RiceWiki - User contributions [en]

Os07g0508500

2014-06-02T03:19:40Z

Yugee: Blanked the page

User talk:Yugee

2014-06-02T03:17:48Z

Yugee: Created page with "?"

Os07g0508500

2014-06-02T03:13:58Z

Yugee:

Os07g0508500

2014-06-02T03:10:42Z

Yugee: Undo revision 175908 by Yugee (talk)

Os07g0508500

2014-06-02T03:10:22Z

Yugee: Undo revision 175909 by Yugee (talk)

Os07g0508500

2014-06-02T03:07:30Z

Yugee: /* Function */

Please input one-sentence summary here.

==Annotated Information==

Os07g0508500

2014-06-02T03:06:56Z

Yugee: /* Function */

Os07g0508500

2014-06-02T03:06:27Z

Yugee: /* Function */

Os07g0508500

2014-06-02T03:05:15Z

Yugee: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Bub1 (for budding uninhibited by benzimidazole 1), one of the main spindle checkpoint kinases, acts as a kinetochore scaffold
for assembling other checkpoint proteins. Here, we identify a plant Bub1-related kinase 1 (BRK1) in rice (Oryza sativa). The
brk1 mutants are sterile due to the precocious separation of sister chromatids at the onset of anaphase I. The centromeric
recruitment of SHUGOSHIN1 and phosphorylation of histone H2A at Thr-134 (H2A-pT134) depend on BRK1. Although the
homologs can faithfully separate from each other at the end of meiosis I, the uncorrected merotelic attachment of paired
sister kinetochores at the early stage of metaphase I in brk1 reduces the tension across homologous kinetochores, causes
the metaphase I spindle to be aberrantly shaped, and subsequently affects the synchronicity of homolog separation at the
onset of anaphase I. In addition, the phosphorylation of inner centromeric histone H3 at Ser-10 (H3-pS10) during diakinesis
depends on BRK1. Therefore, we speculate that BRK1 may be required for normal localization of Aurora kinase before the
onset of metaphase I, which is responsible for correcting the merotelic attachment.<ref name="ref1">

===Expression===
'''Plant Materials'''

The blk1-1 mutant was isolated from the indica rice (Oryza sativa) variety
Zhongxian 3037 following
60
Co;g-ray radiation. Seeds of the Tos17 insertion line NE7019, which we called blk1-2, were kindly provided by the
Rice Genome Resource Center of the National Institute of Agrobiological
Sciences. The other meiotic mutant, sgo1-1, was isolated in our lab previously (Wang et al., 2011). All plant material was cultivated in paddy ﬁelds.

'''Molecular Cloning of BRK1 and Tos17 Insertion Site Mapping'''

To ﬁne map BRK1, STS markers (P1 to P5) were developed based on
sequence differences between indica variety 9311 and japonica variety
Zhonghua 11 according to data published on the National Center for
Biotechnology Information website. All primer sequences are listed in
Supplemental Table 1 online. Primer pair TosP (59-ATTGTTAGGTTGCAAGTTAGTTAAGA-39) and 7019P (59-TGTATCGCCAGCTTGATACG-
39) was used to amplify the Tos17-inserted regions of brk1-2. The PCR
products were cloned into the pMD18-T vector (TaKaRa) and sequenced.

'''Cloning the Full-Length BRK1 cDNA'''

Total RNA was extracted from rice panicle using TRIzol reagent (Invitrogen), and 3 mg RNA was reverse transcribed with the oligo-dT(18)
primer using MMLV-RT (Invitrogen). Gene-speciﬁc primers forward (59-
ATGGTTCTGCTCGAACGCAC-39) and reverse (59-GATGCGTATATGTCTCGGT-39) were designed to amplify the predicted coding region of
BRK1. PCR products were cloned into the pMD18-T vector (TaKaRa) and
sequenced. 39- and 59-RACE was performed according to the kit protocols (39-Full RACE Core Set and 59-Full RACE Core Set; TaKaRa). For
39-RACE, the ﬁrst and second PCRs were performed using 39RACE-F1
(59-CTGCTCAACGCGACCTCCAA-39) and the 39 adaptor (59-AAGCAGTGGTATCAACGCAGA-39), and 39RACE-F2 (59-AGCCTCCGGATGTCCTTCCA-39) and the 39 adaptor, respectively. For 59-RACE, total RNA was
reverse transcribed using the 59 phosphorylated primer 59RACE-RT (59-
CCTTACTGAAGAGAAACAGT-39). First and second PCRs were performed using 59RACE-S1 (59-CTCAGGTCTATCAACAAGGCT-39) and
59RACE-R1 (59-TGCTGCCTCGGGCACCACCAA-39), and 59RACE-S2
(59-GATCGGCTCAAGATTTGTGT-39) and 59RACE-R2 (59-CGTGCGTTCGAGCAGAACCA-39), respectively. The products of 39-RACE-PCR and
59-RACE-PCR were cloned and sequenced.

'''Real-Time PCR Expression Assay'''

Real-time PCR assay was conducted as described (Hong et al., 2010).
Total RNA was extracted from the leaf, root, and panicle of Zhongxian
3037 and panicles of brk1 mutants. Real-time PCR analysis was performed using the Bio-Rad CFX96 real-time PCR instrument and EvaGreen
(BIOTIUM). Real-Time PCR was performed using primers BRKRT-F
(59-CTGCTCAACGCGACCTCCAA-39) and BRKRT-R (59-GCTACGAAGTTACGGAAGGT-39) for BRK1 and UBQF (59-CAAGATGATCTGCCGCAAATGC-39) and UBQR (59-TTTAACCAGTCCATGAACCCG-39) for
Ubiquitin. The real-time PCR results were analyzed using Bio-Rad CFX
Manager analysis software. Each experiment had three replicates.

'''Construction of BRK1 RNA Interference Cassette and
Rice Transformation'''

A 310-bp fragment of the BRK1 cDNA sequence was ampliﬁed with the
primer pair RNAiF, 59-ATTCTCGAGGCCAGTGTCGATGGTAATACA-39
(adding an XhoI site), and RNAiR, 59-ACGAGATCTCAACGCTGTGCAGTGTTTCCA-39 (adding a BglII site). The fragment was cloned into the
BamHI-SalI and BglII-XhoI sites of the pUCRNAi vector. Subsequently,
the stem-loop fragment was cloned into the pCAMBIA2300-Actin vector.
Then the RNAi construct was transformed into an Agrobacterium tumefaciens strain, which was used for further rice transformation.

