 185-197.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;<br /> Souer E, van Houwelingen A, Kloos D,et al. (1996).&quot;The no apical meristem gene of Petunia is required for pattern formation in embryos and flowers and is expressed at meristem and primordia boundaries.&quot;Cell 85(2):159–170&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;<br /> Aida M, Ishida T, Fukaki H,et al. (1997).&quot;Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.&quot; Plant Cell 9(6):841–857&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;<br /> Puranik, S.,Sahu, PP. Srivastava,PS.,et al. (2012). &quot;NAC proteins: regulation and role in stress tolerance.&quot; Trends Plant Sci 17(6): 369-381.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;<br /> Ernst HA, Olsen AN, Larsen S,et al.(2004).&quot;Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.&quot;EMBO Rep.5(3):297–303&lt;/ref&gt;<br /> &lt;ref name=&quot;ref6&quot;&gt;<br /> Jensen MK, Kjaersgaard T, Nielsen MM, et al.(2010).&quot;The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.&quot; Biochem J.426(2):183-96&lt;/ref&gt;<br /> &lt;ref name=&quot;ref7&quot;&gt;<br /> Chen Q, Wang Q, Xiong L, et al.(2011)&quot;A structural view of the conserved domain of rice stress-responsive NAC1.&quot; Protein Cell,2(1):55–63&lt;/ref&gt;<br /> &lt;ref name=&quot;ref8&quot;&gt;<br /> Ooka H, Satoh K, Doi K,et al.(2003).&quot;Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.&quot;DNA Res., 10（6):239–247&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 11]]<br /> [[Category:Chromosome 11]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0126900&diff=277981 2017-05-09T13:38:02Z

<p>Xysj2028: </p> <hr /> <div>The rice ''Os11g0126900'' was reported as ''NAC'' (an acronym for ''NAM'' [No Apical Meristem], ''ATAF1-2'', and ''CUC2'' [Cup-Shaped Cotyledon]) domain gene, ''OsNAC10'',in 2010 by Korean researchers.<br /> ==Annotated Information==<br /> ===Function===<br /> [[Image:finger.jpg|320px|thumb|right||'''Figure 1.'''''Difference in root growth of RCc3:OsNAC10 and GOS2:OsNAC10 plants. &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> '''''OsNAC10''''' plays important role in enhancing stress tolerance when overexpressed in rice.<br /> In Jeong, J. S's et al. research, they constructed two types of transgenic plants,'''''RCc3:OsNAC10''', '''GOS2:OsNAC10'''''.A phenotype evaluation of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'' and NT control plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the ''GOS2:OsNAC10'' plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the ''GOS2:OsNAC10'' plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, ''RCc3:OsNAC10'' plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, ''RCc3:OsNAC10'' plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, ''GOS2:OsNAC10'' plants remain similar total grain weight with NT controls under drought condition. Root volume, length, dry weight, and diameter of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'', and NT plants were measured after growth to the stage of reproduction. Root diameter of the RCc3:OsNAC10 plants was thicker than that of the GOS2:OsNAC10 and NT plants. The increase in root diameter of the ''RCc3:OsNAC10'' plants appears to be caused by an increase in cell number rather than cell size, as evidenced by the similar size of epidermal and exodermal cells between NT and ''RCc3:OsNAC10'' roots.(finger 1)&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * '''''OsNAC10''''' is expressed predominantly in roots and panicles&lt;ref name=&quot;ref1&quot; /&gt; (finger 2 A).[[Image:os1.jpg|320px|thumb|right||'''Figure 2.'''''Expression analyses of OsNAC10(from reference &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> <br /> * The expression of '''''OsNAC10''''' is induced by drought, high salinity, and ABA but not by low temperature&lt;ref name=&quot;ref1&quot; /&gt;.(finger 2 B) <br /> <br /> * 34 root-specific and 40 leaf-specific target genes were up-regulated when '''''OsNAC10''''' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [''P450'', ''Zn-finger'', ''HAK5'', ''2OG-Fe(Ⅱ)'',''NCED'', ''NAC'', and ''KUP3''] were increased in transgenic roots. Expression of two leaf-specific target genes, ''LRR'' and ''Peroxidase'', was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, ''F-box'' and ''Muts4'', was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Evolution===<br /> According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, '''OsNAC10''' is in the subgroup Ⅰ(finger 3)&lt;ref name=&quot;ref1&quot; /&gt;.<br /> ===Knowledge Extension===<br /> *Name of NAC. It derives from the three genes first described as containing the domain, no apical meristem (''NAM'') gene of ''Petunia'' &lt;ref name=&quot;ref2&quot; /&gt; and the ''ATAF1'', ''ATAF2'' and ''CUC'' (cup-shaped cotyledon) genes of Arabidopsis &lt;ref name=&quot;ref3&quot; /&gt;. <br /> <br /> *Structure of NAC. NAC proteins share a well conserved N-terminal NAC domain (∼150 amino acids; aa) and a diversified C-terminal transcription regulatory (TR) region.(finger 4a)&lt;ref name=&quot;ref4&quot; /&gt;The DB ability of NAC TFs is confined to the NAC domain which can be divided into five subdomains.(A–E;Figure 3a (i))The highly conserved positively charged subdomains C and D bind to DNA, whereas subdomain A may be involved in the formation of a functional dimer, and the divergent subdomains B and E may be responsible for the functional diversity of NAC genes.&lt;ref name=&quot;ref5&quot; /&gt;&lt;ref name=&quot;ref6&quot; /&gt;&lt;ref name=&quot;ref7&quot; /&gt;&lt;ref name=&quot;ref8&quot; /&gt;The TRR, generally lying at the highly diverged C-terminal [Figure 3a (i)], can either activate or repress transcription.&lt;ref name=&quot;ref4&quot; /&gt;<br /> <br /> *Regulation of NAC TFs. Expression of stress-responsive NACs may be tightly regulated by several stress-responsive cis-acting elements contained in the promoter region ( Figure 4b).&lt;ref name=&quot;ref4&quot; /&gt;These include the ABREs (ABA-responsive elements), DREs, LTREs (Low-temperature responsive elements), MYB (Myeloblastosis) and MYC (Myelocytomatosis) binding sites, W-Box, jasmonic acid responsive element and salicylic acid responsive element<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea. <br /> <br /> * National Academy of Agricultural Science, Suwon 441–707, Korea.<br /> <br /> * School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.<br /> <br /> * CropDesign NV, B–9052 Ghent, Belgium<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;<br /> Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). &quot;Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions.&quot; Plant Physiol 153(1): 185-197.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;<br /> Souer E, van Houwelingen A, Kloos D,et al. (1996).&quot;The no apical meristem gene of Petunia is required for pattern formation in embryos and flowers and is expressed at meristem and primordia boundaries.&quot;Cell 85(2):159–170&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;<br /> Aida M, Ishida T, Fukaki H,et al. (1997).&quot;Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.&quot; Plant Cell 9(6):841–857&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;<br /> Puranik, S.,Sahu, PP. Srivastava,PS.,et al. (2012). &quot;NAC proteins: regulation and role in stress tolerance.&quot; Trends Plant Sci 17(6): 369-381.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;<br /> Ernst HA, Olsen AN, Larsen S,et al.(2004).&quot;Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.&quot;EMBO Rep.5(3):297–303&lt;/ref&gt;<br /> &lt;ref name=&quot;ref6&quot;&gt;<br /> Jensen MK, Kjaersgaard T, Nielsen MM, et al.(2010).&quot;The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.&quot; Biochem J.426(2):183-96&lt;/ref&gt;<br /> &lt;ref name=&quot;ref7&quot;&gt;<br /> Chen Q, Wang Q, Xiong L, et al.(2011)&quot;A structural view of the conserved domain of rice stress-responsive NAC1.&quot; Protein Cell,2(1):55–63&lt;/ref&gt;<br /> &lt;ref name=&quot;ref8&quot;&gt;<br /> Ooka H, Satoh K, Doi K,et al.(2003).&quot;Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.&quot;DNA Res., 10（6):239–247&lt;/ref&gt;<br /> &lt;references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 11]]<br /> [[Category:Chromosome 11]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0537700&diff=277980 2017-05-08T15:57:37Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os09g0537700''''' was reported as '''''OsRNS4''''' in 2014 by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os02g0187800''''' '''''&lt;=&gt;''''' '''''OsRNS4, OsRRP, RNaseDIS'''''<br /> <br /> ===Function===<br /> * S-like ribonucleases (S-like RNases) are homologous to S-ribonucleases (S-RNases), but are not involved in self-incompatibility. <br /> * In dicotyledonous plants, S-like RNases play an important role in phosphate recycling during senescence and are induced by inorganic phosphate-starvation and in response to defense and mechanical wounding.<br /> <br /> ===Phenotypic analysis===<br /> * The seedlings overexpressing OsRNS4 had longer coleoptiles and first leaves than wild-type seedlings under red light (R) and far-red light (FR), suggesting negative regulation of OsRNS4 in photomor-phogenesis in rice seedlings.<br /> * Moreover, ABA-induced growth inhibition of rice seedlings was significantly increased in the OsRNS4-overexpression (OsRNS4-OX) lines compared with that in WT, suggesting that OsRNS4 probably acts as a positive regulator in ABA responses in rice seedlings. <br /> * In addition, our results demonstrate that OsRNS4-OX lines have enhanced tolerance to high salinity compared to WT.<br /> <br /> ===Expression===<br /> * The OsRNS4 gene was expressed at relatively high levels in leaves although its transcripts were detected in various organs. OsRNS4 expression was regulated by salt, PEG and ABA.<br /> <br /> ===Evolution===<br /> * The process of genome evolution by duplication in each species appears to have been quite different. Functional classifications of the proteins based on Gene Ontology (GO) annotations are shown in Figure 2; the numbers of known functional domains were not significantly different between the two species.<br /> <br /> ==Labs working on this gene==<br /> * Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China<br /> * Shandong Provincial Key Laboratory of Crop Genetic Improvement, Ecology and Physiology, 250100 Jinan, China<br /> <br /> ==References==<br /> * (2005). The map-based sequence of the rice genome. Nature 436, 793-800.<br /> * Itoh, T., Tanaka, T., Barrero, R.A., Yamasaki, C., Fujii, Y., Hilton, P.B., Antonio, B.A., Aono, H., Apweiler, R., Bruskiewich, R., et al. (2007). Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Genome research 17, 175-183.<br /> * Ohyanagi, H., Tanaka, T., Sakai, H., Shigemoto, Y., Yamaguchi, K., Habara, T., Fujii, Y., Antonio, B.A., Nagamura, Y., Imanishi, T., et al. (2006). The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Nucleic acids research 34, D741-744.<br /> * Tanaka, T., Antonio, B.A., Kikuchi, S., Matsumoto, T., Nagamura, Y., Numa, H., Sakai, H., Wu, J., Itoh, T., Sasaki, T., et al. (2008). The Rice Annotation Project Database (RAP-DB): 2008 update. Nucleic acids research 36, D1028-1033.<br /> * Zheng, J., Wang, Y.Y., He, Y.A., Zhou, J.J., Li, Y.P., Liu, Q.Q., and Xie, X.Z. (2014). Overexpression of an S-like ribonuclease gene, OsRNS4, confers enhanced tolerance to high salinity and hyposensitivity to phytochrome-mediated light signals in rice. Plant Sci 214, 99-105.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 9]]<br /> [[Category:Chromosome 9]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0561600&diff=277979 2017-05-08T13:17:22Z

