<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
		<id>http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Ypyabby</id>
		<title>RiceWiki - User contributions [en]</title>
		<link rel="self" type="application/atom+xml" href="http://192.168.164.12:81/ricewiki/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=Ypyabby"/>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php/Special:Contributions/Ypyabby"/>
		<updated>2026-08-28T08:07:07Z</updated>
		<subtitle>User contributions</subtitle>
		<generator>MediaWiki 1.30.0</generator>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184145</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184145"/>
				<updated>2014-06-19T12:15:51Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
[[File:in situ detection of YAB3 and WOX3 transcripts.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
[[File:Figure 1. Phylogeny analysis of YABBY and WOX families.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.[[File:Figure1.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184144</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184144"/>
				<updated>2014-06-19T12:13:31Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
[[File:in situ detection of YAB3 and WOX3 transcripts.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
[[File:Phylogeny analysis of YABBY and WOX families.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.[[File:Figure1.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184143</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184143"/>
				<updated>2014-06-19T12:12:19Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
[[File:in situ detection of YAB3 and WOX3 transcripts.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
[[File:Phylogeny analysis of YABBY and WOX families.png|200px|thumb|left|alt text]]&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.[[File:Figure1.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184142</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184142"/>
				<updated>2014-06-19T12:08:48Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
[[File:in situ detection of YAB3 and WOX3 transcripts.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.[[File:Figure1.jpg]]&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184141</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184141"/>
				<updated>2014-06-19T12:08:07Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
[[File:in situ detection of YAB3 and WOX3 transcripts.jpg]]&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1.jpg]]===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184140</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184140"/>
				<updated>2014-06-19T12:07:41Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1.jpg]]===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184139</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184139"/>
				<updated>2014-06-19T12:06:30Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
[[File:in situ detection of YAB3 and WOX3 transcripts.jpg]]===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1.jpg]]===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:In_situ_detection_of_YAB3_and_WOX3_transcripts.jpg&amp;diff=184138</id>
		<title>File:In situ detection of YAB3 and WOX3 transcripts.jpg</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:In_situ_detection_of_YAB3_and_WOX3_transcripts.jpg&amp;diff=184138"/>
				<updated>2014-06-19T12:04:44Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: A to G, Sections hybridized with YAB3 antisense (A–F) or sense (G)
probes. H to N, Sections hybridized with WOX3 antisense (H–M) or sense (N) probes. A and H, Longitudinal sections of SAM. B
and I, Transverse sections of SAM; insets, enlarged views of&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;A to G, Sections hybridized with YAB3 antisense (A–F) or sense (G)&lt;br /&gt;
probes. H to N, Sections hybridized with WOX3 antisense (H–M) or sense (N) probes. A and H, Longitudinal sections of SAM. B&lt;br /&gt;
and I, Transverse sections of SAM; insets, enlarged views of the central areas of the apexes. C and J, Developing panicle&lt;br /&gt;
longitudinal sections. D to F and K to M, Longitudinal sections of florets at different development stages. The midrib regions of&lt;br /&gt;
leaf primordia (A and H) are designated by plastochron (P) numbers, such that the leaf incipient primordium is labeled P0, the&lt;br /&gt;
next older leaf is labeled P1, and so on. FAM, Floral apical meristem; st, stamen; ca, carpel; l, lemma; p, palea. Bar 5 100 mm.&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184137</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=184137"/>