'''Antibody Production and Protein Gel Blot Analysis'''

Antibodies were produced as described (Wang et al., 2010). To generate
the antibody against BRK1, a 330-bp fragment of the BRK1 cDNA (amino
acids 396 to 505) was ampliﬁed with primers BRKAbF, 59-GTGAATTCCCGAAATCACAGACGAAACCTT-39 (adding an EcoRI site), and
BRKAbR, 59-AGTCTCGAGTCCACAGCTCCACGTTCCAGT-39 (adding an
XhoI site). The fragment was cloned into the expression vector pGEX 4T-2.
The BRKAb-GST peptides were puriﬁed using Glutathione Sepharose 4B
(GE). Polyclonal antibodies against BRK1 were raised in rabbit and mouse.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis</ref>

Os07g0508500

2014-06-02T03:03:50Z

Yugee: /* Function */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Bub1 (for budding uninhibited by benzimidazole 1), one of the main spindle checkpoint kinases, acts as a kinetochore scaffold
for assembling other checkpoint proteins. Here, we identify a plant Bub1-related kinase 1 (BRK1) in rice (Oryza sativa). The
brk1 mutants are sterile due to the precocious separation of sister chromatids at the onset of anaphase I. The centromeric
recruitment of SHUGOSHIN1 and phosphorylation of histone H2A at Thr-134 (H2A-pT134) depend on BRK1. Although the
homologs can faithfully separate from each other at the end of meiosis I, the uncorrected merotelic attachment of paired
sister kinetochores at the early stage of metaphase I in brk1 reduces the tension across homologous kinetochores, causes
the metaphase I spindle to be aberrantly shaped, and subsequently affects the synchronicity of homolog separation at the
onset of anaphase I. In addition, the phosphorylation of inner centromeric histone H3 at Ser-10 (H3-pS10) during diakinesis
depends on BRK1. Therefore, we speculate that BRK1 may be required for normal localization of Aurora kinase before the
onset of metaphase I, which is responsible for correcting the merotelic attachment.

===Expression===
'''Plant Materials'''

The blk1-1 mutant was isolated from the indica rice (Oryza sativa) variety
Zhongxian 3037 following
60
Co;g-ray radiation. Seeds of the Tos17 insertion line NE7019, which we called blk1-2, were kindly provided by the
Rice Genome Resource Center of the National Institute of Agrobiological
Sciences. The other meiotic mutant, sgo1-1, was isolated in our lab previously (Wang et al., 2011). All plant material was cultivated in paddy ﬁelds.

'''Molecular Cloning of BRK1 and Tos17 Insertion Site Mapping'''

To ﬁne map BRK1, STS markers (P1 to P5) were developed based on
sequence differences between indica variety 9311 and japonica variety
Zhonghua 11 according to data published on the National Center for
Biotechnology Information website. All primer sequences are listed in
Supplemental Table 1 online. Primer pair TosP (59-ATTGTTAGGTTGCAAGTTAGTTAAGA-39) and 7019P (59-TGTATCGCCAGCTTGATACG-
39) was used to amplify the Tos17-inserted regions of brk1-2. The PCR
products were cloned into the pMD18-T vector (TaKaRa) and sequenced.

'''Cloning the Full-Length BRK1 cDNA'''

Total RNA was extracted from rice panicle using TRIzol reagent (Invitrogen), and 3 mg RNA was reverse transcribed with the oligo-dT(18)
primer using MMLV-RT (Invitrogen). Gene-speciﬁc primers forward (59-
ATGGTTCTGCTCGAACGCAC-39) and reverse (59-GATGCGTATATGTCTCGGT-39) were designed to amplify the predicted coding region of
BRK1. PCR products were cloned into the pMD18-T vector (TaKaRa) and
sequenced. 39- and 59-RACE was performed according to the kit protocols (39-Full RACE Core Set and 59-Full RACE Core Set; TaKaRa). For
39-RACE, the ﬁrst and second PCRs were performed using 39RACE-F1
(59-CTGCTCAACGCGACCTCCAA-39) and the 39 adaptor (59-AAGCAGTGGTATCAACGCAGA-39), and 39RACE-F2 (59-AGCCTCCGGATGTCCTTCCA-39) and the 39 adaptor, respectively. For 59-RACE, total RNA was
reverse transcribed using the 59 phosphorylated primer 59RACE-RT (59-
CCTTACTGAAGAGAAACAGT-39). First and second PCRs were performed using 59RACE-S1 (59-CTCAGGTCTATCAACAAGGCT-39) and
59RACE-R1 (59-TGCTGCCTCGGGCACCACCAA-39), and 59RACE-S2
(59-GATCGGCTCAAGATTTGTGT-39) and 59RACE-R2 (59-CGTGCGTTCGAGCAGAACCA-39), respectively. The products of 39-RACE-PCR and
59-RACE-PCR were cloned and sequenced.

'''Real-Time PCR Expression Assay'''

Real-time PCR assay was conducted as described (Hong et al., 2010).
Total RNA was extracted from the leaf, root, and panicle of Zhongxian
3037 and panicles of brk1 mutants. Real-time PCR analysis was performed using the Bio-Rad CFX96 real-time PCR instrument and EvaGreen
(BIOTIUM). Real-Time PCR was performed using primers BRKRT-F
(59-CTGCTCAACGCGACCTCCAA-39) and BRKRT-R (59-GCTACGAAGTTACGGAAGGT-39) for BRK1 and UBQF (59-CAAGATGATCTGCCGCAAATGC-39) and UBQR (59-TTTAACCAGTCCATGAACCCG-39) for
Ubiquitin. The real-time PCR results were analyzed using Bio-Rad CFX
Manager analysis software. Each experiment had three replicates.

'''Construction of BRK1 RNA Interference Cassette and
Rice Transformation'''

A 310-bp fragment of the BRK1 cDNA sequence was ampliﬁed with the
primer pair RNAiF, 59-ATTCTCGAGGCCAGTGTCGATGGTAATACA-39
(adding an XhoI site), and RNAiR, 59-ACGAGATCTCAACGCTGTGCAGTGTTTCCA-39 (adding a BglII site). The fragment was cloned into the
BamHI-SalI and BglII-XhoI sites of the pUCRNAi vector. Subsequently,
the stem-loop fragment was cloned into the pCAMBIA2300-Actin vector.
Then the RNAi construct was transformed into an Agrobacterium tumefaciens strain, which was used for further rice transformation.

'''Antibody Production and Protein Gel Blot Analysis'''

Antibodies were produced as described (Wang et al., 2010). To generate
the antibody against BRK1, a 330-bp fragment of the BRK1 cDNA (amino
acids 396 to 505) was ampliﬁed with primers BRKAbF, 59-GTGAATTCCCGAAATCACAGACGAAACCTT-39 (adding an EcoRI site), and
BRKAbR, 59-AGTCTCGAGTCCACAGCTCCACGTTCCAGT-39 (adding an
XhoI site). The fragment was cloned into the expression vector pGEX 4T-2.
The BRKAb-GST peptides were puriﬁed using Glutathione Sepharose 4B
(GE). Polyclonal antibodies against BRK1 were raised in rabbit and mouse.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis</ref>

Os07g0508500

2014-06-02T03:01:54Z

Yugee: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
'''Plant Materials'''

The blk1-1 mutant was isolated from the indica rice (Oryza sativa) variety
Zhongxian 3037 following
60
Co;g-ray radiation. Seeds of the Tos17 insertion line NE7019, which we called blk1-2, were kindly provided by the
Rice Genome Resource Center of the National Institute of Agrobiological
Sciences. The other meiotic mutant, sgo1-1, was isolated in our lab previously (Wang et al., 2011). All plant material was cultivated in paddy ﬁelds.