<p>Xysj2028: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> <br /> OsDEES1,a rice WAK-RLK gene,plays a role in rice sexual reproduction by regulating female gametophyte development.OsDEES1 silencing by RNA interference caused a high rate of female sterility&lt;ref name=&quot;ref1&quot; /&gt;. Crossing experiments showed that female reproductive organs lacking OsDEES1 carried a functional defect&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===The phenotype of OsDEES1 RNA interference plants===<br /> the knockdown of OsDEES1 expression did not affect megasporogenesis<br /> but that it disturbed female gametophyte formation, resulting in a degenerated embryo sac and defective seed formation.The RNAi transgenic<br /> rice exhibited a near-normal morphology in terms of growth but a high rate of sterility (Fig. 1, A and B).Of 44 RNAi transgenic plants obtained over<br /> three years (2005, 2006, and 2007), 33 had high rates of sterility (Fig. 1C).A semiquantitative reverse transcription (RT)-PCR assay revealed that the mRNA expression of endogenous OsDEES1 was significantly<br /> down-regulated in our RNAi plants (Fig. 1D)&lt;ref name=&quot;ref1&quot; /&gt;.<br /> [[File:Fig 1.png|right|thumb|320px|'''Figure 1. Analysis of the sterile phenotype in the OsDEES1 RNAi transgenic rice plants.''' ]]<br /> <br /> ===Expression===<br /> OsDEES1 exhibited a tissue-specific expression pattern in flowers and seedlings. In the ovary, OsDEES1 was expressed in the megagametophyte region and surrounding nucellus cells in the ovule near the micropylar region.OsDEES1pro::GUS construct was induced into rice plants by A. tumefaciensmediated callus transformation&lt;ref name=&quot;ref1&quot; /&gt;. Histochemical staining revealed OsDEES1 expression in floral tissues(anthers, pistils, and lodicules) as well as in the coleoptile,node, and leaf tongue of seedlings, but not in the leaf blade or root(Fig. 2A).ovarian sections from OsDEES1pro::GUS transgenic plants were generated for immunohistochemical<br /> analysis using anti-GUS antibodies. As shown in Figure2B, a strong GUS immunolocalization signal(brown) was detected in the ovule and lodicules (Fig.2Bb).In the enlarged image of the ovule, OsDEES1 expression can be seen in the megagametophyte region and surrounding nucellus cells near the micropyle (i.e.the area where the embryo sac formed and developed;Fig. 2Bc)&lt;ref name=&quot;ref1&quot; /&gt;.<br /> [[File:Fig 2.png|below|thumb|320px|'''Figure 2. OsDEES1 expression pattern in various plant tissues and immunolocalization in the ovary..''' ]]<br /> <br /> ===Evolution===<br /> Online sequence analyses have shown that OsDEES1 possesses a typical receptor kinase structure, including an extracellular domain, a transmembrane domain,and an intracellular kinase domain (http://plantsp.<br /> genomics.purdue.edu/feature_scan.html).the extracellular region of OsDEES1 has a signal peptide composed of 19 amino acids at the N terminus and two EGF repeat-like domains (EGF2 andEGF-Ca) near the transmembrane region. The typical ATP-binding motif and kinase active site can also be found in the intracellular domain (Fig. 3A)&lt;ref name=&quot;ref1&quot; /&gt;. Phylogenetic tree analysis showed that OsDEES1 shares 41% identity with three Arabidopsis WAKs (AtWAK1, -2,and -4), whereas the three AtWAKs exhibited approximately 73% identity among themselves (Fig. 3B)&lt;ref name=&quot;ref1&quot; /&gt;.Notably, compared with AtWAKs, OsDEES1 possesses an additional 42 amino acids in its extracellular domain but lacks 63 amino acids at its C terminus (Fig.3A).<br /> <br /> ==Localization==<br /> The OsDEES1 gene product has a membranelocalizing signal peptide and is thus speculated to be a plasma membrane protein (http://cdna01.dna.<br /> affrc.go.jp/cDNA/).YFP was ubiquitously localized in the cytoplasm, whereas OsDEES1DK-YFP was localized to the plasma membrane region in tobacco cells. In onion cells after plasmolysis, OsDEES1DK-YFP was detected in the plasma membrane region, in the cell wall (long arrow), and in thread-like structures (short arrow) between the cell wall and plasma membrane&lt;ref name=&quot;ref1&quot; /&gt;. The right-most images offer enlarged views of the circumscribed region(Fig.3C).<br /> <br /> ==Labs working on this gene==<br /> *Hebei Key Laboratory of Molecular and Cellular Biology, College of Life Sciences, Hebei Normal University,Shijiazhuang 050016, China<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Na Wang, Hui-Jia Huang, Su-Ting Ren,et al,.The Rice Wall-Associated Receptor-Like Kinase Gene OsDEES1 Plays a Role in Female Gametophyte Development[J].Plant Physiology,2012,160,696–707,<br /> &lt;/references&gt;<br /> == Structured Information ==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 9]]<br /> [[Category:Chromosome 9]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0126900&diff=277978 2017-05-08T13:16:14Z

<p>Xysj2028: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> The rice ''Os11g0126900'' was reported as ''NAC'' (an acronym for ''NAM'' [No Apical Meristem], ''ATAF1-2'', and ''CUC2'' [Cup-Shaped Cotyledon]) domain gene, ''OsNAC10'',in 2010 by Korean researchers.<br /> ==Annotated Information==<br /> ===Function===<br /> [[Image:finger.jpg|320px|thumb|right||'''Figure 1.'''''Difference in root growth of RCc3:OsNAC10 and GOS2:OsNAC10 plants. &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> '''''OsNAC10''''' plays important role in enhancing stress tolerance when overexpressed in rice.<br /> In Jeong, J. S's et al. research, they constructed two types of transgenic plants,'''''RCc3:OsNAC10''', '''GOS2:OsNAC10'''''.A phenotype evaluation of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'' and NT control plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the ''GOS2:OsNAC10'' plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the ''GOS2:OsNAC10'' plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, ''RCc3:OsNAC10'' plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, ''RCc3:OsNAC10'' plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, ''GOS2:OsNAC10'' plants remain similar total grain weight with NT controls under drought condition. Root volume, length, dry weight, and diameter of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'', and NT plants were measured after growth to the stage of reproduction. Root diameter of the RCc3:OsNAC10 plants was thicker than that of the GOS2:OsNAC10 and NT plants. The increase in root diameter of the ''RCc3:OsNAC10'' plants appears to be caused by an increase in cell number rather than cell size, as evidenced by the similar size of epidermal and exodermal cells between NT and ''RCc3:OsNAC10'' roots.(finger 1)&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * '''''OsNAC10''''' is expressed predominantly in roots and panicles&lt;ref name=&quot;ref1&quot; /&gt; (finger 2 A).[[Image:os1.jpg|320px|thumb|right||'''Figure 2.'''''Expression analyses of OsNAC10(from reference &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> <br /> * The expression of '''''OsNAC10''''' is induced by drought, high salinity, and ABA but not by low temperature&lt;ref name=&quot;ref1&quot; /&gt;.(finger 2 B) <br /> <br /> * 34 root-specific and 40 leaf-specific target genes were up-regulated when '''''OsNAC10''''' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [''P450'', ''Zn-finger'', ''HAK5'', ''2OG-Fe(Ⅱ)'',''NCED'', ''NAC'', and ''KUP3''] were increased in transgenic roots. Expression of two leaf-specific target genes, ''LRR'' and ''Peroxidase'', was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, ''F-box'' and ''Muts4'', was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Evolution===<br /> According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, '''OsNAC10''' is in the subgroup Ⅰ(finger 3)&lt;ref name=&quot;ref1&quot; /&gt;.<br /> ===Knowledge Extension===<br /> [[File:finger 3.jpg|right|thumb|320px|'''Figure 4.'''''NAC's structure and regulation pathway (from reference &lt;ref name=&quot;ref4&quot; /&gt;).'']]<br /> <br /> *Name of NAC. It derives from the three genes first described as containing the domain, no apical meristem (''NAM'') gene of ''Petunia'' &lt;ref name=&quot;ref2&quot; /&gt; and the ''ATAF1'', ''ATAF2'' and ''CUC'' (cup-shaped cotyledon) genes of Arabidopsis &lt;ref name=&quot;ref3&quot; /&gt;. <br /> <br /> *Structure of NAC. NAC proteins share a well conserved N-terminal NAC domain (∼150 amino acids; aa) and a diversified C-terminal transcription regulatory (TR) region.(finger 4a)&lt;ref name=&quot;ref4&quot; /&gt;The DB ability of NAC TFs is confined to the NAC domain which can be divided into five subdomains.(A–E;Figure 3a (i))The highly conserved positively charged subdomains C and D bind to DNA, whereas subdomain A may be involved in the formation of a functional dimer, and the divergent subdomains B and E may be responsible for the functional diversity of NAC genes.&lt;ref name=&quot;ref5&quot; /&gt;&lt;ref name=&quot;ref6&quot; /&gt;&lt;ref name=&quot;ref7&quot; /&gt;&lt;ref name=&quot;ref8&quot; /&gt;The TRR, generally lying at the highly diverged C-terminal [Figure 3a (i)], can either activate or repress transcription.&lt;ref name=&quot;ref4&quot; /&gt;<br /> <br /> *Regulation of NAC TFs. Expression of stress-responsive NACs may be tightly regulated by several stress-responsive cis-acting elements contained in the promoter region ( Figure 4b).&lt;ref name=&quot;ref4&quot; /&gt;These include the ABREs (ABA-responsive elements), DREs, LTREs (Low-temperature responsive elements), MYB (Myeloblastosis) and MYC (Myelocytomatosis) binding sites, W-Box, jasmonic acid responsive element and salicylic acid responsive element<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea. <br /> <br /> * National Academy of Agricultural Science, Suwon 441–707, Korea.<br /> <br /> * School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.<br /> <br /> * CropDesign NV, B–9052 Ghent, Belgium<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;<br /> Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). &quot;Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions.&quot; Plant Physiol 153(1): 185-197.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;<br /> Souer E, van Houwelingen A, Kloos D,et al. (1996).&quot;The no apical meristem gene of Petunia is required for pattern formation in embryos and flowers and is expressed at meristem and primordia boundaries.&quot;Cell 85(2):159–170&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;<br /> Aida M, Ishida T, Fukaki H,et al. (1997).&quot;Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.&quot; Plant Cell 9(6):841–857&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;<br /> Puranik, S.,Sahu, PP. Srivastava,PS.,et al. (2012). &quot;NAC proteins: regulation and role in stress tolerance.&quot; Trends Plant Sci 17(6): 369-381.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;<br /> Ernst HA, Olsen AN, Larsen S,et al.(2004).&quot;Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.&quot;EMBO Rep.5(3):297–303&lt;/ref&gt;<br /> &lt;ref name=&quot;ref6&quot;&gt;<br /> Jensen MK, Kjaersgaard T, Nielsen MM, et al.(2010).&quot;The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.&quot; Biochem J.426(2):183-96&lt;/ref&gt;<br /> &lt;ref name=&quot;ref7&quot;&gt;<br /> Chen Q, Wang Q, Xiong L, et al.(2011)&quot;A structural view of the conserved domain of rice stress-responsive NAC1.&quot; Protein Cell,2(1):55–63&lt;/ref&gt;<br /> &lt;ref name=&quot;ref8&quot;&gt;<br /> Ooka H, Satoh K, Doi K,et al.(2003).&quot;Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.&quot;DNA Res., 10（6):239–247&lt;/ref&gt;<br /> &lt;references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 11]]<br /> [[Category:Chromosome 11]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0126900&diff=277977 2017-05-08T13:15:42Z

