Os01g0102300 - Revision history

Xysj2017: /* Annotated Information */

2017-02-14T15:32:49Z

‎Annotated Information

Xysj2017 at 15:32, 14 February 2017

2017-02-14T15:32:40Z

Xysj2017: /* Function */

2017-02-14T15:32:18Z

‎Function

Xysj2017 at 15:31, 14 February 2017

2017-02-14T15:31:28Z

192.168.72.52 at 04:28, 14 May 2015

2015-05-14T04:28:10Z

Happyharry: /* References */

2014-06-07T10:26:51Z

‎References

Happyharry: /* Expression */

2014-06-07T10:26:00Z

‎Expression

Happyharry: /* Function */

2014-06-07T10:25:46Z

‎Function

Happyharry: /* Function */

2014-06-07T10:24:51Z

‎Function

124.16.129.48 at 18:42, 22 July 2012

2012-07-22T18:42:25Z

@@ Line 2: / Line 2: @@
 ==Annotated Information==
-[[File:227-Os01g0102300.png|right|thumb|727px|'''Figure 4.''' ''Chloroplast targeting of the OsTLP27–GFP fusion protein in tobacco (N. benthamiana) leaf mesophyll protoplasts.<ref name="ref1" />.'']]
+[[File:227-Os01g0102300.png|right|thumb|527px|'''Figure 4.''' ''Chloroplast targeting of the OsTLP27–GFP fusion protein in tobacco (N. benthamiana) leaf mesophyll protoplasts.<ref name="ref1" />.'']]
 ===Gene Symbol===
 *'''''Os01g0102300''''' '''<=>''' '''''OsTLP27,TLP27'''''

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Gene Symbol===
 *'''''Os01g0102300''''' '''<=>''' '''''OsTLP27,TLP27'''''
 ===Function===
 * The rice gene '''''OsTLP27'''''  encodes a 27-kDa of 257-amino acid with 53% homology to the AtTLP gene from Arabidopsis thaliana.

@@ Line 6: / Line 6: @@
 ===Function===
-[[File:227-Os01g0102300.png|right|thumb|427px|'''Figure 4.''' ''Chloroplast targeting of the OsTLP27–GFP fusion protein in tobacco (N. benthamiana) leaf mesophyll protoplasts.<ref name="ref1" />.'']]
+[[File:227-Os01g0102300.png|right|thumb|527px|'''Figure 4.''' ''Chloroplast targeting of the OsTLP27–GFP fusion protein in tobacco (N. benthamiana) leaf mesophyll protoplasts.<ref name="ref1" />.'']]
 * The rice gene '''''OsTLP27'''''  encodes a 27-kDa of 257-amino acid with 53% homology to the AtTLP gene from Arabidopsis thaliana.

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os01g0102300''''' was reported as '''''OsTLP27''''' in 2012 <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
 ===Function===
-The thylakoid lumen proteins are highly associated with photosynthesis functionally.
+[[File:227-Os01g0102300.png|right|thumb|427px|'''Figure 4.''' ''Chloroplast targeting of the OsTLP27–GFP fusion protein in tobacco (N. benthamiana) leaf mesophyll protoplasts.<ref name="ref1" />.'']]
 ===Expression===
-OsTLP27 was predicted to encode a thylakoid lumen protein of unknown function in chloroplast, and chloroplast targeting of OsTLP27 was confirmed by transient expression of a fusion protein with green fluorescent protein (GFP). OsTLP27 transcripts accumulated specifically in green tissues such as the leaf blade and leaf sheath, and the levels of its transcripts followed a circadian rhythm. Constitutive expression of OsTLP27 under the control of CaMV 35S promoter resulted in increased pigment content and enhanced photochemical efficiency in terms of the values of maximal photochemical efficiency of photosystem II (PSII) (Fv/Fm), effective quantum yield of PSII (ΦPSII), electron transport rate (ETR) and photochemical quenching (qP). Overexpression of OsTLP27 also enhanced transcript levels of genes related to chloroplast function and caused changes in the grana size and number. Further study showed that the structure and polypeptide composition of the photosynthetic apparatus were altered in transgenic lines overexpressing OsTLP27. These data suggested that OsTLP27 encodes a protein with a novel function in photosynthesis and chloroplast development in rice.
+* '''''OsTLP27''''' transcripts accumulated specifically in green tissues such as the leaf blade and leaf sheath, and the levels of its transcripts followed a circadian rhythm.
-===Evolution===
+===Subcellular localization===
-Please input evolution information here.
+* '''''OsTLP27''''' was localized in chloroplasts of rice leaf
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* College of Biological Engineering, Chongqing University, Chongqing 400030, China
 ==References==
-. Feng Hu;Zhenhui Kang;Shichun Qiu;Ying Wang;Feng Qin;Caili Yue;Junli Huang;Guixue Wang
+<references>
-  Overexpression of OsTLP27 in rice improves chloroplast function and photochemical efficiency
+* <ref name="ref1">
-  Plant Science, 2012, 195: 125-134
+Hu F, Kang Z, Qiu S, Wang Y, Qin F, Yue C, Huang J, Wang G. Overexpression of
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]

