Atp9 - Revision history

192.168.72.52 at 05:34, 15 May 2015

2015-05-15T05:34:02Z

Tangdanwiki at 07:49, 9 June 2014

2014-06-09T07:49:09Z

Tangdanwiki: /* References */

2014-06-09T07:02:13Z

‎References

Tangdanwiki at 07:01, 9 June 2014

2014-06-09T07:01:44Z

Tangdanwiki at 06:59, 9 June 2014

2014-06-09T06:59:29Z

Tangdanwiki: /* References */

2014-06-08T06:49:22Z

‎References

Tangdanwiki: /* Knowledge extension */

2014-06-08T06:48:37Z

‎Knowledge extension

Tangdanwiki: /* References */

2014-06-08T06:47:28Z

‎References

Tangdanwiki: /* Labs working on this gene */

2014-06-08T06:42:32Z

‎Labs working on this gene

Tangdanwiki: /* Labs working on this gene */

2014-06-08T06:41:04Z

‎Labs working on this gene

@@ Line 1: / Line 1: @@
-The rice '''''atp9''''' sequence was first reported by Grabau et al. (1990) in soybean mitochondria.This gene encodes an extremely hydrophobic protein that, when relocated, is particularly challenging to import into mitochondria. <ref name="ref1" /><ref name="ref3" />.
+Please input one-sentence summary here.
 ==Annotated Information==
 ===Function===
-atp9 gene, which encodes ATPase subunit 9, is an important functional gene in mitochondria, and is closely related with energy supply.RNA editing of atp9 gene was associated with male sterility in plants<ref name="ref2" />.
+Please input function information here.
 ===Expression===
-When performing the partial protein sequencing of the mitochondrial subunit 9 of ATP synthase (ATP 9), some residues differ from those encoded for by the mitochondrial atp9 gene. The differences are explained by assuming C-to-U transitions at the mRNA level. Thus, mRNA modifications by RNA editing are reflected at the translational level <ref name="ref4" />.
+Please input expression information here.
 ===Evolution===
-The three atp9 transcripts and positions of RNA editing were not identical. However, the deduced peptide sequences were identical, indicating conservation of the amino acid sequence. And in their study, peptide sequences encoded by fully, partially and excessively edited clones were deduced to be the same <ref name="ref7" />. Thus, the rice mitochondrial ATP9 polypeptide seems to be highly homogeneous and RNA editing might be necessary for production of the functional ATP9 peptide.
+Please input evolution information here.
-===Knowledge extension===
+You can also add sub-section(s) at will.
 ==Labs working on this gene==
-*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France
+Please input related labs here.
 ==References==
-<references>
+Please input cited references here.
 ==Structured Information==
-{{Mitochondrion|
+     [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Mitochondrion]]

← Older revision		Revision as of 07:49, 9 June 2014
Line 48:		Line 48:

	==Structured Information==		==Structured Information==
		+	{{Mitochondrion\|
		+	GeneName = atp9\|
		+	Description = ATP synthase F0 subunit 9\|
		+	Version = GeneID:6450130\|
		+	Length = 255 bp\|
		+	Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.\|
		+	Source = Oryza sativa Japonica Group
		+
		+	ORGANISM Oryza sativa Japonica Group
		+	Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
		+	Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
		+	clade; Ehrhartoideae; Oryzeae; Oryza.
		+	\|
		+	Chromosome = [[:category:Japonica Mitochondrion\|Mitochondrion]]\|
		+	AP = Mitochondrion:263141..263365\|
		+	CDS = 263141..263365\|
		+	AA = <aaseq>MLEGAKLIGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEAIALFALMMAFLILFVF</aaseq>\|
		+	DNA = <dnaseqindica>1..225#atgttagaaggagctaaatcaataggtgccggagctgctacaattgctttagcgggagctgctgtcggtattggaaacgtcctcagttcttcgattcattccgtggcgcgaaatccttcattggctaaacaattatttggttatgccattttgggctttgctctcaccgaagctattgcattgtttgccccaatgatggcctttctgatttcattcgttttccga</dnaseqindica>\|
		+	Link = [http://www.ncbi.nlm.nih.gov/gene?term=6450130 NCBI Gene:atp6]
		+	}}
		+	[[Category:Genes]]
		+	[[Category:Japonica mRNA]]
		+	[[Category:Oryza Sativa Japonica Group]]
		+	[[Category:Japonica Genes]]
		+	[[Category:Japonica Mitochondrion]]
		+	[[Category:Mitochondrion]]

← Older revision		Revision as of 07:02, 9 June 2014
Line 46:		Line 46:
	<ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>		<ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>
	<ref name="ref14">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>		<ref name="ref14">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>
		+
		+	==Structured Information==

← Older revision		Revision as of 07:01, 9 June 2014
Line 46:		Line 46:
	<ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>		<ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>
	<ref name="ref14">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>		<ref name="ref14">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>
−
−	~~==Structured Information==~~

← Older revision		Revision as of 06:59, 9 June 2014
Line 46:		Line 46:
	<ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>		<ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>
	<ref name="ref14">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>		<ref name="ref14">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>
		+
		+	==Structured Information==

@@ Line 45: / Line 45: @@
 <ref name="ref12">Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.</ref>
 <ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>
-<ref name="ref15">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>
+<ref name="ref14">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>