<p>Xysj2028: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> The rice ''Os11g0126900'' was reported as ''NAC'' (an acronym for ''NAM'' [No Apical Meristem], ''ATAF1-2'', and ''CUC2'' [Cup-Shaped Cotyledon]) domain gene, ''OsNAC10'',in 2010 by Korean researchers.<br /> ==Annotated Information==<br /> ===Function===<br /> [[Image:finger.jpg|320px|thumb|right||'''Figure 1.'''''Difference in root growth of RCc3:OsNAC10 and GOS2:OsNAC10 plants. &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> '''''OsNAC10''''' plays important role in enhancing stress tolerance when overexpressed in rice.<br /> In Jeong, J. S's et al. research, they constructed two types of transgenic plants,'''''RCc3:OsNAC10''', '''GOS2:OsNAC10'''''.A phenotype evaluation of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'' and NT control plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the ''GOS2:OsNAC10'' plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the ''GOS2:OsNAC10'' plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, ''RCc3:OsNAC10'' plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, ''RCc3:OsNAC10'' plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, ''GOS2:OsNAC10'' plants remain similar total grain weight with NT controls under drought condition. Root volume, length, dry weight, and diameter of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'', and NT plants were measured after growth to the stage of reproduction. Root diameter of the RCc3:OsNAC10 plants was thicker than that of the GOS2:OsNAC10 and NT plants. The increase in root diameter of the ''RCc3:OsNAC10'' plants appears to be caused by an increase in cell number rather than cell size, as evidenced by the similar size of epidermal and exodermal cells between NT and ''RCc3:OsNAC10'' roots.(finger 1)&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * '''''OsNAC10''''' is expressed predominantly in roots and panicles&lt;ref name=&quot;ref1&quot; /&gt; (finger 2 A).[[Image:os1.jpg|320px|thumb|right||'''Figure 2.'''''Expression analyses of OsNAC10(from reference &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> <br /> * The expression of '''''OsNAC10''''' is induced by drought, high salinity, and ABA but not by low temperature&lt;ref name=&quot;ref1&quot; /&gt;.(finger 2 B) <br /> <br /> * 34 root-specific and 40 leaf-specific target genes were up-regulated when '''''OsNAC10''''' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [''P450'', ''Zn-finger'', ''HAK5'', ''2OG-Fe(Ⅱ)'',''NCED'', ''NAC'', and ''KUP3''] were increased in transgenic roots. Expression of two leaf-specific target genes, ''LRR'' and ''Peroxidase'', was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, ''F-box'' and ''Muts4'', was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Evolution===<br /> According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, '''OsNAC10''' is in the subgroup Ⅰ(finger 3)&lt;ref name=&quot;ref1&quot; /&gt;.<br /> ===Knowledge Extension===<br /> [[File:finger 3.jpg|right|thumb|320px|'''Figure 4.'''''NAC's structure and regulation pathway (from reference &lt;ref name=&quot;ref4&quot; /&gt;).'']]<br /> <br /> *Name of NAC. It derives from the three genes first described as containing the domain, no apical meristem (''NAM'') gene of ''Petunia'' &lt;ref name=&quot;ref2&quot; /&gt; and the ''ATAF1'', ''ATAF2'' and ''CUC'' (cup-shaped cotyledon) genes of Arabidopsis &lt;ref name=&quot;ref3&quot; /&gt;. <br /> <br /> *Structure of NAC. NAC proteins share a well conserved N-terminal NAC domain (∼150 amino acids; aa) and a diversified C-terminal transcription regulatory (TR) region.(finger 4a)&lt;ref name=&quot;ref4&quot; /&gt;The DB ability of NAC TFs is confined to the NAC domain which can be divided into five subdomains.(A–E;Figure 3a (i))The highly conserved positively charged subdomains C and D bind to DNA, whereas subdomain A may be involved in the formation of a functional dimer, and the divergent subdomains B and E may be responsible for the functional diversity of NAC genes.&lt;ref name=&quot;ref5&quot; /&gt;&lt;ref name=&quot;ref6&quot; /&gt;&lt;ref name=&quot;ref7&quot; /&gt;&lt;ref name=&quot;ref8&quot; /&gt;The TRR, generally lying at the highly diverged C-terminal [Figure 3a (i)], can either activate or repress transcription.&lt;ref name=&quot;ref4&quot; /&gt;<br /> <br /> *Regulation of NAC TFs. Expression of stress-responsive NACs may be tightly regulated by several stress-responsive cis-acting elements contained in the promoter region ( Figure 4b).&lt;ref name=&quot;ref4&quot; /&gt;These include the ABREs (ABA-responsive elements), DREs, LTREs (Low-temperature responsive elements), MYB (Myeloblastosis) and MYC (Myelocytomatosis) binding sites, W-Box, jasmonic acid responsive element and salicylic acid responsive element<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea. <br /> <br /> * National Academy of Agricultural Science, Suwon 441–707, Korea.<br /> <br /> * School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.<br /> <br /> * CropDesign NV, B–9052 Ghent, Belgium<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;<br /> Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). &quot;Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions.&quot; Plant Physiol 153(1): 185-197.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;<br /> Souer E, van Houwelingen A, Kloos D,et al. (1996).&quot;The no apical meristem gene of Petunia is required for pattern formation in embryos and flowers and is expressed at meristem and primordia boundaries.&quot;Cell 85(2):159–170&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;<br /> Aida M, Ishida T, Fukaki H,et al. (1997).&quot;Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.&quot; Plant Cell 9(6):841–857&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;<br /> Puranik, S.,Sahu, PP. Srivastava,PS.,et al. (2012). &quot;NAC proteins: regulation and role in stress tolerance.&quot; Trends Plant Sci 17(6): 369-381.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;<br /> Ernst HA, Olsen AN, Larsen S,et al.(2004).&quot;Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.&quot;EMBO Rep.5(3):297–303&lt;/ref&gt;<br /> &lt;ref name=&quot;ref6&quot;&gt;<br /> Jensen MK, Kjaersgaard T, Nielsen MM, et al.(2010).&quot;The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.&quot; Biochem J.426(2):183-96&lt;/ref&gt;<br /> &lt;ref name=&quot;ref7&quot;&gt;<br /> Chen Q, Wang Q, Xiong L, et al.(2011)&quot;A structural view of the conserved domain of rice stress-responsive NAC1.&quot; Protein Cell,2(1):55–63&lt;/ref&gt;<br /> &lt;ref name=&quot;ref8&quot;&gt;<br /> Ooka H, Satoh K, Doi K,et al.(2003).&quot;Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.&quot;DNA Res., 10（6):239–247&lt;/ref&gt;<br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 11]]<br /> [[Category:Chromosome 11]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os11g0126900&diff=277976 2017-05-08T13:13:20Z

<p>Xysj2028: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> The rice ''Os11g0126900'' was reported as ''NAC'' (an acronym for ''NAM'' [No Apical Meristem], ''ATAF1-2'', and ''CUC2'' [Cup-Shaped Cotyledon]) domain gene, ''OsNAC10'',in 2010 by Korean researchers.<br /> ==Annotated Information==<br /> ===Function===<br /> [[Image:finger.jpg|320px|thumb|right||'''Figure 1.'''''Difference in root growth of RCc3:OsNAC10 and GOS2:OsNAC10 plants. &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> '''''OsNAC10''''' plays important role in enhancing stress tolerance when overexpressed in rice.<br /> In Jeong, J. S's et al. research, they constructed two types of transgenic plants,'''''RCc3:OsNAC10''', '''GOS2:OsNAC10'''''.A phenotype evaluation of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'' and NT control plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the ''GOS2:OsNAC10'' plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the ''GOS2:OsNAC10'' plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, ''RCc3:OsNAC10'' plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, ''RCc3:OsNAC10'' plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, ''GOS2:OsNAC10'' plants remain similar total grain weight with NT controls under drought condition. Root volume, length, dry weight, and diameter of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'', and NT plants were measured after growth to the stage of reproduction. Root diameter of the RCc3:OsNAC10 plants was thicker than that of the GOS2:OsNAC10 and NT plants. The increase in root diameter of the ''RCc3:OsNAC10'' plants appears to be caused by an increase in cell number rather than cell size, as evidenced by the similar size of epidermal and exodermal cells between NT and ''RCc3:OsNAC10'' roots.(finger 1)&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * '''''OsNAC10''''' is expressed predominantly in roots and panicles&lt;ref name=&quot;ref1&quot; /&gt; (finger 2 A).[[Image:os1.jpg|320px|thumb|right||'''Figure 2.'''''Expression analyses of OsNAC10(from reference &lt;ref name=&quot;ref1&quot;/&gt;).'']]<br /> <br /> * The expression of '''''OsNAC10''''' is induced by drought, high salinity, and ABA but not by low temperature&lt;ref name=&quot;ref1&quot; /&gt;.(finger 2 B) <br /> <br /> * 34 root-specific and 40 leaf-specific target genes were up-regulated when '''''OsNAC10''''' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [''P450'', ''Zn-finger'', ''HAK5'', ''2OG-Fe(Ⅱ)'',''NCED'', ''NAC'', and ''KUP3''] were increased in transgenic roots. Expression of two leaf-specific target genes, ''LRR'' and ''Peroxidase'', was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, ''F-box'' and ''Muts4'', was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ===Evolution===<br /> According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, '''OsNAC10''' is in the subgroup Ⅰ(finger 3)&lt;ref name=&quot;ref1&quot; /&gt;.<br /> ===Knowledge Extension===<br /> [[File:finger 3.jpg|right|thumb|320px|'''Figure 4.'''''NAC's structure and regulation pathway (from reference &lt;ref name=&quot;ref4&quot; /&gt;).'']]<br /> <br /> *Name of NAC. It derives from the three genes first described as containing the domain, no apical meristem (''NAM'') gene of ''Petunia'' &lt;ref name=&quot;ref2&quot; /&gt; and the ''ATAF1'', ''ATAF2'' and ''CUC'' (cup-shaped cotyledon) genes of Arabidopsis &lt;ref name=&quot;ref3&quot; /&gt;. <br /> <br /> *Structure of NAC. NAC proteins share a well conserved N-terminal NAC domain (∼150 amino acids; aa) and a diversified C-terminal transcription regulatory (TR) region.(finger 4a)&lt;ref name=&quot;ref4&quot; /&gt;The DB ability of NAC TFs is confined to the NAC domain which can be divided into five subdomains.(A–E;Figure 3a (i))The highly conserved positively charged subdomains C and D bind to DNA, whereas subdomain A may be involved in the formation of a functional dimer, and the divergent subdomains B and E may be responsible for the functional diversity of NAC genes.&lt;ref name=&quot;ref5&quot; /&gt;&lt;ref name=&quot;ref6&quot; /&gt;&lt;ref name=&quot;ref7&quot; /&gt;&lt;ref name=&quot;ref8&quot; /&gt;The TRR, generally lying at the highly diverged C-terminal [Figure 3a (i)], can either activate or repress transcription.&lt;ref name=&quot;ref4&quot; /&gt;<br /> <br /> *Regulation of NAC TFs. Expression of stress-responsive NACs may be tightly regulated by several stress-responsive cis-acting elements contained in the promoter region ( Figure 4b).&lt;ref name=&quot;ref4&quot; /&gt;These include the ABREs (ABA-responsive elements), DREs, LTREs (Low-temperature responsive elements), MYB (Myeloblastosis) and MYC (Myelocytomatosis) binding sites, W-Box, jasmonic acid responsive element and salicylic acid responsive element<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea. <br /> <br /> * National Academy of Agricultural Science, Suwon 441–707, Korea.<br /> <br /> * School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.<br /> <br /> * CropDesign NV, B–9052 Ghent, Belgium<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;<br /> Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). &quot;Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions.&quot; Plant Physiol 153(1): 185-197.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;<br /> Souer E, van Houwelingen A, Kloos D,et al. (1996).&quot;The no apical meristem gene of Petunia is required for pattern formation in embryos and flowers and is expressed at meristem and primordia boundaries.&quot;Cell 85(2):159–170&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;<br /> Aida M, Ishida T, Fukaki H,et al. (1997).&quot;Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant.&quot; Plant Cell 9(6):841–857&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;<br /> Puranik, S.,Sahu, PP. Srivastava,PS.,et al. (2012). &quot;NAC proteins: regulation and role in stress tolerance.&quot; Trends Plant Sci 17(6): 369-381.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;<br /> Ernst HA, Olsen AN, Larsen S,et al.(2004).&quot;Structure of the conserved domain of ANAC, a member of the NAC family of transcription factors.&quot;EMBO Rep.5(3):297–303&lt;/ref&gt;<br /> &lt;ref name=&quot;ref6&quot;&gt;<br /> Jensen MK, Kjaersgaard T, Nielsen MM, et al.(2010).&quot;The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling.&quot; Biochem J.426(2):183-96&lt;/ref&gt;<br /> &lt;ref name=&quot;ref7&quot;&gt;<br /> Chen Q, Wang Q, Xiong L, et al.(2011)&quot;A structural view of the conserved domain of rice stress-responsive NAC1.&quot; Protein Cell,2(1):55–63&lt;/ref&gt;<br /> &lt;ref name=&quot;ref8&quot;&gt;<br /> Ooka H, Satoh K, Doi K,et al.(2003).&quot;Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.&quot;DNA Res., 10（6):239–247&lt;/ref&gt;<br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os11g0126900|<br /> Description = Similar to NAC domain transcription factor|<br /> Version = NM_001072159.1 GI:115483930 GeneID:4349648|<br /> Length = 2046 bp|<br /> Definition = Oryza sativa Japonica Group Os11g0126900, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 11|Chromosome 11]]|<br /> AP = Chromosome 11:1215803..1217848|<br /> CDS = 1216006..1216177,1216305..1216612,1216879..1216914|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008404:1215803..1217848<br /> source=RiceChromosome11<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008404:1215803..1217848<br /> source=RiceChromosome11<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgaggaatccacaagaagagcaacgacttcaattcctctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANSTTTTKQRRASSMTMR NPQEEQRLQFL&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;204..375#503..810#1077..1112#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacctaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttaaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatatatactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaactttgggctttgaaaatggatatgggatgttgcaggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgagggtgagattaattacttaactaatttagttttctcttcgtcgtacgtcttgtttgaaagctacttgttgtttggcataaagaaggagcaacgtgcatgttgctcttagttaactcagtacaaagtcaaatgagttgatgttgattgagcttgttttattcttggtatatattttattttttagaaaagggttaaagtttgcacgcttctaattattgtttactgcatttgtgattgtccatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgaggaatcaaccgtcgaacagcttgaagacatccatgacaacaactcctctgaacaacctccagctccagctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaccatcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcctcctgctcctcccagccccctaatatacacaacacctcatccaaattaccaaacactaaactataacattaacagcaacagcagcatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctgaggaggaagagaatgatggcgtgtagtgcaacttcctttgatgatggcagcagcagcaatgactttgtgcatgccgttgtcaagaaaccgcagctgctgccaagtgattcgaggggtagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggctttcagtttcagaacggcaatctgctgagccatccatttcctctgaacaatcatctgcagatgcagtagtaggcgtctagatcccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttgtgatttattttgaggagttgcatgggcagatagacaaacagacggaattcttgatgtaaccgatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatg&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001072159.1 RefSeq:Os11g0126900]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 11]]<br /> [[Category:Chromosome 11]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0700700&diff=277975 2017-05-08T13:12:06Z