← Older revision		Revision as of 04:28, 14 May 2015
Line 22:		Line 22:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0102300\|~~
−	~~Description = Conserved hypothetical protein\|~~
−	~~Version = NM_001048282.1 GI:115433977 GeneID:4326466\|~~
−	~~Length = 1140 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0102300, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:133300..134439\|~~
−	~~CDS = 133311..133615,133698..133824,133912..134253\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:133300..134439~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:133300..134439~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgacgtcatcattatcatcatccacagcctctgctgctgcttgttgcaagagtagaagtcgtaatcctcctccggcgccggcgccacacactagtactgcacgagtagttcgcagcagcaggcggaggcttctcttagtattcttctccgcagaggcggcggcggctgcgacgagcggtctcatccagaccccgtgtgggcaagcctaccctttcgctggcaccaacgtgaagaagccgcagccgccgtccaccccttactcccaatcccaatcgcagcagcagtttggcctcgacgccaaagggaggattagggcgtgcccgtcgacgaaccccggatgcgtgtccacaaaccccacggtgggcgcatcttgctccttggcctccccgctcatcgtccccgctaatacaccaacggacaaggccgccgcttcgctgcgcgaggctatcctcaagacgcagaggaatgcggtgatcaaagccgacgaggagacggcgtacgggcactacatccaggcggaggtcgacggcggcgcaggccgcgacgtgatggagttcctcctcaaggaatcccagtcccagtcccaggaggtggtggccgcgtaccgatgcgtcgccaccaaggtcatcttcgtctaccccttcaccactgccgtcggcgattcaagagggcagagccagaggatcgccgccgtcgcccaggagctcggatggtacgccccggacctactcaacgccgccaccgccgacgaccactctatcctcgactattaa</cdnaseq>\|
−	AA = <aaseq>MTSSLSSSTASAAACCKSRSRNPPPAPAPHTSTARVVRSSRRRL LLVFFSAEAAAAATSGLIQTPCGQAYPFAGTNVKKPQPPSTPYSQSQSQQQFGLDAKG RIRACPSTNPGCVSTNPTVGASCSLASPLIVPANTPTDKAAASLREAILKTQRNAVIK ADEETAYGHYIQAEVDGGAGRDVMEFLLKESQSQSQEVVAAYRCVATKVIFVYPFTTA VGDSRGQSQRIAAVAQELGWYAPDLLNAATADDHSILDY</aaseq>\|
−	DNA = <dnaseqindica>12..316#399..525#613..954#gtacgtttgtaatgacgtcatcattatcatcatccacagcctctgctgctgcttgttgcaagagtagaagtcgtaatcctcctccggcgccggcgccacacactagtactgcacgagtagttcgcagcagcaggcggaggcttctcttagtattcttctccgcagaggcggcggcggctgcgacgagcggtctcatccagaccccgtgtgggcaagcctaccctttcgctggcaccaacgtgaagaagccgcagccgccgtccaccccttactcccaatcccaatcgcagcagcagtttggcctcgacgccaaagggtaattaactaaaccggccgccacagatctggatggatcgatcttaaaattaagaaagagattatatatattatggatgcaggaggattagggcgtgcccgtcgacgaaccccggatgcgtgtccacaaaccccacggtgggcgcatcttgctccttggcctccccgctcatcgtccccgctaatacaccaacggacaaggccgccgctgtaagtgtacgcacgcacgcatttgttattcatttaatatagcagtatttgtttctgaattagtaattcgatgtgaatgaatgacagtcgctgcgcgaggctatcctcaagacgcagaggaatgcggtgatcaaagccgacgaggagacggcgtacgggcactacatccaggcggaggtcgacggcggcgcaggccgcgacgtgatggagttcctcctcaaggaatcccagtcccagtcccaggaggtggtggccgcgtaccgatgcgtcgccaccaaggtcatcttcgtctaccccttcaccactgccgtcggcgattcaagagggcagagccagaggatcgccgccgtcgcccaggagctcggatggtacgccccggacctactcaacgccgccaccgccgacgaccactctatcctcgactattaaccaaggccatacatatgcttgcttcattatctctagtctgtacaagtacaactcgtccaaattcattcatccatccatccatccacgacacatatacaaatactaatctattattactactaagtagtactagtagccaccgatatatatacacaacaaatgtattaatcaaaatgctaatttatt</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048282.1 RefSeq:Os01g0102300]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

← Older revision		Revision as of 18:42, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os01g0102300\|		GeneName = Os01g0102300\|