'''Molecular Cloning of BRK1 and Tos17 Insertion Site Mapping'''

To ﬁne map BRK1, STS markers (P1 to P5) were developed based on
sequence differences between indica variety 9311 and japonica variety
Zhonghua 11 according to data published on the National Center for
Biotechnology Information website. All primer sequences are listed in
Supplemental Table 1 online. Primer pair TosP (59-ATTGTTAGGTTGCAAGTTAGTTAAGA-39) and 7019P (59-TGTATCGCCAGCTTGATACG-
39) was used to amplify the Tos17-inserted regions of brk1-2. The PCR
products were cloned into the pMD18-T vector (TaKaRa) and sequenced.

'''Cloning the Full-Length BRK1 cDNA'''

Total RNA was extracted from rice panicle using TRIzol reagent (Invitrogen), and 3 mg RNA was reverse transcribed with the oligo-dT(18)
primer using MMLV-RT (Invitrogen). Gene-speciﬁc primers forward (59-
ATGGTTCTGCTCGAACGCAC-39) and reverse (59-GATGCGTATATGTCTCGGT-39) were designed to amplify the predicted coding region of
BRK1. PCR products were cloned into the pMD18-T vector (TaKaRa) and
sequenced. 39- and 59-RACE was performed according to the kit protocols (39-Full RACE Core Set and 59-Full RACE Core Set; TaKaRa). For
39-RACE, the ﬁrst and second PCRs were performed using 39RACE-F1
(59-CTGCTCAACGCGACCTCCAA-39) and the 39 adaptor (59-AAGCAGTGGTATCAACGCAGA-39), and 39RACE-F2 (59-AGCCTCCGGATGTCCTTCCA-39) and the 39 adaptor, respectively. For 59-RACE, total RNA was
reverse transcribed using the 59 phosphorylated primer 59RACE-RT (59-
CCTTACTGAAGAGAAACAGT-39). First and second PCRs were performed using 59RACE-S1 (59-CTCAGGTCTATCAACAAGGCT-39) and
59RACE-R1 (59-TGCTGCCTCGGGCACCACCAA-39), and 59RACE-S2
(59-GATCGGCTCAAGATTTGTGT-39) and 59RACE-R2 (59-CGTGCGTTCGAGCAGAACCA-39), respectively. The products of 39-RACE-PCR and
59-RACE-PCR were cloned and sequenced.

'''Real-Time PCR Expression Assay'''

Real-time PCR assay was conducted as described (Hong et al., 2010).
Total RNA was extracted from the leaf, root, and panicle of Zhongxian
3037 and panicles of brk1 mutants. Real-time PCR analysis was performed using the Bio-Rad CFX96 real-time PCR instrument and EvaGreen
(BIOTIUM). Real-Time PCR was performed using primers BRKRT-F
(59-CTGCTCAACGCGACCTCCAA-39) and BRKRT-R (59-GCTACGAAGTTACGGAAGGT-39) for BRK1 and UBQF (59-CAAGATGATCTGCCGCAAATGC-39) and UBQR (59-TTTAACCAGTCCATGAACCCG-39) for
Ubiquitin. The real-time PCR results were analyzed using Bio-Rad CFX
Manager analysis software. Each experiment had three replicates.

'''Construction of BRK1 RNA Interference Cassette and
Rice Transformation'''

A 310-bp fragment of the BRK1 cDNA sequence was ampliﬁed with the
primer pair RNAiF, 59-ATTCTCGAGGCCAGTGTCGATGGTAATACA-39
(adding an XhoI site), and RNAiR, 59-ACGAGATCTCAACGCTGTGCAGTGTTTCCA-39 (adding a BglII site). The fragment was cloned into the
BamHI-SalI and BglII-XhoI sites of the pUCRNAi vector. Subsequently,
the stem-loop fragment was cloned into the pCAMBIA2300-Actin vector.
Then the RNAi construct was transformed into an Agrobacterium tumefaciens strain, which was used for further rice transformation.

'''Antibody Production and Protein Gel Blot Analysis'''

Antibodies were produced as described (Wang et al., 2010). To generate
the antibody against BRK1, a 330-bp fragment of the BRK1 cDNA (amino
acids 396 to 505) was ampliﬁed with primers BRKAbF, 59-GTGAATTCCCGAAATCACAGACGAAACCTT-39 (adding an EcoRI site), and
BRKAbR, 59-AGTCTCGAGTCCACAGCTCCACGTTCCAGT-39 (adding an
XhoI site). The fragment was cloned into the expression vector pGEX 4T-2.
The BRKAb-GST peptides were puriﬁed using Glutathione Sepharose 4B
(GE). Polyclonal antibodies against BRK1 were raised in rabbit and mouse.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis</ref>