<p>Xysj2028: </p> <hr /> <div>OsHMA2 is a transporter of Zn and Cd in rice and is involved in the root-to-shoot translocation of Zn and Cd. <br /> <br /> ==Annotated Information==<br /> ===Function===<br /> [[File:1.png|right|thumb|150px|'' Phylogenic tree of HMAs from rice and Arabidopsis.(from reference &lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> [[File:subcellular localization of OsHMA2.png |right|thumb|150px|''subcellular localization of OsHMA2 (from reference &lt;ref name=&quot;ref3&quot; /&gt;).'']]<br /> The P1B-type heavy metal ATPases(HMA) are transporters which play an important role in the translocation or detoxification of Zn or Cd in plants. These transporters are divided into two subgroups based on their metal-substrate specificity: a copper (Cu)/silver (Ag) group and a zinc (Zn)/cobalt (Co)/cadmium (Cd)/lead (Pb) group. Rice(''Oryza sativa'' L.) has nine HAM genes. OsHMA2 belongs to the Zn/Co/Cd/Pb subgroup. ''OsHMA2'' is a gene which is localized in the plasma membrane and trasport Zn and Cd out of the cell. &lt;ref name=&quot;ref1&quot; /&gt; ''OsHMA2'' plays an important role in the root-to-shoot translocation of Zn and Cd, and participate in Zn and Cd transport to developing seeds in rice. In rice, ''OsHMA2'' is the only gene which is responsible for the translocation of Zn, unlike Arabidopsis, in which two genes have redundant fuctions. OsHMA2 is also the transporter of Cd in rice and to date, the OsHMA2 is the only one gene which translocate both Zn and Cd in rice. &lt;ref name=&quot;ref2&quot; /&gt; OsHMA2 also plays a role in Zn transport during flowering and seed maturing. &lt;ref name=&quot;ref1&quot; /&gt; OsHMA2 in the nodes plays an important role in preferential distribution of Zn as well as Cd through the phloem to the developing tissues. &lt;ref name=&quot;ref4&quot;/&gt;<br /> <br /> ===Expression===<br /> [[File:The expression of OsHMA2.png|right|thumb|150px|''The expression of OsHMA2(from reference &lt;ref name=&quot;ref3&quot; /&gt;).'']]<br /> <br /> Total RNA was extracted from rice using the RNeasy Plant Mini Kit. The RNA was reverse transcribed using an oligo dT primer and the ReverTra Ace reverse transcriptase. Amplification reactions were carried out with the HMA2-F1 primer (5′-GCAGATCAAGTCACCCCATGG-3′) and the HMA2-R1 primer (5′-GCCATCACCAAC CATCAGCGT-3′). As an internal standard, the a-tubulin gene was used as described previously. Transcript abundance was normalized by a-tubulin expression level, and the results represent average number of copies of OsHMA2 transcripts in 1 mg of total RNA in three reactions.&lt;ref name=&quot;ref3&quot; /&gt;<br /> <br /> The expression of OsHMA2 was observed mainly in the roots. Using LM, OsHMA2 transcripts were detected mainly in vascular bundles. Expression of OsHMA2 in the roots was unchanged in the presence of Cd, whereas expression in the shoots increased in the presence of 1 mm Cd. Under Zn deficiency, the expression of OsHMA2 decreased in the roots, whereas it remained unchanged in shoots. In contrast, the expression of OsHMA2 increased in roots under Fe deficiency, whereas it decreased in shoots. Expression of OsHMA2 was unchanged in both roots and shoots under Mn deficiency.&lt;ref name=&quot;ref3&quot; /&gt;<br /> <br /> ===Mutation===<br /> [[File:The concentration of Cd and Zn in shoots,roots and the whole plant.png|right|thumb|150px|''The concentration of Cd and Zn in shoots,roots and the whole plant(from reference &lt;ref name=&quot;ref2&quot; /&gt;).'']]<br /> ''OsHMA2'' is composed of nine exons and eight introns. Secondary structure prediction of membrane proteins, an online bioinformatics tool, predicted that the OsHMA2 protein in the wild type has six transmembrane segments and a histidine-rich C-terminal domain. To investigate the function of ''OsHMA2'', three the retrotransposon ''Tos17'' insertion mutants were obtained. The ''Tos17'' insertion into intron 5 was designated ''oshma2-1''.In other two lines the insertions were in exon 9 at different positions. Only two transmembrane segments occur in oshma2-1 according to SOSUI predition. In ''oshma2-2'', most of the C-terminal region after the last transmembrane segment is absent, and in ''oshma2-3'', only part of the histidine-rich C-terminal region is absent. &lt;ref name=&quot;ref2&quot;/&gt; <br /> <br /> When grow wild type and three ''oshma2'' mutants with 4.5nM Cd, oshma2 mutants had a significantly lower translocation ratio of Cd and Zn than the wild type. The concentrations of Cd and Zn in shoots of the ''oshma2'' mutants were very low. And the concentration of Cd in the roots of ''oshma2'' mutants were not significantly different from those of wild type, while the concentration of Zn in roots of ''oshma2'' mutants higher than the wild type. No significant difference were observed between oshma2 mutants and wild type in the concentration of accumulated Cd and Zn in whole plants. &lt;ref name=&quot;ref2&quot;/&gt;<br /> <br /> When OsHMA2-suppressed rice was grown in a Cd-contaminated paddy field, both the Zn and Cd concentrations in the grains decreased.31 OsHMA2-overexpressing rice<br /> also contained less Zn and Cd in the grains compared with the wild type. &lt;ref name=&quot;ref1&quot;/&gt;<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> <br /> *Graduate School of Agricultural and Life Sciences; The University of Tokyo; Tokyo, Japan<br /> *Graduate School of Science; Tohoku University; Sendai, Miyagi, Japan<br /> *Institute for Bioresources and Biotechnology; Ishikawa Prefectural University; Ishikawa, Japan<br /> *Department of Biological Production, Faculty of Bioresource Sciences, Akita Prefectural University, Kaidoubata-Nishi<br /> *Akita Agricultural Experiment Station, Genpachizawa 34-1, Aikawa, Yuwa, Akita, 010-1231 Japan<br /> *Research Institute for Bioresources &amp; Biotechnology, Ishikawa Prefectural University, 1-308 Suematsu, Nonoichi-shi, Ishikawa, 921-8836, Japan<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt; Ryuichi Takahashi, Khurram Bashir, Yasuhiro Ishimaru, Naoko K. Nishizawa and Hiromi Nakanishi.(2012) The role of heavy-metal ATPases, HMAs, in zinc and cadmium transport in rice. Plant Signaling &amp; Behavior 7:12, 1605–1607. &lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt; Namiko Satoh-Nagasawa, Mikako Mori, Nobushige Nakazawa, Tomohiko Kawamot3, Yasuo Nagato, Kenji Sakurai, Hidekazu Takahashi, Akio Watanabe and Hiromori Akagi.(2012) Mutations in Rice (Oryza sativa) Heavy Metal ATPase2 (OsHMA2) Restrict the Translocation of Zinc and Cadmium. Plant Cell Physiol 53(1): 213–224. &lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt; Ryuichi Takahashi, Yasuhiro Ishimaru, Hugo Shimo, Yuko Ogo, Takeshi Ssnoura, Naoko K. Nishizawa and Hiromi Nakaishi.(2012) The OsHMA2 transporter is involved in root-to-shoot translocation of Zn and Cd in rice. Plant, Cell and Environment 35:1948–1957. &lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt; Naoki Yamaji, Jixing Xia, Namiki Mitani-Ueno, Kengo Yokosho, and Jian Feng Ma.(2013) Preferential Delivery of Zinc to Developing Tissues in Rice Is Mediated by P-Type Heavy Metal ATPase OsHMA2. Plant Physiology 162:927–939. &lt;/ref&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0157500&diff=277974 2017-05-08T13:10:01Z