				<updated>2014-06-19T11:41:13Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1.jpg]]===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172656</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172656"/>
				<updated>2014-05-26T03:52:06Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Knowledge Extension */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
[[File:Figure1.jpg]]===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
3.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure_1._Phylogeny_analysis_of_YABBY_and_WOX_families.jpg&amp;diff=172652</id>
		<title>File:Figure 1. Phylogeny analysis of YABBY and WOX families.jpg</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=File:Figure_1._Phylogeny_analysis_of_YABBY_and_WOX_families.jpg&amp;diff=172652"/>
				<updated>2014-05-26T03:45:19Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: Neighborjoining trees of YABBY (A) and WOX (B) proteins from rice (Os), Arabidopsis
(At), Antirrhinum majus (Am), maize (Zm), Triticum aestivum (Ta), Solanum tuberosum (St), Ipomoea nil (In), Nymphaea alba (Na), Nymphaea colorata (Nc), and Solanum Nycoper&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Neighborjoining trees of YABBY (A) and WOX (B) proteins from rice (Os), Arabidopsis&lt;br /&gt;
(At), Antirrhinum majus (Am), maize (Zm), Triticum aestivum (Ta), Solanum tuberosum (St), Ipomoea nil (In), Nymphaea alba (Na), Nymphaea colorata (Nc), and Solanum Nycopersicum (Le).&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172544</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172544"/>
				<updated>2014-05-25T16:29:55Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* References */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
1. Dai, M., Hu, Y., Zhao, Y., Liu, H., &amp;amp; Zhou, D. X. (2007). A WUSCHEL-LIKE HOMEOBOX gene represses a YABBY gene expression required for rice leaf development. Plant physiology, 144(1), 380-390.&lt;br /&gt;
&lt;br /&gt;
2. Li, J., Yuan, Y., Lu, Z., Yang, L., Gao, R., Lu, J., ... &amp;amp; Xiong, G. (2012). Glabrous Rice 1, encoding a homeodomain protein, regulates trichome development in rice. Rice, 5(1), 1-10.&lt;br /&gt;
&lt;br /&gt;
3.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172541</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172541"/>
				<updated>2014-05-25T16:27:11Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
&lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172540</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172540"/>
				<updated>2014-05-25T16:26:51Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Labs working on this gene */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
1. National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China.&lt;br /&gt;
2. Institut de Biotechnologie des Plantes, Universite´ Paris sud 11, 91405, Orsay, France.&lt;br /&gt;
3. Jiaxing Academy of Agricultural Sciences, Jiaxing, Zhejiang Province 314016, China. &lt;br /&gt;
4. State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172537</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172537"/>
				<updated>2014-05-25T16:22:43Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
''WOX3'' and ''YAB3'' are coexpressed in most lateral organ primordia and young leaves without adaxial/abaxial polarity.&lt;br /&gt;
&lt;br /&gt;
Overexpression of ''WOX3'' leads to lnotted outgrowth of leaves that lack clear separation between the leaf sheath and the leaf blade, simiar to thephenotypic changes as induced by ''YAB3'' RNAi, along with ectopic expression of ''KNOX'' genes in leaves of the trangenic plants. These experiments with inducible ''WOX3'' expression suggest that ''WOX3'' directly regulated ''YAB3''. Conversely, down-regulation of WOX3 induces no phenotype which suggests that other WOX genes may act redundantly with ''WOX3'' to function independently of YAB3/KNOX regulation. Meanwhile, repression of ''WOX3'' induces ''YAB3'' expression which reinforces the interaction between ''WOX3'' and ''YAB3''.&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172494</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172494"/>
				<updated>2014-05-25T15:42:57Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and expression and DNA-binding studies showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172492</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172492"/>
				<updated>2014-05-25T15:42:21Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Expression */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and experiments of gene-to-protein interaction showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172489</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172489"/>