Os07g0508500

2014-06-02T03:00:42Z

Yugee: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
'''Plant Materials'''
The blk1-1 mutant was isolated from the indica rice (Oryza sativa) variety
Zhongxian 3037 following
60
Co;g-ray radiation. Seeds of the Tos17 insertion line NE7019, which we called blk1-2, were kindly provided by the
Rice Genome Resource Center of the National Institute of Agrobiological
Sciences. The other meiotic mutant, sgo1-1, was isolated in our lab previously (Wang et al., 2011). All plant material was cultivated in paddy ﬁelds.
'''Molecular Cloning of BRK1 and Tos17 Insertion Site Mapping'''
To ﬁne map BRK1, STS markers (P1 to P5) were developed based on
sequence differences between indica variety 9311 and japonica variety
Zhonghua 11 according to data published on the National Center for
Biotechnology Information website. All primer sequences are listed in
Supplemental Table 1 online. Primer pair TosP (59-ATTGTTAGGTTGCAAGTTAGTTAAGA-39) and 7019P (59-TGTATCGCCAGCTTGATACG-
39) was used to amplify the Tos17-inserted regions of brk1-2. The PCR
products were cloned into the pMD18-T vector (TaKaRa) and sequenced.
'''Cloning the Full-Length BRK1 cDNA'''
Total RNA was extracted from rice panicle using TRIzol reagent (Invitrogen), and 3 mg RNA was reverse transcribed with the oligo-dT(18)
primer using MMLV-RT (Invitrogen). Gene-speciﬁc primers forward (59-
ATGGTTCTGCTCGAACGCAC-39) and reverse (59-GATGCGTATATGTCTCGGT-39) were designed to amplify the predicted coding region of
BRK1. PCR products were cloned into the pMD18-T vector (TaKaRa) and
sequenced. 39- and 59-RACE was performed according to the kit protocols (39-Full RACE Core Set and 59-Full RACE Core Set; TaKaRa). For
39-RACE, the ﬁrst and second PCRs were performed using 39RACE-F1
(59-CTGCTCAACGCGACCTCCAA-39) and the 39 adaptor (59-AAGCAGTGGTATCAACGCAGA-39), and 39RACE-F2 (59-AGCCTCCGGATGTCCTTCCA-39) and the 39 adaptor, respectively. For 59-RACE, total RNA was
reverse transcribed using the 59 phosphorylated primer 59RACE-RT (59-
CCTTACTGAAGAGAAACAGT-39). First and second PCRs were performed using 59RACE-S1 (59-CTCAGGTCTATCAACAAGGCT-39) and
59RACE-R1 (59-TGCTGCCTCGGGCACCACCAA-39), and 59RACE-S2
(59-GATCGGCTCAAGATTTGTGT-39) and 59RACE-R2 (59-CGTGCGTTCGAGCAGAACCA-39), respectively. The products of 39-RACE-PCR and
59-RACE-PCR were cloned and sequenced.
'''Real-Time PCR Expression Assay'''
Real-time PCR assay was conducted as described (Hong et al., 2010).
Total RNA was extracted from the leaf, root, and panicle of Zhongxian
3037 and panicles of brk1 mutants. Real-time PCR analysis was performed using the Bio-Rad CFX96 real-time PCR instrument and EvaGreen
(BIOTIUM). Real-Time PCR was performed using primers BRKRT-F
(59-CTGCTCAACGCGACCTCCAA-39) and BRKRT-R (59-GCTACGAAGTTACGGAAGGT-39) for BRK1 and UBQF (59-CAAGATGATCTGCCGCAAATGC-39) and UBQR (59-TTTAACCAGTCCATGAACCCG-39) for
Ubiquitin. The real-time PCR results were analyzed using Bio-Rad CFX
Manager analysis software. Each experiment had three replicates.
'''Construction of BRK1 RNA Interference Cassette and
Rice Transformation'''
A 310-bp fragment of the BRK1 cDNA sequence was ampliﬁed with the
primer pair RNAiF, 59-ATTCTCGAGGCCAGTGTCGATGGTAATACA-39
(adding an XhoI site), and RNAiR, 59-ACGAGATCTCAACGCTGTGCAGTGTTTCCA-39 (adding a BglII site). The fragment was cloned into the
BamHI-SalI and BglII-XhoI sites of the pUCRNAi vector. Subsequently,
the stem-loop fragment was cloned into the pCAMBIA2300-Actin vector.
Then the RNAi construct was transformed into an Agrobacterium tumefaciens strain, which was used for further rice transformation.
'''Antibody Production and Protein Gel Blot Analysis'''
Antibodies were produced as described (Wang et al., 2010). To generate
the antibody against BRK1, a 330-bp fragment of the BRK1 cDNA (amino
acids 396 to 505) was ampliﬁed with primers BRKAbF, 59-GTGAATTCCCGAAATCACAGACGAAACCTT-39 (adding an EcoRI site), and
BRKAbR, 59-AGTCTCGAGTCCACAGCTCCACGTTCCAGT-39 (adding an
XhoI site). The fragment was cloned into the expression vector pGEX 4T-2.
The BRKAb-GST peptides were puriﬁed using Glutathione Sepharose 4B
(GE). Polyclonal antibodies against BRK1 were raised in rabbit and mouse.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis</ref>

Os07g0508500

2014-06-02T02:58:04Z