<p>Xysj2028: /* References */</p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> FLOWERING LOCUS T 1 (RFT1) is a florigen gene in rice (Figure 1), because an RFT1:GFP fusion protein localized in the shoot apical meristem (SAM) under LD conditions (Figure 2). RFT1 is the closest homolog to Heading date 3a (Hd3a) and is a major floral activator under LD conditions..RFT1 and Hd3a regulate rice flowering under LD and SD conditions.OsMADS50, an LD floral activator, acts upstream of Ehd1 and RFT1.OsMADS14 and OsMADS15 act downstream of RFT1 in the SAM under LD conditions.Both positive (OsMADS50 and Ehd1) and negative (Hd1, phyB and Ghd7) regulators of RFT1 form a gene network that regulates LD flowering in rice The OsMADS50-Ehd1-RFT1 pathway is involved in floral activation under LD conditions(Figure 2 )&lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> [[File:Fig.1. RFT1 encodes LD florigen.jpg|right|thumb|200px|''Fig.1'''' ''. RFT1 encodes LD florigen. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> [[File:Fig. 2. A model for the photoperiodic control of flowering in rice.jpg|center|thumb|450px|'''Fig.2.''' ''. A model for the photoperiodic control of flowering in rice. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> [http://www.ricedata.cn/reference/list/2537.htm]<br /> RICE FLOWERING LOCUS T 1 (RFT1/FT-L3) is the closest homologue of Heading date 3a (Hd3a), with 91% identity in the deduced amino acid sequence, which is thought to encode a mobile flowering signal and promote floral transition under short-day (SD) conditions. RFT1 also lies adjacent to Hd3a, separated by only 11.5 kb on chromosome 6. The Hd3a and RFT1 are essential for flowering in rice. RFT1 expression was very low in wild-type plants. Hd3a and RFT1 act as floral activators under SD conditions, and that RFT1 expression is partly regulated by chromatin modification. These two genes are essential for flowering in rice. Moreover, RFT1 functions as a floral activator in Hd3a RNAi plants.<br /> <br /> ===Mutation===<br /> Polymorphisms in the promoter region that lead to reduced expression levels of RFT1. An amino acid substitution (E105K) that leads to a functional defect in Nona Bokra RFT1. The E105K mutation is found only in indica, and a strong association was founded between the RFT1 haplotype and extremely late flowering in a functional Hd1 background.. Furthermore, SNPs in the regulatory region of RFT1 and the E105K substitution in 1,397 accessions show strong linkage disequilibrium with a flowering time–associated SNP. &lt;ref name=&quot;ref2&quot; /&gt; .<br /> [http://www.ricedata.cn/reference/list/45205.htm]<br /> ===Expression===<br /> Developmental expression of RFT1 in the SAM under LD conditions through stages 1-5 (Figure 3 ) &lt;ref name=&quot;ref1&quot; /&gt;.<br /> [[File:Fig.3.Expression of RFT1 in the SAM.jpg|center|thumb|550px|'''''' ''. Expression of RFT1 in the SAM. (from reference&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> Transcript levels of RFT1 were very low in wild-type plants throughout development. The similarity of Hd3a and RFT1 expression patterns under SD and LD conditions, and in vascular tissues, suggests that RFT1 could function redundantly with Hd3a in promoting floral transition under SD conditions[3].<br /> <br /> ===Evolution===<br /> The ratios of nonsynonymous to synonymous substitutions suggest that the E105K mutation resulting in the defect in RFT1 occurred relatively recently. These findings indicate that natural mutations in RFT1 provide flowering time divergence under long-day conditions &lt;ref name=&quot;ref2&quot; /&gt; .<br /> <br /> ==Labs working on this gene==<br /> *Genetic Resources Center, National Institute of Agrobiological Sciences, Kannondai Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Institute of Crop Sciences, National Agriculture and Food Research Organization, Tsukuba, Ibaraki, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *Iwate Agricultural Research Center, Narita, Kitakami, Iwate, Japan&lt;ref name=&quot;ref2&quot; /&gt; .<br /> *National Institute of Genetics, 111-1 Yata, Mishima 411-8540,Japan &lt;ref name=&quot;ref1&quot; /&gt;. <br /> *Faculty of Agriculture, Iwate University, Morioka 020-8550, Japan &lt;ref name=&quot;ref1&quot; /&gt;.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Reina Komiya*, Shuji Yokoi and Ko Shimamoto. A gene network for long-day flowering activates RFT1 encoding a mobile flowering signal in rice<br /> .Development 136, 3443-3450 (2009) doi:10.1242/dev.040170.&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Ogiso-Tanaka E, Matsubara K, Yamamoto S-i, Nonoue Y, Wu J, et al. (2013) Natural Variation of the RICE FLOWERING LOCUS T 1 Contributes to Flowering Time Divergence in Rice. PLoS ONE 8(10): e75959. doi:10.1371/journal.pone.0075959&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0537700&diff=277973 2017-05-08T13:09:34Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os09g0537700''''' was reported as '''''OsRNS4''''' in 2014 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os02g0187800''''' '''''&lt;=&gt;''''' '''''OsRNS4, OsRRP, RNaseDIS'''''<br /> <br /> ===Function===<br /> * S-like ribonucleases (S-like RNases) are homologous to S-ribonucleases (S-RNases), but are not involved in self-incompatibility. <br /> * In dicotyledonous plants, S-like RNases play an important role in phosphate recycling during senescence and are induced by inorganic phosphate-starvation and in response to defense and mechanical wounding.<br /> <br /> ===Phenotypic analysis===<br /> * The seedlings overexpressing OsRNS4 had longer coleoptiles and first leaves than wild-type seedlings under red light (R) and far-red light (FR), suggesting negative regulation of OsRNS4 in photomor-phogenesis in rice seedlings.<br /> * Moreover, ABA-induced growth inhibition of rice seedlings was significantly increased in the OsRNS4-overexpression (OsRNS4-OX) lines compared with that in WT, suggesting that OsRNS4 probably acts as a positive regulator in ABA responses in rice seedlings. <br /> * In addition, our results demonstrate that OsRNS4-OX lines have enhanced tolerance to high salinity compared to WT.<br /> <br /> ===Expression===<br /> * The OsRNS4 gene was expressed at relatively high levels in leaves although its transcripts were detected in various organs. OsRNS4 expression was regulated by salt, PEG and ABA.<br /> <br /> ===Evolution===<br /> * The process of genome evolution by duplication in each species appears to have been quite different. Functional classifications of the proteins based on Gene Ontology (GO) annotations are shown in Figure 2; the numbers of known functional domains were not significantly different between the two species.<br /> <br /> ==Labs working on this gene==<br /> * Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China<br /> * Shandong Provincial Key Laboratory of Crop Genetic Improvement, Ecology and Physiology, 250100 Jinan, China<br /> <br /> ==References==<br /> * (2005). The map-based sequence of the rice genome. Nature 436, 793-800.<br /> * Itoh, T., Tanaka, T., Barrero, R.A., Yamasaki, C., Fujii, Y., Hilton, P.B., Antonio, B.A., Aono, H., Apweiler, R., Bruskiewich, R., et al. (2007). Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Genome research 17, 175-183.<br /> * Ohyanagi, H., Tanaka, T., Sakai, H., Shigemoto, Y., Yamaguchi, K., Habara, T., Fujii, Y., Antonio, B.A., Nagamura, Y., Imanishi, T., et al. (2006). The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Nucleic acids research 34, D741-744.<br /> * Tanaka, T., Antonio, B.A., Kikuchi, S., Matsumoto, T., Nagamura, Y., Numa, H., Sakai, H., Wu, J., Itoh, T., Sasaki, T., et al. (2008). The Rice Annotation Project Database (RAP-DB): 2008 update. Nucleic acids research 36, D1028-1033.<br /> * Zheng, J., Wang, Y.Y., He, Y.A., Zhou, J.J., Li, Y.P., Liu, Q.Q., and Xie, X.Z. (2014). Overexpression of an S-like ribonuclease gene, OsRNS4, confers enhanced tolerance to high salinity and hyposensitivity to phytochrome-mediated light signals in rice. Plant Sci 214, 99-105.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 9]]<br /> [[Category:Chromosome 9]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0610500&diff=277972 2017-05-08T13:02:36Z

<p>Xysj2028: </p> <hr /> <div><br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.<br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os02g0610500''''' '''''&lt;=&gt;''''' '''''OsBBX5, OsCCT06, OsCOL4, OsCOL4/OsD, OsD'''''<br /> ===function===<br /> [[File:Figure1.jpg|right|thumb|275px|'''Figure 1.''' '' Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> <br /> OsCOL4, a member of the CONSTANS-like (COL) family in rice.OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants. By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Evolution===<br /> <br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor&lt;ref name=&quot;ref1&quot; /&gt;s. In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression&lt;ref name=&quot;ref2&quot; /&gt;. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end&lt;ref name=&quot;ref3&quot; /&gt; .In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes &lt;ref name=&quot;ref4&quot; /&gt;. Among them, Hd1 was identified first via QTL analyses &lt;ref name=&quot;ref5&quot; /&gt;. Two groups of rice COL proteins differ from those in Arabidopsis &lt;ref name=&quot;ref4&quot; /&gt;.<br /> <br /> ==Labs working on this gene==<br /> *Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea<br /> *Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea<br /> *Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea<br /> *Gyeongsang National University, Korea<br /> *the Plant Functional Genomics Laboratory at the POSTECH<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;（2010）OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 2]]<br /> [[Category:Chromosome 2]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0610500&diff=277971 2017-05-08T13:02:02Z

<p>Xysj2028: /* References */</p> <hr /> <div><br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.<br /> ==Annotated Information==<br /> <br /> ===function===<br /> [[File:Figure1.jpg|right|thumb|275px|'''Figure 1.''' '' Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> <br /> OsCOL4, a member of the CONSTANS-like (COL) family in rice.OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants. By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Evolution===<br /> <br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor&lt;ref name=&quot;ref1&quot; /&gt;s. In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression&lt;ref name=&quot;ref2&quot; /&gt;. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end&lt;ref name=&quot;ref3&quot; /&gt; .In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes &lt;ref name=&quot;ref4&quot; /&gt;. Among them, Hd1 was identified first via QTL analyses &lt;ref name=&quot;ref5&quot; /&gt;. Two groups of rice COL proteins differ from those in Arabidopsis &lt;ref name=&quot;ref4&quot; /&gt;.<br /> <br /> ==Labs working on this gene==<br /> *Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea<br /> *Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea<br /> *Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea<br /> *Gyeongsang National University, Korea<br /> *the Plant Functional Genomics Laboratory at the POSTECH<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;（2010）OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483&lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 2]]<br /> [[Category:Chromosome 2]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0610500&diff=277970 2017-05-08T13:01:44Z

<p>Xysj2028: </p> <hr /> <div><br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.<br /> ==Annotated Information==<br /> <br /> ===function===<br /> [[File:Figure1.jpg|right|thumb|275px|'''Figure 1.''' '' Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> <br /> OsCOL4, a member of the CONSTANS-like (COL) family in rice.OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants. By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Evolution===<br /> <br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor&lt;ref name=&quot;ref1&quot; /&gt;s. In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression&lt;ref name=&quot;ref2&quot; /&gt;. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end&lt;ref name=&quot;ref3&quot; /&gt; .In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes &lt;ref name=&quot;ref4&quot; /&gt;. Among them, Hd1 was identified first via QTL analyses &lt;ref name=&quot;ref5&quot; /&gt;. Two groups of rice COL proteins differ from those in Arabidopsis &lt;ref name=&quot;ref4&quot; /&gt;.<br /> <br /> ==Labs working on this gene==<br /> *Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea<br /> *Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea<br /> *Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea<br /> *Gyeongsang National University, Korea<br /> *the Plant Functional Genomics Laboratory at the POSTECH<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;（2010）OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483&lt;/ref&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 2]]<br /> [[Category:Chromosome 2]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0610500&diff=277969 2017-05-08T13:01:05Z