@@ Line 17: / Line 17: @@
 ===Knowledge extension===
-RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria [9] and the addition of guanosine residues on paramyxovirus RNA [10]. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes [11]. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians <ref name="ref12" />. The mechanism by which the C-to-U changes occur is unknown.
+RNA editing is a biological phenomenon consisting of the modificationof the genetic message leadingto the creation of new codons or to the alteration of reading frames. Severa1 mechanisms have been described such as the addition/deletion of uridine residues in trypanosome mitochondria <ref name="ref9" /> and the addition of guanosine residues on paramyxovirus RNA <ref name="ref10" />. In the case of higher plant mitochondria, RNA editing is found in several species and has been described for several protein coding genes <ref name="ref11" />. The post-transcriptionalmodifications, observed by RNA or cDNA sequence analysis, occur mainly by C-to-U transitions, similar to the situation described for apolipoprotein B in mammalians <ref name="ref12" />. The mechanism by which the C-to-U changes occur is unknown.
 Cytoplasmic male sterility (CMS) is a maternally inherited inability of a plant to produce functional pollen. Sterility-inducing cytoplasms have been identified in over 150 plant species <ref name="ref13" />. The action of specific nuclear genes can suppress the cytoplasmic dysfunction and restore fertility. For several plant species CMS-associated DNA sequences have been identified <ref name="ref14" />. They are located in the mitochondrial genome and often contain chimeric open reading frames (ORFs).

@@ Line 35: / Line 35: @@
 Maı¨lis Bietenhader1,2, Alexandre Martos1,2 Experimental Relocation of the MitochondrialATP9Gene to the Nucleus Reveals Forces Underlying Mitochondrial
 Genome Evolution PLOS Genetics August 2012</ref>
-== Structured Information ==
+<ref name="ref4">Graves PV, Bégu D, Velours J, Neau E, Belloc F, Litvak S, Araya A (1990). Direct protein sequencing of wheat mitochondrial ATP-synthasesubunit 9 confirms RNA editing in plants. J. MOI.Biol. 214: 1-6.</ref>
-{{Mitochondrion|
+<ref name="ref5">Dominique B, Pierre VG, Christine D, Geneviève A, Simon L, Alejandro A (1990) RNA Editing of Wheat Mitochondrial ATP Synthase Subunit 9: Direct Protein and cDNA Sequencing. The Plant Cell 2: 1283-1290.</ref>
-GeneName = atp9|
+<ref name="ref6">Edward K, Kaleikau, Charles P, André, Virginia W (1993) Transcription of the gene coding for subunit 9 of ATP synthase in rice. Plant Molecular Biology 22: 899-905.</ref>
-Description = ATP synthase F0 subunit 9|
+<ref name="ref7">Ishikawa M, Kadowaki KI (1993) Excess RNA editing in Rice mitochondrial atp9 transcripts. Plant Cell Physiol 34(6):959–963.</ref>
-Version = GeneID:6450130|
+<ref name="ref8">Edward K, Kaleikau, Charles P, Andre, Virginia W (1990) Sequence of the Fo-atpase proteolipid (atp9) gene from rice mitochondria. Nucleic Acids Research 18: 370.</ref>
-Length = 225 bp|
+<ref name="ref9">Simpson L, Shaw J (1989) RNA editing and the mitochondrial cryptogenes of kinetoplastid protozoa. Cell 57: 355-366.</ref>
-Definition = Oryza sativa Japonica Group ''atp9'', Mitochondrion gene.|
+<ref name="ref10">Cattaneo R, Kaelin K, Baczko K, Billeter MA (1989) Measles virus editing provides an additional cysteine-rich protein. Cell 56： 759-764.</ref>
-Source = Oryza sativa Japonica Group
+<ref name="ref11">Covello PS, Gray MW (1989) RNA editing in wheat mitochondria.Nature 341: 662-666.</ref>
+<ref name="ref12">Higuchi K, Hospattankar AV, Law SW, Meglin N, Cortright J, Brewer B, Jr (1988) Human apolipoprotein B (apoB) mRNA: ldentificationof two distinct apoB mRNAs, an mRNA with the apoB-1O0 sequence and an apoB mRNA containing a premature in frame translational stop codon in both liver and intestine. Proc. Natl. Acad. Sci. USA 85: 1772-1776.</ref>
-  ORGANISM  Oryza sativa Japonica Group
+<ref name="ref13">Mackenzie S, He S, Lyznik A (1994) The elusive plant mitochondrion as a genetic system. Plant Physiol 105: 775-780.</ref>
-            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
+<ref name="ref15">Schnable PS, Wise RP (1998) The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 3: 175-180</ref>

@@ Line 21: / Line 21: @@
 ==Labs working on this gene==
-Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France
+*Laboratoire de Biologie Mol6culaire Vdgetale, Institut de Biochimie Cellulaire et Neurochimie-Centre National de la Recherche Scientifique, 1 rue Camille Saint Sacns, 33077 Bordeaux, France
-Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland
+*Department of Genetics, Plant Breeding and Seed Science, Cracow Agricultural University, Al. 29-go Listopada 54, 31-425 Cracow, Poland
-Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland
+*Department of Plant Molecular Biology, Miedzychodzka 5,60-371 Poznan, Poland
-Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany
+*Institute of Biology (Genetics), Humboldt University, Chausseestr. 117, D-10115 Berlin, Germany
-Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA
+*Department of Biological Sciences, Stanford University, Stanford, CA 94305-5020, USA
-Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton
+*Department of Biochemistry, and Centre for Molecular Biology and Medicine, Monash University, Clayton
 ==References==