Yugee: /* Expression */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
Plant Materials
The blk1-1 mutant was isolated from the indica rice (Oryza sativa) variety
Zhongxian 3037 following
60
Co;g-ray radiation. Seeds of the Tos17 insertion line NE7019, which we called blk1-2, were kindly provided by the
Rice Genome Resource Center of the National Institute of Agrobiological
Sciences. The other meiotic mutant, sgo1-1, was isolated in our lab previously (Wang et al., 2011). All plant material was cultivated in paddy ﬁelds.
Molecular Cloning of BRK1 and Tos17 Insertion Site Mapping
To ﬁne map BRK1, STS markers (P1 to P5) were developed based on
sequence differences between indica variety 9311 and japonica variety
Zhonghua 11 according to data published on the National Center for
Biotechnology Information website. All primer sequences are listed in
Supplemental Table 1 online. Primer pair TosP (59-ATTGTTAGGTTGCAAGTTAGTTAAGA-39) and 7019P (59-TGTATCGCCAGCTTGATACG-
39) was used to amplify the Tos17-inserted regions of brk1-2. The PCR
products were cloned into the pMD18-T vector (TaKaRa) and sequenced.
Cloning the Full-Length BRK1 cDNA
Total RNA was extracted from rice panicle using TRIzol reagent (Invitrogen), and 3 mg RNA was reverse transcribed with the oligo-dT(18)
primer using MMLV-RT (Invitrogen). Gene-speciﬁc primers forward (59-
ATGGTTCTGCTCGAACGCAC-39) and reverse (59-GATGCGTATATGTCTCGGT-39) were designed to amplify the predicted coding region of
BRK1. PCR products were cloned into the pMD18-T vector (TaKaRa) and
sequenced. 39- and 59-RACE was performed according to the kit protocols (39-Full RACE Core Set and 59-Full RACE Core Set; TaKaRa). For
39-RACE, the ﬁrst and second PCRs were performed using 39RACE-F1
(59-CTGCTCAACGCGACCTCCAA-39) and the 39 adaptor (59-AAGCAGTGGTATCAACGCAGA-39), and 39RACE-F2 (59-AGCCTCCGGATGTCCTTCCA-39) and the 39 adaptor, respectively. For 59-RACE, total RNA was
reverse transcribed using the 59 phosphorylated primer 59RACE-RT (59-
CCTTACTGAAGAGAAACAGT-39). First and second PCRs were performed using 59RACE-S1 (59-CTCAGGTCTATCAACAAGGCT-39) and
59RACE-R1 (59-TGCTGCCTCGGGCACCACCAA-39), and 59RACE-S2
(59-GATCGGCTCAAGATTTGTGT-39) and 59RACE-R2 (59-CGTGCGTTCGAGCAGAACCA-39), respectively. The products of 39-RACE-PCR and
59-RACE-PCR were cloned and sequenced.
Real-Time PCR Expression Assay
Real-time PCR assay was conducted as described (Hong et al., 2010).
Total RNA was extracted from the leaf, root, and panicle of Zhongxian
3037 and panicles of brk1 mutants. Real-time PCR analysis was performed using the Bio-Rad CFX96 real-time PCR instrument and EvaGreen
(BIOTIUM). Real-Time PCR was performed using primers BRKRT-F
(59-CTGCTCAACGCGACCTCCAA-39) and BRKRT-R (59-GCTACGAAGTTACGGAAGGT-39) for BRK1 and UBQF (59-CAAGATGATCTGCCGCAAATGC-39) and UBQR (59-TTTAACCAGTCCATGAACCCG-39) for
Ubiquitin. The real-time PCR results were analyzed using Bio-Rad CFX
Manager analysis software. Each experiment had three replicates.
Construction of BRK1 RNA Interference Cassette and
Rice Transformation
A 310-bp fragment of the BRK1 cDNA sequence was ampliﬁed with the
primer pair RNAiF, 59-ATTCTCGAGGCCAGTGTCGATGGTAATACA-39
(adding an XhoI site), and RNAiR, 59-ACGAGATCTCAACGCTGTGCAGTGTTTCCA-39 (adding a BglII site). The fragment was cloned into the
BamHI-SalI and BglII-XhoI sites of the pUCRNAi vector. Subsequently,
the stem-loop fragment was cloned into the pCAMBIA2300-Actin vector.
Then the RNAi construct was transformed into an Agrobacterium tumefaciens strain, which was used for further rice transformation.
Antibody Production and Protein Gel Blot Analysis
Antibodies were produced as described (Wang et al., 2010). To generate
the antibody against BRK1, a 330-bp fragment of the BRK1 cDNA (amino
acids 396 to 505) was ampliﬁed with primers BRKAbF, 59-GTGAATTCCCGAAATCACAGACGAAACCTT-39 (adding an EcoRI site), and
BRKAbR, 59-AGTCTCGAGTCCACAGCTCCACGTTCCAGT-39 (adding an
XhoI site). The fragment was cloned into the expression vector pGEX 4T-2.
The BRKAb-GST peptides were puriﬁed using Glutathione Sepharose 4B
(GE). Polyclonal antibodies against BRK1 were raised in rabbit and mouse.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<references>
<ref name="ref1">BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis</ref>