<p>Xysj2028: </p> <hr /> <div><br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor.<br /> ==Annotated Information==<br /> <br /> ===function===<br /> [[File:Figure1.jpg|right|thumb|275px|'''Figure 1.''' '' Phenotypes of oscol4-1, oscol4-2, and WT at heading stage .(from reference)&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> [[File:Figure2.jpg|right|thumb|275px|'''Figure 2.''' '' OsCOL4 has two exons (boxes) and one intron (line between boxes). Closed boxes indicate coding region, and open boxes show the 5¢ and 3¢ untranslated regions (UTR).(from reference)&lt;ref name=&quot;ref1&quot; /&gt;).'']]<br /> OsCOL4, a member of the CONSTANS-like (COL) family in rice.OsCOL4 is a constitutive repressorfunctioning upstream of Ehd1 and functions independently from previously reported flowering pathways. In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants,indicating OsCOL4 functions downstream of OsphyB.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> OsCOL4 null mutants flowered early under short or long days. In contrast, OsCOL4 activation-tagging mutants (OsCOL4-D) flowered late in either environment. Transcripts of Ehd1, Hd3a, and RFT1 were increased in the oscol4 mutants, but reduced in the OsCOL4-D mutants. By comparison, levels of Hd1, OsID1, OsMADS50, OsMADS51, and OsMADS56 transcripts were not significantly changed in oscol4 or OsCOL4-D.In osphyB mutants, OsCOL4 expression was decreased and osphyB oscol4 double mutants flowered at the same time as the osphyB single mutants&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Evolution===<br /> <br /> Plants recognize environmental factors to determine flowering time. CONSTANS (CO) plays a central role in the photoperiod flowering pathway of Arabidopsis, and CO protein stability is modulated by photoreceptor&lt;ref name=&quot;ref1&quot; /&gt;s. In the former, GIGANTEA (GI) activates CONSTANS (CO), which promotes Flowering Locus T (FT) expression&lt;ref name=&quot;ref2&quot; /&gt;. The CO gene is a member of a B-box transcription factor family which contains a CCT (CO, CO-like, and TOC1) domain at the C-terminal end&lt;ref name=&quot;ref3&quot; /&gt; .In rice, Hd1, an ortholog of CO, acts as a flowering promoter, and phytochromes repress Hd1 expression.The rice genome contains 16 OsCOL genes &lt;ref name=&quot;ref4&quot; /&gt;. Among them, Hd1 was identified first via QTL analyses &lt;ref name=&quot;ref5&quot; /&gt;. Two groups of rice COL proteins differ from those in Arabidopsis &lt;ref name=&quot;ref4&quot; /&gt;.<br /> <br /> ==Labs working on this gene==<br /> *Department of Life Science, Pohang University of Science and Technology (POSTECH), Pohang 790–784, Korea<br /> *Crop Biotech Institute, Kyung Hee University, Yongin 446–701, Korea<br /> *Department of Plant Systems Biotech, Kyung Hee University, Yongin 446–701, Korea<br /> *Gyeongsang National University, Korea<br /> *the Plant Functional Genomics Laboratory at the POSTECH<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Yang-Seok Lee; Dong-Hoon Jeong; Dong-Yeon Lee;（2010）OsCOL4 is a constitutive flowering repressor upstream of Ehd1 and downstream of OsphyB The Plant Journal, 63(1): 18-30&lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yanovsky, M.J. and Kay, S.A. (2002) Molecular basis of seasonal time measurement in Arabidopsis. Nature, 419, 308–312&lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Robson, F., Costa, M.M.R., Hepworth, S.R.. (2001) Functional importance of conserved domains in the flowering-time gene CONSTANS demonstrated by analysis of mutant alleles and transgenic plants. Plant J. 28, 619631&lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Griffiths, S., Dunford, R.P., Coupland, G. and Laurie, D.A. (2003) The evolution of CONSTANS-like gene families in barley, rice, and Arabidopsis. Plant Physiol. 131, 1855–1867&lt;/ref&gt;<br /> &lt;ref name=&quot;ref5&quot;&gt;Yano, M., Katayose, Y., Ashikari, M. et al. (2000) Hd1, a major photoperiod sensitivity quantitative trait locus in rice, is closely related to the Arabidopsis flowering time gene CONSTANS. Plant Cell, 12, 24732483&lt;/ref&gt;<br /> <br /> ==Structured Information==<br /> {{JaponicaGene|<br /> GeneName = Os02g0610500|<br /> Description = Similar to CONSTANS-like protein CO9 (Fragment)|<br /> Version = NM_001053934.1 GI:115447238 GeneID:4329950|<br /> Length = 1469 bp|<br /> Definition = Oryza sativa Japonica Group Os02g0610500, complete gene.|<br /> Source = Oryza sativa Japonica Group<br /> <br /> ORGANISM Oryza sativa Japonica Group<br /> Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;<br /> Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP<br /> clade; Ehrhartoideae; Oryzeae; Oryza.<br /> |<br /> Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|<br /> AP = Chromosome 2:24847664..24849132|<br /> CDS = 24847765..24848448,24848530..24848844|<br /> GCID = &lt;gbrowseImage1&gt;<br /> name=NC_008395:24847664..24849132<br /> source=RiceChromosome02<br /> preset=GeneLocation<br /> &lt;/gbrowseImage1&gt;|<br /> GSID = &lt;gbrowseImage2&gt;<br /> name=NC_008395:24847664..24849132<br /> source=RiceChromosome02<br /> preset=GeneLocation<br /> &lt;/gbrowseImage2&gt;|<br /> CDNA = &lt;cdnaseq&gt;atggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctga&lt;/cdnaseq&gt;|<br /> AA = &lt;aaseq&gt;MEAVEDKAMVGVGGAVAAGYSSSSWGLGTRACDSCGGEAARLYC RADGAFLCARCDARAHGAGSRHARVWLCEVCEHAPAAVTCRADAAALCAACDADIHSA NPLARRHERLPVAPFFGPLADAPQPFPFSQAAADAAAAREEDADDDRSNEAEAASWLL PEPDDNSHEDSAAAADAFFADTGAYLGVDLDFARSMDGIKAIGVPVAPPELDLTAGSL FYPEHSMAHSLSSSEVAIVPDALSAGSAAPPMVVVVASKGKEREARLMRYREKRKNRR FDKTIRYASRKAYAETRPRIKGRFAKRTADADDDDEAPCSPAFSALAASDGVVPSF&lt;/aaseq&gt;|<br /> DNA = &lt;dnaseqindica&gt;102..785#867..1181#gtgcccaacgcccaaaaaacacagccaaactccgcgagaaaccgagctgcgagcgagtgaaacgcaccacgcgccgagcggcaaagcgaagcgaagaagaaatggaggcggtggaggacaaggcgatggtgggagtgggaggagcggtggcggcggggtactcctcgtcgtcgtgggggttggggacgcgggcgtgcgactcgtgcggcggggaggcggcgcggctctactgccgcgcggacggggcgttcctgtgcgcccggtgcgacgcgcgggcgcacggcgccgggtcgcgccacgcgcgggtgtggctgtgcgaggtgtgcgagcacgcgcccgccgccgtcacgtgccgggcggacgccgcggcgctgtgcgccgcctgcgacgccgacatccactcggcgaacccgctcgcgcgcaggcacgagcgcctccccgtcgcgcccttcttcggcccgctcgccgacgcgccgcagcccttccccttctcccaggccgccgcggatgccgccgcggcgcgggaggaggatgcggatgatgaccggagcaacgaggccgaggcggcgtcgtggcttctccccgagcccgacgacaatagccacgaggatagcgccgcagccgccgacgcgttcttcgccgacaccggcgcgtacctcggcgtcgacctggacttcgcccggtccatggacggaatcaaggccatcggggtaccggtcgcgccgcccgagctggacctcaccgccggcagccttttctaccccgaacactccatggcccacagcgtaagcctcactaccacacagctagctctcgtcgatgctcatggcgcggcgttatgacatggtttcctacgcgttccgcagttgtcgtcgtcggaggtcgcgatcgtaccggacgcgctgtcggcgggctcggcggcgccgcccatggtggtggtggtggcgagcaaggggaaggagagggaggcgcggctgatgcggtacagggagaagcgcaagaaccggcggttcgacaagaccatccggtacgcgtcccgcaaggcgtacgccgagacgcggccgcgcatcaagggccggttcgccaagcgcaccgccgacgccgacgacgacgacgaggcgccatgctcgccggcgttctccgccctcgccgcgtcggacggcgtcgtgccgtcgttctgaggaaggacgtacgcacggtacggcgagtcggcgacgtgcgccgtcgtaattttggcgcgccccgtgcgcgcgtgcatgcgtgcgtgtgtgcgacgcatggccccgtgtgacatgaataatatgtacagtagtttttcatccatggacgtagtattctattgtactccttgtactcctactactcctcttctgcctaaccaaggcttgtacattaccatgggagtagctgtttttgcaaccgtgaccatggttcagtgcttcaagttcaagggcgttaatgttactgtc&lt;/dnaseqindica&gt;|<br /> Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001053934.1 RefSeq:Os02g0610500]|<br /> }}<br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 2]]<br /> [[Category:Chromosome 2]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0529600&diff=277968 2017-05-08T13:00:09Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os07g0529600''''' was reported as '''''OsDR8''''' in 2006 by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:1.png|right|thumb|227px|]]<br /> ===Gene Symbol===<br /> *'''''Os07g0529600''''' '''''&lt;=&gt;''''' '''''FOXRED1, OsDR8, OsXNP'''''<br /> <br /> ===Function===<br /> * Silencing of OsDR8 using an RNA interference approach resulted in phenotypic alteration of the plants. <br /> * The transgenic plants with repressed expression of OsDR8 showed reduced resistance or susceptibility to Xanthomonas oryzae pv. oryzae and Magnaporthe grisea causing bacterial blight and blast, which are two of the most devastating diseases in rice worldwide, respectively.<br /> <br /> ===Expression===<br /> * The impact of OsDR8 on disease resistance in rice may be through the regulation of expression of other defense-responsive genes and the site of OsDR8 function is on the upstream of the signal transduction pathway. In addition, the accumulation of thiamine may be essential for bacterial blight resistance and blast resistance.<br /> <br /> ===Evolution===<br /> * The putative product of OsDR8 was highly homologous to an enzyme involved in the biosynthesis of the thiazole precursor of thiamine.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research<br /> <br /> ==References==<br /> Dual function of rice OsDR8 gene in disease resistance and thiamine accumulation, Gongnan Wang, Xinhua Ding, Meng Yuan, Deyun Qiu, Xianghua Li, Caiguo Xu and Shiping Wang, Plant Molecular Biology (2006) 60:437-449.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 7]]<br /> [[Category:Chromosome 7]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0529600&diff=277967 2017-05-08T12:59:57Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os07g0529600''''' was reported as '''''OsDR8''''' in 2006 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:1.png|right|thumb|227px|]]<br /> ===Gene Symbol===<br /> *'''''Os07g0529600''''' '''''&lt;=&gt;''''' '''''FOXRED1, OsDR8, OsXNP'''''<br /> <br /> ===Function===<br /> * Silencing of OsDR8 using an RNA interference approach resulted in phenotypic alteration of the plants. <br /> * The transgenic plants with repressed expression of OsDR8 showed reduced resistance or susceptibility to Xanthomonas oryzae pv. oryzae and Magnaporthe grisea causing bacterial blight and blast, which are two of the most devastating diseases in rice worldwide, respectively.<br /> <br /> ===Expression===<br /> * The impact of OsDR8 on disease resistance in rice may be through the regulation of expression of other defense-responsive genes and the site of OsDR8 function is on the upstream of the signal transduction pathway. In addition, the accumulation of thiamine may be essential for bacterial blight resistance and blast resistance.<br /> <br /> ===Evolution===<br /> * The putative product of OsDR8 was highly homologous to an enzyme involved in the biosynthesis of the thiazole precursor of thiamine.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research<br /> <br /> ==References==<br /> Dual function of rice OsDR8 gene in disease resistance and thiamine accumulation, Gongnan Wang, Xinhua Ding, Meng Yuan, Deyun Qiu, Xianghua Li, Caiguo Xu and Shiping Wang, Plant Molecular Biology (2006) 60:437-449.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 7]]<br /> [[Category:Chromosome 7]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os07g0529600&diff=277966 2017-05-08T12:59:38Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os07g0529600''''' was reported as '''''OsDR8''''' in 2006 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:1.png|right|thumb|327px|]]<br /> ===Gene Symbol===<br /> *'''''Os07g0529600''''' '''''&lt;=&gt;''''' '''''FOXRED1, OsDR8, OsXNP'''''<br /> <br /> ===Function===<br /> * Silencing of OsDR8 using an RNA interference approach resulted in phenotypic alteration of the plants. <br /> * The transgenic plants with repressed expression of OsDR8 showed reduced resistance or susceptibility to Xanthomonas oryzae pv. oryzae and Magnaporthe grisea causing bacterial blight and blast, which are two of the most devastating diseases in rice worldwide, respectively.<br /> <br /> ===Expression===<br /> * The impact of OsDR8 on disease resistance in rice may be through the regulation of expression of other defense-responsive genes and the site of OsDR8 function is on the upstream of the signal transduction pathway. In addition, the accumulation of thiamine may be essential<br /> for bacterial blight resistance and blast resistance.<br /> <br /> ===Evolution===<br /> * The putative product of OsDR8 was highly homologous to an enzyme involved in the biosynthesis of the thiazole precursor of thiamine.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research<br /> <br /> ==References==<br /> Dual function of rice OsDR8 gene in disease resistance and thiamine accumulation, Gongnan Wang, Xinhua Ding, Meng Yuan, Deyun Qiu, Xianghua Li, Caiguo Xu and Shiping Wang, Plant Molecular Biology (2006) 60:437-449.<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 7]]<br /> [[Category:Chromosome 7]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0106700&diff=277965 2017-05-08T12:54:04Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os09g0106700''''' was reported as '''''PutAKT1''''' in 2009 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''PutAKT1'' is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii)in ''P. tenuiflora'' , even under saltstress condition.The notion that ''AKT1''-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of ''AKT1''-disrupted mutants.<br /> *''PutAKT1'' not only increases tissue K+ accumulation, but also decreases Na+&lt;ref name=&quot;ref1&quot;/&gt;.<br /> <br /> ===Expression===<br /> *The AKT1 is preferentially expressed in peripheral root cell layers and root hairs.<br /> *Expression of ''PutAKT1'' increased the K+ content under normal K+ -starvation,and NaCl-stress conditions.<br /> *The expression of ''PutAKT1'' was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing ''PutAKT1'' showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight.<br /> * Expression of ''PutAKT1'' also showed a decrease in Na+ accumulation both in the shoot and in the root. <br /> ====Expression in experiment====<br /> * Subjected to NaCl and K+-starvation stresses for 24 h, ''PutAKT1'' was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, ''PutAKT1'' expression was monitored over a 24-h period. <br /> * In rice, the expression level of ''PutAKT1'' is down-regulated by excessive external NaCl. Under K+-starvation stress, ''PutAKT1'' was dramatically induced at 24 h of stress.<br /> <br /> ===Evolution===<br /> *''PutAKT1'' belongs to the ''AKT1''-subfamily in the Shaker K+ channel family. ''PutAKT1'' was localized in the plasma membrane and it was preferentially expressed in the roots.there are three ''AKT1''-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that ''PutAKT''1 belongs to a small gene family.<br /> <br /> ==Labs working on this gene==<br /> * Asian Natural Environmental Science Center (ANESC),The University of Tokyo, 1-1-1 Midori-Cho, Nishitokyo,Tokyo 188-0002, Japan<br /> * Department of Agronomy and Horticulture,Bogor Agricultural University (IPB), Jl. Meranti, Kampus IPB, Darmaga Bogor 16680, Indonesia S. Liu<br /> * Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin 150040, China<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Ardie SW, Liu S, Takano T. Expression of the AKT1-type K(+) channel gene from <br /> Puccinellia tenuiflora, PutAKT1, enhances salt tolerance in Arabidopsis. Plant<br /> Cell Rep. 2010 Aug;29(8):865-74. doi: 10.1007/s00299-010-0872-2. PubMed PMID:<br /> 20532513.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 9]]<br /> [[Category:Chromosome 9]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0106700&diff=277964 2017-05-08T12:53:34Z

