Os01g0136200 - Revision history

Xysj2017 at 14:41, 14 February 2017

2017-02-14T14:41:49Z

192.168.72.52 at 04:31, 14 May 2015

2015-05-14T04:31:26Z

Xysj2012: /* Structured Information */

2015-05-13T06:53:43Z

‎Structured Information

Zhangye at 07:09, 4 February 2015

2015-02-04T07:09:54Z

124.16.129.48 at 18:43, 22 July 2012

2012-07-22T18:43:55Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os01g0136200| Description = 16.9 kDa class I heat shock protein| Version = NM_001048490.1 GI:115434393 GeneID:4325698| Length = 752 bp| Definit..."

2012-06-25T04:20:13Z

Created page with "{{JaponicaGene| GeneName = Os01g0136200| Description = 16.9 kDa class I heat shock protein| Version = NM_001048490.1 GI:115434393 GeneID:4325698| Length = 752 bp| Definit..."

New page

{{JaponicaGene|
GeneName = Os01g0136200|
Description = 16.9 kDa class I heat shock protein|
Version = NM_001048490.1 GI:115434393 GeneID:4325698|
Length = 752 bp|
Definition = Oryza sativa Japonica Group Os01g0136200, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:1950930..1951681|
CDS = 1951047..1951499|
GCID = <gbrowseImage1>
name=NC_008394:1950930..1951681
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:1950930..1951681
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgtcgctggtgaggcgcagcaacgtgttcgaccccttctccctcgacctctgggaccccttcgacagcgtgttccgctccgtcgtcccggccacctccgacaacgacaccgccgccttcgccaacgcccgcatcgactggaaggagacgccggagtcgcacgtcttcaaggccgacctccccggcgtcaagaaggaggaggtgaaggtggaggtggaggaaggcaacgtgctggtgatcagcggccagcgcagcaaggagaaggaggacaagaacgacaagtggcaccgcgtggagcgcagcagcgggcagttcatgcggcggttccggctgccggagaacgccaaggtggaccaggtgaaggccggcatggagaacggcgtgctcaccgtcaccgtgcccaaggccgaggtcaagaagcccgaggtgaaggccattgagatctctggctaa</cdnaseq>|
AA = <aaseq>MSLVRRSNVFDPFSLDLWDPFDSVFRSVVPATSDNDTAAFANAR IDWKETPESHVFKADLPGVKKEEVKVEVEEGNVLVISGQRSKEKEDKNDKWHRVERSS GQFMRRFRLPENAKVDQVKAGMENGVLTVTVPKAEVKKPEVKAIEISG</aaseq>|
DNA = <dnaseqindica>118..570#attcaaggcagagctagtagtggtcacatcgccaattcacagtcgaatcaagcaaaccatccaaatcacacccaactcttcttcttcccatcctccagagatccaagcagcttagccatgtcgctggtgaggcgcagcaacgtgttcgaccccttctccctcgacctctgggaccccttcgacagcgtgttccgctccgtcgtcccggccacctccgacaacgacaccgccgccttcgccaacgcccgcatcgactggaaggagacgccggagtcgcacgtcttcaaggccgacctccccggcgtcaagaaggaggaggtgaaggtggaggtggaggaaggcaacgtgctggtgatcagcggccagcgcagcaaggagaaggaggacaagaacgacaagtggcaccgcgtggagcgcagcagcgggcagttcatgcggcggttccggctgccggagaacgccaaggtggaccaggtgaaggccggcatggagaacggcgtgctcaccgtcaccgtgcccaaggccgaggtcaagaagcccgaggtgaaggccattgagatctctggctaaaatggtgaaaacgggagtttgtcaaggtcaaggcgtgtcatgcatgttcactctgaactgtttgcggtgtttcactcgggtttgatggtttttactagtcctatgaactgtgtattcttttgtactctgttgtgagcgcgtttgcacgaagcaataaataaaaataaaatcagcttgtttgt</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048490.1 RefSeq:Os01g0136200]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-''OsHsp17.0'' and [[Os12g0569700|''OsHsp23.7'']] play an important role in rice acclimation to salt and drought stresses and are useful for '''engineering drought and salt tolerance rice'''. Heat shock proteins (Hsps) play an important role in plant stress tolerance<ref name="ref1"/>.
+* ''OsHsp17.0'' and [[Os12g0569700|''OsHsp23.7'']] play an important role in rice acclimation to salt and drought stresses and are useful for '''engineering drought and salt tolerance rice'''. Heat shock proteins (Hsps) play an important role in plant stress tolerance<ref name="ref1"/>.
-The transcripts of ''OsHSP80.2'', ''OsHSP74.8'', ''OsHSP26.7'' and ''OsHSP17.0'' were increased rapidly and kept at constantly high levels during the heat stress<ref name="ref2"/>.
+* The transcripts of ''OsHSP80.2'', ''OsHSP74.8'', ''OsHSP26.7'' and ''OsHSP17.0'' were increased rapidly and kept at constantly high levels during the heat stress<ref name="ref2"/>.
 ===Mutation===

@@ Line 37: / Line 37: @@
 HSPs, o40 kDa)<ref name="ref4"/>. Most HSPs function as molecular chaperones in maintaining homeostasis of protein folding and are thought to be responsible for the acquisition of thermo tolerance<ref name="ref3"/>. It is believed that the accumulations of HSPs play a pivotal role in abiotic stress.
-==Labs working on this gene==
+==Structured Information==
-*Hunan Provincial Key Laboratory for Germplasm Innovation and Utilization of Crop, Hunan Agricultural University, Changsha 410128, China
+     [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
 ==References==

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+'''''OsHsp17.0''''' is a member of Heat shock proteins('''Hsps'''), it belongs to '''sHSP family'''<ref name="ref1"/><ref name="ref2"/>.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+''OsHsp17.0'' and [[Os12g0569700|''OsHsp23.7'']] play an important role in rice acclimation to salt and drought stresses and are useful for '''engineering drought and salt tolerance rice'''. Heat shock proteins (Hsps) play an important role in plant stress tolerance<ref name="ref1"/>.
 ===Expression===
-Please input expression information here.
+[[File: nine OsHSP genes.jpg|right|thumb|300px|'''Figure 1.'''''Gene tree of the nine rice HSPs(from reference <ref name="ref2"/>).'']]
 ===Evolution===
-Please input evolution information here.
+Gene tree were conducted using the software Molecular Evolutionary Genetics Analysis (MEGA) Version 4.0 by the neighbor-joining method with pairwise deletion and the Poisson correction model. As shown in Figure 1, based on amino acids sequence homology, nine OsHSP genes were divided into three classes, among them ''OsHSP80.2'', ''OsHSP74.8'' and ''OsHSP50.2'' belong to ''HSP90'' family; ''OsHSP71.1'', ''OsHSP58.7'' and ''OsHSP23.7'' belong to ''HSP70'' family; ''OsHSP26.7'', ''OsHSP24.1'' and ''OsHSP17.0'' belong to '''sHSP family'''<ref name="ref2"/>.
-You can also add sub-section(s) at will.
+===Knowledge Extension===
 ==Labs working on this gene==
-Please input related labs here.
+*Hunan Provincial Key Laboratory for Germplasm Innovation and Utilization of Crop, Hunan Agricultural University, Changsha 410128, China
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==

← Older revision		Revision as of 18:43, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os01g0136200\|		GeneName = Os01g0136200\|

@@ Line 58: / Line 58: @@
 </references>
 [[Category:Genes]]
 [[Category:Japonica mRNA]]