Os07g0508500

2014-06-02T02:56:02Z

Yugee: /* Expression */

Os07g0508500

2014-06-02T02:49:03Z

Yugee: /* References */

Os07g0508500

2014-06-02T02:47:24Z

Yugee: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
<ref name="ref1">BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis

==Structured Information==
{{JaponicaGene|
GeneName = Os07g0508500|
Description = Protein kinase-like domain containing protein|
Version = NM_001066280.1 GI:115472292 GeneID:4343342|
Length = 3152 bp|
Definition = Oryza sativa Japonica Group Os07g0508500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
AP = Chromosome 7:19988887..19992038|
CDS = 19988919..19988966,19989046..19989133,19989352..19989455,19989533..19989604,19989687..19989776 ,19989888..19990045,19990877..19990931,19991024..19991158,19991280..19991401 ,19991653..19991842|
GCID = <gbrowseImage1>
name=NC_008400:19988887..19992038
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008400:19988887..19992038
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgaataatttattggagaacattaatgttgatctgaagaagttcgctggctatcataagagcaataaggtctatcatggaaaggtgccattaacttcgcctcagaatgttttaagaaacaaagtcattgaattaggtggtagaaagtaccagatcaaaggttctcctggtactggtgcttttgcaaaagtttacaaagccagtgtcgatggtaatacagaagacctggttgctttaaagattcagaaaccaccatttccttgggaattttacatgtatcgccagcttgatacgcgcgtatctgatattgagagaccaagctttggctacactcatgaagtgcatgtatacgctgatgtcagtgtgcttgtttgtgattacctgccatacggaactcttctggatgttataaattctcatctagtacttgaacgccatatggatgaagttctatgcatatattacactatagagatgctgcgcatgttggaaacactgcacagcgttggcataattcatggtgatttcaagcctgacaatatgcttgtttgctacccaagtggagaaatcacagacgaaaccttcaaaggcgagacaagatccgagcggaatcaggggctctgccttgttgactggggccgtggcatcgacctgaacctcttcccatccggtgcggagttctacggcgactgccgaacctccgggttcagctgcgtcgagatgcaggaacagagagcctggacgtttcaggctgacacttacggcctctgcgtcatcgcgcacatgatgctacatgggacgcagatgagcatccagaagacgcccaggcccgatggaagctacatgtaccagcccacatcgccgttcaaaaggtactggaacgtggagctgtggaaaaacctcttctccacgctgctcaacgcgacctccaacggcagcgacgcggccgtgctccggagcctccggatgtccttccaggagtacctgtgcagcaaccggcagctcgtcggcaagctgaaccagcaactggccaagcagaagacctccctgtgcctatcctga</cdnaseq>|
AA = <aaseq>MNNLLENINVDLKKFAGYHKSNKVYHGKVPLTSPQNVLRNKVIE LGGRKYQIKGSPGTGAFAKVYKASVDGNTEDLVALKIQKPPFPWEFYMYRQLDTRVSD IERPSFGYTHEVHVYADVSVLVCDYLPYGTLLDVINSHLVLERHMDEVLCIYYTIEML RMLETLHSVGIIHGDFKPDNMLVCYPSGEITDETFKGETRSERNQGLCLVDWGRGIDL NLFPSGAEFYGDCRTSGFSCVEMQEQRAWTFQADTYGLCVIAHMMLHGTQMSIQKTPR PDGSYMYQPTSPFKRYWNVELWKNLFSTLLNATSNGSDAAVLRSLRMSFQEYLCSNRQ LVGKLNQQLAKQKTSLCLS</aaseq>|
DNA = <dnaseqindica>33..80#160..247#466..569#647..718#801..890#1002..1159#1991..2045#2138..2272#2394..2515#2767..2956#ctattttgctggatccatggtctgagtctactatgaataatttattggagaacattaatgttgatctgaagaagttcgctgtaagttgcatttactctatatgattcgctagtgtttatcttagctctcatcttggacggttgcccgaatccttgacagggctatcataagagcaataaggtctatcatggaaaggtgccattaacttcgcctcagaatgttttaagaaacaaagtcattgaattaggtataaactataatttcttgcttgtcagtcttttaccaaaactataatcatttttgtagtttggctcctttatgatccatgctctgtaagtcacaatgaatacataataatgctccttgaaaaaaaggaagaaatatacccttttttatttagaaaaaggccatttatattgatgacataacaaaagtttagttacaaatcccttttgttgcaccaaggtggtagaaagtaccagatcaaaggttctcctggtactggtgcttttgcaaaagtttacaaagccagtgtcgatggtaatacagaagacctggttgctttaaaggtgagtcatacttccatttgtcttactgaagcctgcttttttcatcagattcctctactgaacttgcccgtttgcagattcagaaaccaccatttccttgggaattttacatgtatcgccagcttgatacgcgcgtatctgatattgaggtacagaaattatctttaagaagaccataacatttgtaattgtaaaattatgattcacactgcaaaataattttacttccagagaccaagctttggctacactcatgaagtgcatgtatacgctgatgtcagtgtgcttgtttgtgattacctgccatacggaactcttctggtaaaatactttatgtattaatttttttttttgagatcatgatcatgcaaaactagcattttgtgcccggattagtgaatctgtgtttgataagatgcaaatcttttgcaggatgttataaattctcatctagtacttgaacgccatatggatgaagttctatgcatatattacactatagagatgctgcgcatgttggaaacactgcacagcgttggcataattcatggtgatttcaagcctgacaatatgcttgtttgctacccaaggtaagtagaggtaaccagcttagctttcaagttagaacacttgatggagcttcctccctcttcctcttgtgatctctaactgaaatatgggcaaaacacacacacacacacacacacacactctctctctctctctcacacagacacacacaaaactatccagtgaccattgacatcttacttttcataaaatcgacagatttattctagttgcaatatttgtgtgccgtccatttgcccagtgcccatattctcttgctatttgttttggacagatcttgttaccatgtttgtgggtgatgatgtctgtgctgtaaatattttactccaagcttcacaaccatctacaacttttataaactagatgttatatttaaactgatctaataacatagttttcaatgaaaatatttgacatggatggtcataacaacaagcatgttggtaagtggtcaatttgttggccccagatgttgggtttggtgggggcaaagatccttgctgatttactactgtttcaattactttatatgagcggttactggaatcttgcttgatggctccatcctccatgtttccgctgagatgacgattttttttgtcatttttgttggccatttgctgctattggcttgtttcggccaaaactcaattataacccatctagtacatgttacgcctgaaaaaaaaagaaagagtaaacctaatgctagtgtctgttcctttttgttctcgctatccaagtcttcacctcttcaatctttagcccttgtctcgacatgtaattttcgttcacccgcatctttgttttgcgtgtggtggtctgtgcagtggagaaatcacagacgaaaccttcaaaggcgagacaagatccgagcggaatcaggtcagcttctcaatcccaagttcccaacacgccgagaaacttggttaagatgttctggatatctcctgatgcttataggattcccattccaggggctctgccttgttgactggggccgtggcatcgacctgaacctcttcccatccggtgcggagttctacggcgactgccgaacctccgggttcagctgcgtcgagatgcaggaacagagagcctggacgtttcaggtatctgtaccctcccaagctacttactcaaaacctcctctcacctagacatctctgaaagcaacccctgcctgacgctgccagtttgtttgttggttggttgattggtttcttcctgcaggctgacacttacggcctctgcgtcatcgcgcacatgatgctacatgggacgcagatgagcatccagaagacgcccaggcccgatggaagctacatgtaccagcccacatcgccgttcaaaaggtgctttgatgccattgcctatacacctctttgataatttcctctatcccaaaatatagctactatgagatatttttcagtactatgaatctgaacaggtttagaaaatatctcatcctatgctagttagttatattttaagataaaggtagtagtaattaccatgattcgcagtagcgtaaataaatcagagattagattagatggcatatgtaacaggagctgtttgctgccattttgccccttgacaggtactggaacgtggagctgtggaaaaacctcttctccacgctgctcaacgcgacctccaacggcagcgacgcggccgtgctccggagcctccggatgtccttccaggagtacctgtgcagcaaccggcagctcgtcggcaagctgaaccagcaactggccaagcagaagacctccctgtgcctatcctgaccgagacatatacgcatctcgcgtttcatcctcatcatttttcccgattccctcgtgttgcctgtgtgtaaagtggtggagtataagataccttccgtaacttcgtagcacttcctctgtgcgtgcgtgtgcagcagtaattaacgtgccacatctccactttgaaagctgaaacatctactattgggccagatgg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066280.1 RefSeq:Os07g0508500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