<p>Xysj2028: /* Expression in experiment */</p> <hr /> <div>The rice '''''Os09g0106700''''' was reported as '''''PutAKT1''''' in 2009 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Function===<br /> * ''PutAKT1'' is involved in mediating K+ uptake (i) both in low- and in high-affinity K+ uptake range, and (ii)in ''P. tenuiflora'' , even under saltstress condition.The notion that ''AKT1''-type channels are the main K+ uptake pathway into the plant root was based on their dominant expression in the roots and studies of ''AKT1''-disrupted mutants.<br /> *''PutAKT1'' not only increases tissue K+ accumulation, but also decreases Na+&lt;ref name=&quot;ref 1&quot;/&gt;.<br /> <br /> ===Expression===<br /> *The AKT1 is preferentially expressed in peripheral root cell layers and root hairs.<br /> *Expression of ''PutAKT1'' increased the K+ content under normal K+ -starvation,and NaCl-stress conditions.<br /> *The expression of ''PutAKT1'' was induced by K+-starvation stress in the roots and was not downregulated by the presence of excess Na+.Over-expressing ''PutAKT1'' showed enhanced salt tolerance compared to wild-type plants as shown by their shoot phenotype and dry weight.<br /> * Expression of ''PutAKT1'' also showed a decrease in Na+ accumulation both in the shoot and in the root. <br /> ====Expression in experiment====<br /> * Subjected to NaCl and K+-starvation stresses for 24 h, ''PutAKT1'' was predominantly expressed in the roots under all conditions tested (about two-fold higher than in the shoots). To gain further insight into ionic stress regulation of PutAKT1 expression in roots, ''PutAKT1'' expression was monitored over a 24-h period. <br /> * In rice, the expression level of ''PutAKT1'' is down-regulated by excessive external NaCl. Under K+-starvation stress, ''PutAKT1'' was dramatically induced at 24 h of stress.<br /> <br /> ===Evolution===<br /> *''PutAKT1'' belongs to the ''AKT1''-subfamily in the Shaker K+ channel family. ''PutAKT1'' was localized in the plasma membrane and it was preferentially expressed in the roots.there are three ''AKT1''-type K+ channel genes in Arabidopsis and two in rice.Genomic Southern-hybridizations using DIGlabeled PutAKT1 were performed with probes from the coding region of the PutAKT1. The result revealed a number of PutAKT1 hybridizing bands, suggesting that ''PutAKT''1 belongs to a small gene family.<br /> <br /> ==Labs working on this gene==<br /> * Asian Natural Environmental Science Center (ANESC),The University of Tokyo, 1-1-1 Midori-Cho, Nishitokyo,Tokyo 188-0002, Japan<br /> * Department of Agronomy and Horticulture,Bogor Agricultural University (IPB), Jl. Meranti, Kampus IPB, Darmaga Bogor 16680, Indonesia S. Liu<br /> * Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin 150040, China<br /> <br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Ardie SW, Liu S, Takano T. Expression of the AKT1-type K(+) channel gene from <br /> Puccinellia tenuiflora, PutAKT1, enhances salt tolerance in Arabidopsis. Plant<br /> Cell Rep. 2010 Aug;29(8):865-74. doi: 10.1007/s00299-010-0872-2. PubMed PMID:<br /> 20532513.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 9]]<br /> [[Category:Chromosome 9]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0493100&diff=277963 2017-05-08T12:52:22Z

<p>Xysj2028: /* Evolution */</p> <hr /> <div>The rice '''''Os06g0493100''''' was reported as '''''Bphi008a''''' in 2011 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os06g0493100''''' '''''&lt;=&gt;''''' ''''' BpHi008A, OsRALF-22, OsRALF22, RALF-22, RALF22, bphi008a'''''<br /> <br /> ===Function===<br /> * The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding. &lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * In a previous study, ''Bphi008a'' expression was found to be induced by both BPH feeding and spraying plants with ethephon, which slowly releases Et &lt;ref name=&quot;ref2&quot; /&gt;.<br /> * Measurement of the expression levels of ethylene synthases and of ethylene emissions showed that BPH feeding rapidly initiated the ethylene signaling pathway and up-regulated Bphi008a transcript levels after 6 to 96 h of feeding. In contrast, blocking ethylene transduction (using 1-methylcyclopropene) reduced Bphi008a transcript levels in wild-type plants fed upon by BPH.&lt;ref name=&quot;ref2&quot; /&gt;.&lt;ref name=&quot;ref4&quot; /&gt;.&lt;ref name=&quot;ref3&quot; /&gt;.<br /> <br /> ===Evolution===<br /> * In transgenic lines, changes in the expression levels of several enzymes that are important components of the defenses against the BPH were also observed. <br /> * Yeast two-hybrid screening results showed that Bphi008a is able to interact with a b-ZIP transcription factor (OsbZIP60) and a RNA polymerase polypeptide (SDRP).<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * State Key Laboratory of Hybrid Rice, College of Life Sciences, Wuhan University, Wuhan 430072, People’s Republic of China<br /> * College of Life Sciences, Xinyang Normal University, Xinyang 464000, People’s Republic of China<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189. <br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215. <br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0493100&diff=277962 2017-05-08T12:52:09Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os06g0493100''''' was reported as '''''Bphi008a''''' in 2011 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> ===Gene Symbol===<br /> *'''''Os06g0493100''''' '''''&lt;=&gt;''''' ''''' BpHi008A, OsRALF-22, OsRALF22, RALF-22, RALF22, bphi008a'''''<br /> <br /> ===Function===<br /> * The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding. &lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> * In a previous study, ''Bphi008a'' expression was found to be induced by both BPH feeding and spraying plants with ethephon, which slowly releases Et &lt;ref name=&quot;ref2&quot; /&gt;.<br /> * Measurement of the expression levels of ethylene synthases and of ethylene emissions showed that BPH feeding rapidly initiated the ethylene signaling pathway and up-regulated Bphi008a transcript levels after 6 to 96 h of feeding. In contrast, blocking ethylene transduction (using 1-methylcyclopropene) reduced Bphi008a transcript levels in wild-type plants fed upon by BPH.&lt;ref name=&quot;ref2&quot; /&gt;.&lt;ref name=&quot;ref4&quot; /&gt;.&lt;ref name=&quot;ref3&quot; /&gt;.<br /> <br /> ===Evolution===<br /> * In transgenic lines, changes in the expression levels of several enzymes that are important components of the defenses against the BPH were also observed. <br /> * Yeast two-hybrid screening results showed that Bphi008a is able to interact with a b-ZIP transcription<br /> factor (OsbZIP60) and a RNA polymerase polypeptide (SDRP).<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * State Key Laboratory of Hybrid Rice, College of Life Sciences, Wuhan University, Wuhan 430072, People’s Republic of China<br /> * College of Life Sciences, Xinyang Normal University, Xinyang 464000, People’s Republic of China<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189. <br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215. <br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0493100&diff=277961 2017-05-08T12:35:59Z