				<updated>2014-05-25T15:39:32Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Knowledge Extension */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and experiments of gene-to-protein interaction showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
Glabrous Rice 1(GRL1) shares the same gene locus with WOX3. Sequence analysis showed that GRL1 is similar to OsWOX in rice. GRL1 encodes WUS-like homeodomain protein and is essential for the trichome development in rice and will contribute to breeding of glabrous elite rie varieties.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172478</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172478"/>
				<updated>2014-05-25T15:32:30Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and experiments of gene-to-protein interaction showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
===Knowledge Extension===&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172469</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172469"/>
				<updated>2014-05-25T15:28:50Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
''WOX3'' funtions as a transcriptional repressor of ''YAB3''. &lt;br /&gt;
&lt;br /&gt;
The ''YABBY'' family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. ''YABBY'' members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize ''FIL''-related ''YABBY'' genes(''ZmYAB9'' and ''ZmYAB14'') expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice ''YABBY'' genes have different funtions from ''YABBY'' members in Arabidopsis and in maize. Additionally, these rice ''YABBY'' genes have distinct funtiions. In particular, ''YAB3'' contributes to the exclusion of ''KNOX'' expression from the leaves(''KNOX'' genes are essencial for leaf development), that is ''YAB3'' is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of ''WOX3'' represses ''YAB3'' and repression of ''WOX3'' by RNAi induces the expression of ''YAB3''. Further sequence analysis and experiments of gene-to-protein interaction showing ''WOX3'' can actually bind to the WOX3-binding site in ''YAB3'' reinforces the hypothesis that ''WOX3'' has a function to control or limit the expression levels of ''YAB3'' in leaves contributing to maintain the undifferentiated state of dividing cells.&lt;br /&gt;
&lt;br /&gt;
In summary, a regulatory module of rice leaf development in which ''WOX3'' represses ''YAB3'' that in turn represses ''KNOX'' genes in leaf tissues is identified. And this regulatory relationship among these three genes might be required to maintain the balance between cell division and cell differentiation during the leaf growth.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172444</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172444"/>
				<updated>2014-05-25T15:15:56Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Function */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
WOX3 funtions as a transcriptional repressor of YAB3. &lt;br /&gt;
&lt;br /&gt;
The YABBY family encode transcription factors with a C2C2 zinc finger domain toward the amino terminus and a putative helix-loop-helix domain called YABBY. YABBY members in Arabidopsis function in controlling abaxial identity of lateral organs, but funtion differently in monocots, with an example of maize FIL-related YABBY genes(ZmYAB9 and ZmYAB14) expressing on the adaxial part of leaf primordia indicating a probable role in lateral leaf outgrowth rather than specifying adaxial cell fate. Likely, rice YABBY genes have different funtions from YABBY members in Arabidopsis and in maize. Additionally, these rice YABBY genes have distinct funtiions. In particular, YAB3 contributes to the exclusion of KNOX expression from the leaves(KNOX genes are essencial for leaf development), that is YAB3 is required for the promotion of diffentiation during leaf organogenesis.&lt;br /&gt;
&lt;br /&gt;
Transgenetic experiments show that overexpression of WOX3 represses YAB3 and repression of WOX3 by RNAi&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172405</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172405"/>
				<updated>2014-05-25T14:38:58Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of ''YABBY'' and  ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes, while OsYAB3 falls to a small FIL/YAB subgroup consisting of AtYAB3, StYAB, FIL, ZmYAB14, and OsYAB3.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172399</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172399"/>
				<updated>2014-05-25T14:18:18Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Evolution */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
According to the phylogeny analysis of the ''WOX'' families, ''OsWOX3'' is highly homologous to Arabidopsis ''PRS'' gene and the maize dulicated ''NS1'' and ''NS2'' genes.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172390</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172390"/>