Os07g0508500

2014-06-02T02:46:03Z

Yugee: /* References */ BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
1.BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis

==Structured Information==
{{JaponicaGene|
GeneName = Os07g0508500|
Description = Protein kinase-like domain containing protein|
Version = NM_001066280.1 GI:115472292 GeneID:4343342|
Length = 3152 bp|
Definition = Oryza sativa Japonica Group Os07g0508500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
AP = Chromosome 7:19988887..19992038|
CDS = 19988919..19988966,19989046..19989133,19989352..19989455,19989533..19989604,19989687..19989776 ,19989888..19990045,19990877..19990931,19991024..19991158,19991280..19991401 ,19991653..19991842|
GCID = <gbrowseImage1>
name=NC_008400:19988887..19992038
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008400:19988887..19992038
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgaataatttattggagaacattaatgttgatctgaagaagttcgctggctatcataagagcaataaggtctatcatggaaaggtgccattaacttcgcctcagaatgttttaagaaacaaagtcattgaattaggtggtagaaagtaccagatcaaaggttctcctggtactggtgcttttgcaaaagtttacaaagccagtgtcgatggtaatacagaagacctggttgctttaaagattcagaaaccaccatttccttgggaattttacatgtatcgccagcttgatacgcgcgtatctgatattgagagaccaagctttggctacactcatgaagtgcatgtatacgctgatgtcagtgtgcttgtttgtgattacctgccatacggaactcttctggatgttataaattctcatctagtacttgaacgccatatggatgaagttctatgcatatattacactatagagatgctgcgcatgttggaaacactgcacagcgttggcataattcatggtgatttcaagcctgacaatatgcttgtttgctacccaagtggagaaatcacagacgaaaccttcaaaggcgagacaagatccgagcggaatcaggggctctgccttgttgactggggccgtggcatcgacctgaacctcttcccatccggtgcggagttctacggcgactgccgaacctccgggttcagctgcgtcgagatgcaggaacagagagcctggacgtttcaggctgacacttacggcctctgcgtcatcgcgcacatgatgctacatgggacgcagatgagcatccagaagacgcccaggcccgatggaagctacatgtaccagcccacatcgccgttcaaaaggtactggaacgtggagctgtggaaaaacctcttctccacgctgctcaacgcgacctccaacggcagcgacgcggccgtgctccggagcctccggatgtccttccaggagtacctgtgcagcaaccggcagctcgtcggcaagctgaaccagcaactggccaagcagaagacctccctgtgcctatcctga</cdnaseq>|
AA = <aaseq>MNNLLENINVDLKKFAGYHKSNKVYHGKVPLTSPQNVLRNKVIE LGGRKYQIKGSPGTGAFAKVYKASVDGNTEDLVALKIQKPPFPWEFYMYRQLDTRVSD IERPSFGYTHEVHVYADVSVLVCDYLPYGTLLDVINSHLVLERHMDEVLCIYYTIEML RMLETLHSVGIIHGDFKPDNMLVCYPSGEITDETFKGETRSERNQGLCLVDWGRGIDL NLFPSGAEFYGDCRTSGFSCVEMQEQRAWTFQADTYGLCVIAHMMLHGTQMSIQKTPR PDGSYMYQPTSPFKRYWNVELWKNLFSTLLNATSNGSDAAVLRSLRMSFQEYLCSNRQ LVGKLNQQLAKQKTSLCLS</aaseq>|
DNA = <dnaseqindica>33..80#160..247#466..569#647..718#801..890#1002..1159#1991..2045#2138..2272#2394..2515#2767..2956#ctattttgctggatccatggtctgagtctactatgaataatttattggagaacattaatgttgatctgaagaagttcgctgtaagttgcatttactctatatgattcgctagtgtttatcttagctctcatcttggacggttgcccgaatccttgacagggctatcataagagcaataaggtctatcatggaaaggtgccattaacttcgcctcagaatgttttaagaaacaaagtcattgaattaggtataaactataatttcttgcttgtcagtcttttaccaaaactataatcatttttgtagtttggctcctttatgatccatgctctgtaagtcacaatgaatacataataatgctccttgaaaaaaaggaagaaatatacccttttttatttagaaaaaggccatttatattgatgacataacaaaagtttagttacaaatcccttttgttgcaccaaggtggtagaaagtaccagatcaaaggttctcctggtactggtgcttttgcaaaagtttacaaagccagtgtcgatggtaatacagaagacctggttgctttaaaggtgagtcatacttccatttgtcttactgaagcctgcttttttcatcagattcctctactgaacttgcccgtttgcagattcagaaaccaccatttccttgggaattttacatgtatcgccagcttgatacgcgcgtatctgatattgaggtacagaaattatctttaagaagaccataacatttgtaattgtaaaattatgattcacactgcaaaataattttacttccagagaccaagctttggctacactcatgaagtgcatgtatacgctgatgtcagtgtgcttgtttgtgattacctgccatacggaactcttctggtaaaatactttatgtattaatttttttttttgagatcatgatcatgcaaaactagcattttgtgcccggattagtgaatctgtgtttgataagatgcaaatcttttgcaggatgttataaattctcatctagtacttgaacgccatatggatgaagttctatgcatatattacactatagagatgctgcgcatgttggaaacactgcacagcgttggcataattcatggtgatttcaagcctgacaatatgcttgtttgctacccaaggtaagtagaggtaaccagcttagctttcaagttagaacacttgatggagcttcctccctcttcctcttgtgatctctaactgaaatatgggcaaaacacacacacacacacacacacacactctctctctctctctcacacagacacacacaaaactatccagtgaccattgacatcttacttttcataaaatcgacagatttattctagttgcaatatttgtgtgccgtccatttgcccagtgcccatattctcttgctatttgttttggacagatcttgttaccatgtttgtgggtgatgatgtctgtgctgtaaatattttactccaagcttcacaaccatctacaacttttataaactagatgttatatttaaactgatctaataacatagttttcaatgaaaatatttgacatggatggtcataacaacaagcatgttggtaagtggtcaatttgttggccccagatgttgggtttggtgggggcaaagatccttgctgatttactactgtttcaattactttatatgagcggttactggaatcttgcttgatggctccatcctccatgtttccgctgagatgacgattttttttgtcatttttgttggccatttgctgctattggcttgtttcggccaaaactcaattataacccatctagtacatgttacgcctgaaaaaaaaagaaagagtaaacctaatgctagtgtctgttcctttttgttctcgctatccaagtcttcacctcttcaatctttagcccttgtctcgacatgtaattttcgttcacccgcatctttgttttgcgtgtggtggtctgtgcagtggagaaatcacagacgaaaccttcaaaggcgagacaagatccgagcggaatcaggtcagcttctcaatcccaagttcccaacacgccgagaaacttggttaagatgttctggatatctcctgatgcttataggattcccattccaggggctctgccttgttgactggggccgtggcatcgacctgaacctcttcccatccggtgcggagttctacggcgactgccgaacctccgggttcagctgcgtcgagatgcaggaacagagagcctggacgtttcaggtatctgtaccctcccaagctacttactcaaaacctcctctcacctagacatctctgaaagcaacccctgcctgacgctgccagtttgtttgttggttggttgattggtttcttcctgcaggctgacacttacggcctctgcgtcatcgcgcacatgatgctacatgggacgcagatgagcatccagaagacgcccaggcccgatggaagctacatgtaccagcccacatcgccgttcaaaaggtgctttgatgccattgcctatacacctctttgataatttcctctatcccaaaatatagctactatgagatatttttcagtactatgaatctgaacaggtttagaaaatatctcatcctatgctagttagttatattttaagataaaggtagtagtaattaccatgattcgcagtagcgtaaataaatcagagattagattagatggcatatgtaacaggagctgtttgctgccattttgccccttgacaggtactggaacgtggagctgtggaaaaacctcttctccacgctgctcaacgcgacctccaacggcagcgacgcggccgtgctccggagcctccggatgtccttccaggagtacctgtgcagcaaccggcagctcgtcggcaagctgaaccagcaactggccaagcagaagacctccctgtgcctatcctgaccgagacatatacgcatctcgcgtttcatcctcatcatttttcccgattccctcgtgttgcctgtgtgtaaagtggtggagtataagataccttccgtaacttcgtagcacttcctctgtgcgtgcgtgtgcagcagtaattaacgtgccacatctccactttgaaagctgaaacatctactattgggccagatgg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066280.1 RefSeq:Os07g0508500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]

Os07g0508500

2014-06-02T02:43:51Z

Yugee: /* References */

Please input one-sentence summary here.

==Annotated Information==
===Function===
Please input function information here.

===Expression===
Please input expression information here.

===Evolution===
Please input evolution information here.

You can also add sub-section(s) at will.

==Labs working on this gene==
Please input related labs here.

==References==
Please input cited references here.
BRK1, a Bub1-Related Kinase, Is Essential for Generating Proper Tension between Homologous Kinetochores at Metaphase I of Rice Meiosis