<p>Xysj2028: </p> <hr /> <div>Please input one-sentence summary here.<br /> <br /> ==Annotated Information==<br /> ===Function===<br /> The ''Brown planthopper induced008a'' (''Bphi008a''; AY256682) gene of rice (''Oryza sativa'') enhances the plant’s resistance to the brown planthopper (BPH; ''Nilaparvata lugens''). BPH feeding rapidly initiated the ethylene (ET) signaling pathway and up-regulated ''Bphi008a'' transcript levels after 6 to 96 h of feeding. In contrast, blocking ethylene transduction (using 1-methylcyclopropene) reduced ''Bphi008a'' transcript levels in wild-type plants fed upon by BPH. Because ''Bphi008a'' is a downstream gene of the Et signaling pathway in rice. The overexpressed (OE) plants had greater resistance to the BPH than wildtype plants (Fig. 1wD). In contrast, the change in susceptibility of rice to the BPH caused by RNAi of ''Bphi008a'' was not obvious. The level of ''Bphi008a'' expression affects BPH feeding on the phloem of rice (Fig. 1wE). The ''Bphi008a'' expression enhances rice resistance to the BPH by impairing BPH feeding (Fig.1wF). The ''Bphi008a'' can be phosphorylated by rice Mitogen-activated Protein Kinase5 (OsMPK5). Yeast two-hybrid assays demonstrated that the carboxyl-terminal proline-rich region of ''Bphi008a'' interacts directly with this kinase, and this interaction occurs in the nucleus. Subsequently, we found that ''Bphi008a'' up-regulation and down-regulation were accompanied by different changes in transcription levels of OsMPK5, OsMPK12, OsMPK13, and OsMPK17 in transgenic plants (Fig. 2w). Immunoblot analysis also showed that the OsMPK5 protein level increased in overexpressing plants and decreased in RNA interference plants after BPH feeding(Fig. 3w, A and B). The ''Bphi008a'' Overexpression Enhances Levels of AP2/ERF Transcription Factors and Defense-Related Genes. Yeast two-hybrid screening results showed that a clear interaction between ''Bphi008a''and a b-ZIP transcription factor (OsbZIP60), but a weak interaction between ''Bphi008a'' and a RNA polymerase polypeptide (SDRP) (Fig. 4wB). Furthermore, analysis of OsbZIP60 expression levels in wild-type and transgenic plants after BPH feeding from 0 to 96 h (Fig. 4wD) indicated that ''Bphi008a'' (possibly phosphorylated) might form a transcriptional complex with OsbZIP60 and SDRP in vivo that activates the transcription of target genes.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Expression===<br /> In a previous study, ''Bphi008a'' expression was found to be induced by both BPH feeding and spraying plants with ethephon, which slowly releases Et.&lt;ref name=&quot;ref2&quot; /&gt;.In rice, a large gene family controls Et biosynthesis, composed of six 1-aminocyclopropane-1-carboxylic acid (ACC) synthase genes (designated OsACS1–OsACS6) and<br /> seven ACC oxidase genes (designated OsACO1–OsACO7)&lt;ref name=&quot;ref3&quot; /&gt;&lt;ref name=&quot;ref4&quot; /&gt;. Experimental results indicate that Bphi008a transcription is stimulated by active Et(Fig. 5w).Bphi008a expression levels were highest in the roots of seedlings, followed (in order) by leaf blades and leaf sheaths at the heading stage, then leaf sheaths, leaf blades, and stems of seedlings. The lowest detected level of Bphi008a expression was in the flowers (Fig. 6w).<br /> <br /> ===Evolution===<br /> Please input evolution information here.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> State Key Laboratory of Hybrid Rice, College of Life Sciences, Wuhan University, China. <br /> <br /> College of Life Sciences, Xinyang Normal University, China.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189. <br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215. <br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os02g0552700&diff=277960 2017-05-08T12:35:31Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os06g0493100''''' was reported as '''''OsZFP6''''' in 2014 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:23-Os12g0100500.png|right|thumb|327px|'''Fig. 3. Subcellular localisation of the 35S::OsZFP6::GFP fusion protein..&lt;ref name=&quot;ref1&quot; /&gt;.''']]<br /> ===Function===<br /> * '''''OsZFP6''''' is a putatively useful gene for developing crops with increased alkali and H2O2 tolerance.<br /> * '''''OsZFP6''''' plays an important role in abiotic stress responses.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Phenotypic analysis===<br /> * When OsZFP6 was transformed into yeast, the transgenic yeast showed significantly increased resistance to NaHCO3 compared to the control. * Moreover, Arabidopsis transgenic plants overexpressing ''''OsZFP6''''' were more tolerant to both NaHCO3 and H2O2 treatments.<br /> <br /> ===Expression===<br /> * '''''OsZFP6''''' expression was increased by abiotic stress, including salt (NaCl), alkali (NaHCO 3 ) and H2O2 treatment<br /> <br /> ===Subcellular localization===<br /> * The '''''OsZFP6''''' protein contains 305 amino acids and a conserved zinc finger domain and is localised to the nucleus.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin,Heilongjiang 150081, China<br /> * Key Laboratory of Biology and Genetic Resources of Rubber Tree, Ministry of Agriculture, State Key Laboratory Incubation Base for Cultivation and Physiology of Tropical Crops, Rubber Research Institute, CATAS, Danzhou, Hainan 571737, China<br /> * Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin, Heilongjiang 150040, China College of Life Sciences, Xinyang Normal University, China.<br /> ==References==<br /> &lt;references&gt;<br /> * &lt;ref name=&quot;ref1&quot;&gt;<br /> Zhang K, Qian Q, Huang Z, Wang Y, Li M, Hong L, Zeng D, Gu M, Chu C, Cheng Z. <br /> GOLD HULL AND INTERNODE2 encodes a primarily multifunctional cinnamyl-alcohol<br /> dehydrogenase in rice. Plant Physiol. 2006 Mar;140(3):972-83. Epub 2006 Jan 27.<br /> PubMed PMID: 16443696; PubMed Central PMCID: PMC1400561.<br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 2]]<br /> [[Category:Chromosome 2]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0493100&diff=277959 2017-05-08T12:34:28Z

<p>Xysj2028: /* Expression */</p> <hr /> <div>The rice '''''Os06g0493100''''' was reported as '''''OsZFP6''''' in 2014 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:23-Os12g0100500.png|right|thumb|327px|'''Fig. 3. Subcellular localisation of the 35S::OsZFP6::GFP fusion protein..&lt;ref name=&quot;ref1&quot; /&gt;.''']]<br /> ===Function===<br /> * '''''OsZFP6''''' is a putatively useful gene for developing crops with increased alkali and H2O2 tolerance.<br /> * '''''OsZFP6''''' plays an important role in abiotic stress responses.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Phenotypic analysis===<br /> * When OsZFP6 was transformed into yeast, the transgenic yeast showed significantly increased resistance to NaHCO3 compared to the control. * Moreover, Arabidopsis transgenic plants overexpressing ''''OsZFP6''''' were more tolerant to both NaHCO3 and H2O2 treatments.<br /> <br /> ===Expression===<br /> * '''''OsZFP6''''' expression was increased by abiotic stress, including salt (NaCl), alkali (NaHCO 3 ) and H2O2 treatment<br /> <br /> ===Subcellular localization===<br /> * The '''''OsZFP6''''' protein contains 305 amino acids and a conserved zinc finger domain and is localised to the nucleus.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin,Heilongjiang 150081, China<br /> * Key Laboratory of Biology and Genetic Resources of Rubber Tree, Ministry of Agriculture, State Key Laboratory Incubation Base for Cultivation and Physiology of Tropical Crops, Rubber Research Institute, CATAS, Danzhou, Hainan 571737, China<br /> * Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin, Heilongjiang 150040, China College of Life Sciences, Xinyang Normal University, China.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189. <br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215. <br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0493100&diff=277958 2017-05-08T12:34:15Z

<p>Xysj2028: /* Annotated Information */</p> <hr /> <div>The rice '''''Os06g0493100''''' was reported as '''''OsZFP6''''' in 2014 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:23-Os12g0100500.png|right|thumb|327px|'''Fig. 3. Subcellular localisation of the 35S::OsZFP6::GFP fusion protein..&lt;ref name=&quot;ref1&quot; /&gt;.''']]<br /> ===Function===<br /> * '''''OsZFP6''''' is a putatively useful gene for developing crops with increased alkali and H2O2 tolerance.<br /> * '''''OsZFP6''''' plays an important role in abiotic stress responses.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Phenotypic analysis===<br /> * When OsZFP6 was transformed into yeast, the transgenic yeast showed significantly increased resistance to NaHCO3 compared to the control. * Moreover, Arabidopsis transgenic plants overexpressing ''''OsZFP6''''' were more tolerant to both NaHCO3 and H2O2 treatments.<br /> <br /> ===Expression===<br /> * '''''OsZFP6''''' expression was increased by abiotic stress, including salt (NaCl), alkali (NaHCO 3 ) and H 2 O 2 treatment<br /> <br /> ===Subcellular localization===<br /> * The '''''OsZFP6''''' protein contains 305 amino acids and a conserved zinc finger domain and is localised to the nucleus.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin,Heilongjiang 150081, China<br /> * Key Laboratory of Biology and Genetic Resources of Rubber Tree, Ministry of Agriculture, State Key Laboratory Incubation Base for Cultivation and Physiology of Tropical Crops, Rubber Research Institute, CATAS, Danzhou, Hainan 571737, China<br /> * Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin, Heilongjiang 150040, China College of Life Sciences, Xinyang Normal University, China.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189. <br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215. <br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0493100&diff=277957 2017-05-08T12:34:00Z

<p>Xysj2028: </p> <hr /> <div>The rice '''''Os06g0493100''''' was reported as '''''OsZFP6''''' in 2014 &lt;ref name=&quot;ref1&quot; /&gt; by researchers from China. <br /> <br /> ==Annotated Information==<br /> [[File:23-Os12g0100500.png|right|thumb|327px|'''Fig. 3. Subcellular localisation of the 35S::OsZFP6::GFP fusion protein..&lt;ref name=&quot;ref1&quot; /&gt;.'']]<br /> ===Function===<br /> * '''''OsZFP6''''' is a putatively useful gene for developing crops with increased alkali and H2O2 tolerance.<br /> * '''''OsZFP6''''' plays an important role in abiotic stress responses.&lt;ref name=&quot;ref1&quot; /&gt;<br /> <br /> ===Phenotypic analysis===<br /> * When OsZFP6 was transformed into yeast, the transgenic yeast showed significantly increased resistance to NaHCO3 compared to the control. * Moreover, Arabidopsis transgenic plants overexpressing ''''OsZFP6''''' were more tolerant to both NaHCO3 and H2O2 treatments.<br /> <br /> ===Expression===<br /> * '''''OsZFP6''''' expression was increased by abiotic stress, including salt (NaCl), alkali (NaHCO 3 ) and H 2 O 2 treatment<br /> <br /> ===Subcellular localization===<br /> * The '''''OsZFP6''''' protein contains 305 amino acids and a conserved zinc finger domain and is localised to the nucleus.<br /> <br /> You can also add sub-section(s) at will.<br /> <br /> ==Labs working on this gene==<br /> * Northeast Institute of Geography and Agroecology, Key Laboratory of Soybean Molecular Design Breeding, Chinese Academy of Sciences, Harbin,Heilongjiang 150081, China<br /> * Key Laboratory of Biology and Genetic Resources of Rubber Tree, Ministry of Agriculture, State Key Laboratory Incubation Base for Cultivation and Physiology of Tropical Crops, Rubber Research Institute, CATAS, Danzhou, Hainan 571737, China<br /> * Alkali Soil Natural Environmental Science Center (ASNESC), Northeast Forestry University, Harbin, Heilongjiang 150040, China College of Life Sciences, Xinyang Normal University, China.<br /> <br /> ==References==<br /> &lt;references&gt;<br /> &lt;ref name=&quot;ref1&quot;&gt;Jing Hu, Jiangbo Zhou, Xinxin Peng, Henghao Xu, Caixiang Liu, Bo Du, Hongyu Yuan, Lili Zhu, and Guangcun He. The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding1[C][W][OA][J].Plant Physiology, 2011, 156: 856-872.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref2&quot;&gt;Yuan H, Chen X, Zhu L, He G. Isolation and characterization of a novel rice gene encoding a putative insect-inducible protein homologous to wheat Wir1[J].Plant Physiol, 2004, 161: 79-85.<br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref3&quot;&gt;Yang SF, Hoffman NE. Ethylene biosynthesis and its regulation in higher plants[J]. Annu Rev Plant Physiol, 1984, 35: 155-189. <br /> &lt;/ref&gt;<br /> &lt;ref name=&quot;ref4&quot;&gt;Iwai T, Miyasaka A, Seo S, Ohashi Y. Contribution of ethylene biosynthesis for resistance to blast fungus infection in young rice plants[J]. Plant Physiol, 2006, 142: 1202-1215. <br /> &lt;/ref&gt;<br /> &lt;/references&gt;<br /> <br /> ==Structured Information==<br /> <br /> [[Category:Genes]]<br /> [[Category:Japonica mRNA]]<br /> [[Category:Oryza Sativa Japonica Group]]<br /> [[Category:Japonica Genes]]<br /> [[Category:Japonica Chromosome 6]]<br /> [[Category:Chromosome 6]]</div>

Xysj2028 https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:23-Os12g0100500.png&diff=277956 2017-05-08T12:33:05Z

<p>Xysj2028: </p> <hr /> <div></div>

Xysj2028