				<updated>2014-05-25T13:51:47Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172389</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172389"/>
				<updated>2014-05-25T13:50:32Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Annotated Information */&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	<entry>
		<id>https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172388</id>
		<title>BGIOSGA019069</title>
		<link rel="alternate" type="text/html" href="https://ngdc.cncb.ac.cn/ricewiki/index.php?title=BGIOSGA019069&amp;diff=172388"/>
				<updated>2014-05-25T13:49:27Z</updated>
		
		<summary type="html">&lt;p&gt;Ypyabby: /* Annotated Information */ ''WOX3'', a rice ''WUSCHEL-LIKE HOMEOBOX'' gene, negatively regulates the rice ''YAB3'' gene which is involved in the leaf development in rice.&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;Please input one-sentence summary here.&lt;br /&gt;
&lt;br /&gt;
==Annotated Information==&lt;br /&gt;
===Function===&lt;br /&gt;
Please input function information here.&lt;br /&gt;
&lt;br /&gt;
===Expression===&lt;br /&gt;
Please input expression information here.he&lt;br /&gt;
&lt;br /&gt;
===Evolution===&lt;br /&gt;
Please input evolution information here.&lt;br /&gt;
&lt;br /&gt;
You can also add sub-section(s) at will.&lt;br /&gt;
&lt;br /&gt;
==Labs working on this gene==&lt;br /&gt;
Please input related labs here.&lt;br /&gt;
&lt;br /&gt;
==References==&lt;br /&gt;
Please input cited references here.&lt;br /&gt;
&lt;br /&gt;
==Structured Information==&lt;br /&gt;
{{IndicaGene|&lt;br /&gt;
GeneName = BGIOSGA019069|&lt;br /&gt;
Description = Putative wuschel homeobox protein|&lt;br /&gt;
Definition = Oryza sativa Indica Group BGIOSGA019069, complete gene.|&lt;br /&gt;
tag = WOX3|&lt;br /&gt;
tid = BGIOSGA019069-TA|&lt;br /&gt;
pid = BGIOSGA019069-PA|&lt;br /&gt;
Length = 941|&lt;br /&gt;
Source = Oryza sativa Indica Group&lt;br /&gt;
&lt;br /&gt;
  ORGANISM  Oryza sativa Indica Group&lt;br /&gt;
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;&lt;br /&gt;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP&lt;br /&gt;
            clade; Ehrhartoideae; Oryzeae; Oryza.&lt;br /&gt;
|&lt;br /&gt;
Chromosome = [[:category:Indica Chromosome 5|Chromosome 5]]|&lt;br /&gt;
AP = Chromosome 5:1033323..1034263|&lt;br /&gt;
CDS = 1033323..1033910,1033991..1034263|&lt;br /&gt;
GCID = &amp;lt;gbrowseImage1&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage1&amp;gt;|&lt;br /&gt;
GSID = &amp;lt;gbrowseImage2&amp;gt;&lt;br /&gt;
name=IndicaChromosome05:1033323..1034263&lt;br /&gt;
source=RiceIndica05&lt;br /&gt;
preset=GeneLocation&lt;br /&gt;
&amp;lt;/gbrowseImage2&amp;gt;|&lt;br /&gt;
CDNA = &amp;lt;cdnaseq&amp;gt;ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/cdnaseq&amp;gt;|&lt;br /&gt;
AA = &amp;lt;aaseq&amp;gt;MAPAVQQQQSGGGGGSTGAAAVGSTTRWCPTPEQLMMLEEMYRGGLRTPNAAQIQQITAHLSTYGRIEGKNVFYWFQNHKARDRQKLRRRLCISHHLLSCAHYYHHHLAAAAAVVPTTKLLTTLNPSSSSSSCGGGLNEDANSLLSPTSPTTPTSAAAAAAAAAYTTSYYYPFTAAAAPPPPRTSPAASPLFHYNQGGGGVVLPAAEAIGRSSSSSDYSLGKLVDNFGVALEETFPAQPQQPATTMAMTAVVDTTAVAAAAGGFCRPLKTLDLFPGGLKEEQHDVV&amp;lt;/aaseq&amp;gt;|&lt;br /&gt;
DNA = &amp;lt;dnaseqindica&amp;gt;1..588#669..941#ATGGCGCCGGCGGTGCAGCAGCAGCAGAGCGGCGGCGGCGGCGGATCGACGGGGGCGGCGGCGGTGGGGTCGACGACGCGGTGGTGCCCGACGCCGGAGCAGCTGATGATGCTGGAGGAGATGTACAGGGGAGGGCTCCGGACGCCGAACGCGGCGCAGATACAGCAGATCACGGCGCACCTCTCGACGTACGGCCGCATCGAGGGCAAGAACGTCTTCTACTGGTTCCAGAACCACAAGGCCCGCGACCGCCAGAAGCTCCGCCGCCGCCTCTGCATCTCCCACCACCTCCTCTCCTGCGCCCACTACTACCACCACCACCTCGCCGCCGCCGCCGCCGTCGTACCGACGACGAAGCTTCTGACGACGCTGAACCCCTCCTCCTCCTCCTCCTCCTGCGGAGGAGGACTCAACGAAGACGCTAATTCCCTTCTCTCCCCCACGTCGCCGACCACCCCCACCTCCGCCGCCGCAGCAGCAGCAGCAGCAGCTTACACCACCAGCTACTACTACCCCTTCACCGCCGCCGCCGCACCGCCACCGCCCAGGACGTCGCCGGCGGCGAGCCCCCTCTTCCACTACAACCAGGTACGTAATGGTGTAACCTAACCTAGCTAGCTAGCTAGCTACTAGCTAATCATTGCTTAATCGATCATGTCGCGTGGCAGGGAGGCGGCGGCGTGGTGTTGCCGGCGGCGGAGGCGATCGGGCGTTCGTCGTCGTCGTCGGACTACTCGCTGGGGAAGCTAGTGGACAACTTCGGGGTGGCGCTGGAGGAGACGTTCCCGGCGCAGCCGCAGCAGCCGGCGACGACGATGGCGATGACGGCCGTCGTCGACACTACGGCGGTGGCGGCGGCGGCAGGTGGCTTCTGCCGGCCGCTCAAGACGCTGGACCTCTTCCCCGGCGGCCTCAAGGAAGAGCAGCATGACGTCGTCTAG&amp;lt;/dnaseqindica&amp;gt;|&lt;br /&gt;
Link = [http://plants.ensembl.org/Oryza_indica/Gene/Summary?g=BGIOSGA019069 EnsemblPlants:BGIOSGA019069]|&lt;br /&gt;
}}&lt;br /&gt;
[[Category:Genes]]&lt;br /&gt;
[[Category:Indica mRNA]]&lt;br /&gt;
[[Category:Oryza Sativa Indica Group]]&lt;br /&gt;
[[Category:Indica Genes]]&lt;br /&gt;
[[Category:Indica Chromosome 5]]&lt;br /&gt;
[[Category:Chromosome 5]]&lt;/div&gt;</summary>
		<author><name>Ypyabby</name></author>	</entry>

	</feed>