==Structured Information==
{{JaponicaGene|
GeneName = Os07g0508500|
Description = Protein kinase-like domain containing protein|
Version = NM_001066280.1 GI:115472292 GeneID:4343342|
Length = 3152 bp|
Definition = Oryza sativa Japonica Group Os07g0508500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 7|Chromosome 7]]|
AP = Chromosome 7:19988887..19992038|
CDS = 19988919..19988966,19989046..19989133,19989352..19989455,19989533..19989604,19989687..19989776 ,19989888..19990045,19990877..19990931,19991024..19991158,19991280..19991401 ,19991653..19991842|
GCID = <gbrowseImage1>
name=NC_008400:19988887..19992038
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008400:19988887..19992038
source=RiceChromosome07
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgaataatttattggagaacattaatgttgatctgaagaagttcgctggctatcataagagcaataaggtctatcatggaaaggtgccattaacttcgcctcagaatgttttaagaaacaaagtcattgaattaggtggtagaaagtaccagatcaaaggttctcctggtactggtgcttttgcaaaagtttacaaagccagtgtcgatggtaatacagaagacctggttgctttaaagattcagaaaccaccatttccttgggaattttacatgtatcgccagcttgatacgcgcgtatctgatattgagagaccaagctttggctacactcatgaagtgcatgtatacgctgatgtcagtgtgcttgtttgtgattacctgccatacggaactcttctggatgttataaattctcatctagtacttgaacgccatatggatgaagttctatgcatatattacactatagagatgctgcgcatgttggaaacactgcacagcgttggcataattcatggtgatttcaagcctgacaatatgcttgtttgctacccaagtggagaaatcacagacgaaaccttcaaaggcgagacaagatccgagcggaatcaggggctctgccttgttgactggggccgtggcatcgacctgaacctcttcccatccggtgcggagttctacggcgactgccgaacctccgggttcagctgcgtcgagatgcaggaacagagagcctggacgtttcaggctgacacttacggcctctgcgtcatcgcgcacatgatgctacatgggacgcagatgagcatccagaagacgcccaggcccgatggaagctacatgtaccagcccacatcgccgttcaaaaggtactggaacgtggagctgtggaaaaacctcttctccacgctgctcaacgcgacctccaacggcagcgacgcggccgtgctccggagcctccggatgtccttccaggagtacctgtgcagcaaccggcagctcgtcggcaagctgaaccagcaactggccaagcagaagacctccctgtgcctatcctga</cdnaseq>|
AA = <aaseq>MNNLLENINVDLKKFAGYHKSNKVYHGKVPLTSPQNVLRNKVIE LGGRKYQIKGSPGTGAFAKVYKASVDGNTEDLVALKIQKPPFPWEFYMYRQLDTRVSD IERPSFGYTHEVHVYADVSVLVCDYLPYGTLLDVINSHLVLERHMDEVLCIYYTIEML RMLETLHSVGIIHGDFKPDNMLVCYPSGEITDETFKGETRSERNQGLCLVDWGRGIDL NLFPSGAEFYGDCRTSGFSCVEMQEQRAWTFQADTYGLCVIAHMMLHGTQMSIQKTPR PDGSYMYQPTSPFKRYWNVELWKNLFSTLLNATSNGSDAAVLRSLRMSFQEYLCSNRQ LVGKLNQQLAKQKTSLCLS</aaseq>|
DNA = <dnaseqindica>33..80#160..247#466..569#647..718#801..890#1002..1159#1991..2045#2138..2272#2394..2515#2767..2956#ctattttgctggatccatggtctgagtctactatgaataatttattggagaacattaatgttgatctgaagaagttcgctgtaagttgcatttactctatatgattcgctagtgtttatcttagctctcatcttggacggttgcccgaatccttgacagggctatcataagagcaataaggtctatcatggaaaggtgccattaacttcgcctcagaatgttttaagaaacaaagtcattgaattaggtataaactataatttcttgcttgtcagtcttttaccaaaactataatcatttttgtagtttggctcctttatgatccatgctctgtaagtcacaatgaatacataataatgctccttgaaaaaaaggaagaaatatacccttttttatttagaaaaaggccatttatattgatgacataacaaaagtttagttacaaatcccttttgttgcaccaaggtggtagaaagtaccagatcaaaggttctcctggtactggtgcttttgcaaaagtttacaaagccagtgtcgatggtaatacagaagacctggttgctttaaaggtgagtcatacttccatttgtcttactgaagcctgcttttttcatcagattcctctactgaacttgcccgtttgcagattcagaaaccaccatttccttgggaattttacatgtatcgccagcttgatacgcgcgtatctgatattgaggtacagaaattatctttaagaagaccataacatttgtaattgtaaaattatgattcacactgcaaaataattttacttccagagaccaagctttggctacactcatgaagtgcatgtatacgctgatgtcagtgtgcttgtttgtgattacctgccatacggaactcttctggtaaaatactttatgtattaatttttttttttgagatcatgatcatgcaaaactagcattttgtgcccggattagtgaatctgtgtttgataagatgcaaatcttttgcaggatgttataaattctcatctagtacttgaacgccatatggatgaagttctatgcatatattacactatagagatgctgcgcatgttggaaacactgcacagcgttggcataattcatggtgatttcaagcctgacaatatgcttgtttgctacccaaggtaagtagaggtaaccagcttagctttcaagttagaacacttgatggagcttcctccctcttcctcttgtgatctctaactgaaatatgggcaaaacacacacacacacacacacacacactctctctctctctctcacacagacacacacaaaactatccagtgaccattgacatcttacttttcataaaatcgacagatttattctagttgcaatatttgtgtgccgtccatttgcccagtgcccatattctcttgctatttgttttggacagatcttgttaccatgtttgtgggtgatgatgtctgtgctgtaaatattttactccaagcttcacaaccatctacaacttttataaactagatgttatatttaaactgatctaataacatagttttcaatgaaaatatttgacatggatggtcataacaacaagcatgttggtaagtggtcaatttgttggccccagatgttgggtttggtgggggcaaagatccttgctgatttactactgtttcaattactttatatgagcggttactggaatcttgcttgatggctccatcctccatgtttccgctgagatgacgattttttttgtcatttttgttggccatttgctgctattggcttgtttcggccaaaactcaattataacccatctagtacatgttacgcctgaaaaaaaaagaaagagtaaacctaatgctagtgtctgttcctttttgttctcgctatccaagtcttcacctcttcaatctttagcccttgtctcgacatgtaattttcgttcacccgcatctttgttttgcgtgtggtggtctgtgcagtggagaaatcacagacgaaaccttcaaaggcgagacaagatccgagcggaatcaggtcagcttctcaatcccaagttcccaacacgccgagaaacttggttaagatgttctggatatctcctgatgcttataggattcccattccaggggctctgccttgttgactggggccgtggcatcgacctgaacctcttcccatccggtgcggagttctacggcgactgccgaacctccgggttcagctgcgtcgagatgcaggaacagagagcctggacgtttcaggtatctgtaccctcccaagctacttactcaaaacctcctctcacctagacatctctgaaagcaacccctgcctgacgctgccagtttgtttgttggttggttgattggtttcttcctgcaggctgacacttacggcctctgcgtcatcgcgcacatgatgctacatgggacgcagatgagcatccagaagacgcccaggcccgatggaagctacatgtaccagcccacatcgccgttcaaaaggtgctttgatgccattgcctatacacctctttgataatttcctctatcccaaaatatagctactatgagatatttttcagtactatgaatctgaacaggtttagaaaatatctcatcctatgctagttagttatattttaagataaaggtagtagtaattaccatgattcgcagtagcgtaaataaatcagagattagattagatggcatatgtaacaggagctgtttgctgccattttgccccttgacaggtactggaacgtggagctgtggaaaaacctcttctccacgctgctcaacgcgacctccaacggcagcgacgcggccgtgctccggagcctccggatgtccttccaggagtacctgtgcagcaaccggcagctcgtcggcaagctgaaccagcaactggccaagcagaagacctccctgtgcctatcctgaccgagacatatacgcatctcgcgtttcatcctcatcatttttcccgattccctcgtgttgcctgtgtgtaaagtggtggagtataagataccttccgtaacttcgtagcacttcctctgtgcgtgcgtgtgcagcagtaattaacgtgccacatctccactttgaaagctgaaacatctactattgggccagatgg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001066280.1 RefSeq:Os07g0508500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 7]]
[[Category:Chromosome 7]]