Os01g0159600 - Revision history

192.168.72.52 at 04:33, 14 May 2015

2015-05-14T04:33:28Z

Xuemin318: Proteins abundant in seeds during the late stages of development, late embryogenesis abundant (LEA) proteins, are associated with desiccation tolerance.

2014-06-06T05:19:23Z

Proteins abundant in seeds during the late stages of development, late embryogenesis abundant (LEA) proteins, are associated with desiccation tolerance.

Xuemin318: Proteins abundant in seeds during the late stages of development, late embryogenesis abundant (LEA) proteins, are associated with desiccation tolerance.

2014-06-06T05:08:59Z

Proteins abundant in seeds during the late stages of development, late embryogenesis abundant (LEA) proteins, are associated with desiccation tolerance.

Xuemin318 at 15:40, 5 June 2014

2014-06-05T15:40:57Z

Xuemin318 at 15:34, 5 June 2014

2014-06-05T15:34:36Z

124.16.129.48 at 18:44, 22 July 2012

2012-07-22T18:44:43Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os01g0159600| Description = Small hydrophilic plant seed protein family protein| Version = NM_001048621.2 GI:297596143 GeneID:4324064| Length = ..."

2012-06-25T04:22:45Z

Created page with "{{JaponicaGene| GeneName = Os01g0159600| Description = Small hydrophilic plant seed protein family protein| Version = NM_001048621.2 GI:297596143 GeneID:4324064| Length = ..."

New page

{{JaponicaGene|
GeneName = Os01g0159600|
Description = Small hydrophilic plant seed protein family protein|
Version = NM_001048621.2 GI:297596143 GeneID:4324064|
Length = 975 bp|
Definition = Oryza sativa Japonica Group Os01g0159600, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:3123351..3124325|
CDS = 3123807..3123939,3124052..3124200|
GCID = <gbrowseImage1>
name=NC_008394:3123351..3124325
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:3123351..3124325
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atggcgcagcaggcggagaaggcggcggagctgcaggacccggagatccgggcggagctggaccggcgcgcccgcgacgacggcaagaccgtcatcaagagcggcaccggcggcaagagcctcgacgcccaggagcgcctcgccgaagggcgtaagaagggagggctgagccgcacgacggagtccggcaaggagcgcgccgacgacgacaccggcgccgtgctcatcgagcccgacgacaagatgctcaaggaggccaaaaagaacctgggccgcaagtga</cdnaseq>|
AA = <aaseq>MAQQAEKAAELQDPEIRAELDRRARDDGKTVIKSGTGGKSLDAQ ERLAEGRKKGGLSRTTESGKERADDDTGAVLIEPDDKMLKEAKKNLGRK</aaseq>|
DNA = <dnaseqindica>387..519#126..274#atcgatccatcgctagcttatctcaatctcgccacgaggaaataaagcctagcgcatattagccgttggttggtttagtatacgtacgtagggtagcttagcttagagcacgtacgtacgcatcgatggcgcagcaggcggagaaggcggcggagctgcaggacccggagatccgggcggagctggaccggcgcgcccgcgacgacggcaagaccgtcatcaagagcggcaccggcggcaagagcctcgacgcccaggagcgcctcgccgaaggcccgtgtcctttttatgtttcttctctcttttgtgctatatcttttacacgttctgatcgatttgatgtgtacgtacgtttatattggcgtaatagtgtatacgtgtgcagggcgtaagaagggagggctgagccgcacgacggagtccggcaaggagcgcgccgacgacgacaccggcgccgtgctcatcgagcccgacgacaagatgctcaaggaggccaaaaagaacctgggccgcaagtgagacgtacgtgcactagcgtgctggtgtgttgtggttgctcgatcatatagtagtgtactagtgtgtgcatttccttggtgtatccatgtgcatgcatgcatggcaggcgtacgtattagtattactctacgtgacgtgtaagctatgctggctacaaaattttggtccctgcaggattatattgtagccatatgtatgttagtatgtatgtacgtgttcttcacgtactgccctagctactagcaagtcgatctagctatatcgtgtgtgtgtacgtatattgtgatcgatgtacgaagctgctgctttctacatcctggctacaaatgtaattgtgtttgtgtgtctccgtacgctacgtttctgtgtgtctgtagccatgcattgtcctcttcaaggctccaatgttatataacaataagtggttgatttctactgatgaaagcttagtttatc</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048621.2 RefSeq:Os01g0159600]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

@@ Line 25: / Line 25: @@
 Ming-Der Shih; Lin-Tzu Huang; Fu-Jin Wei; Ming-Tsung Wu; Folkert A. Hoekstra; Yue-Ie C. Hsing (2010). OsLEA1a, a new Em-like protein of cereal plants. Plant and Cell Physiology, 51(12): 2132-2144.
 ==Structured Information==
-{{JaponicaGene|
+     [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
 .Several functional studies showed that the accumulation of LEA proteins might improve plant survival during osmotic stress.
 .the accumulation of LEA proteins is tightly associated with the accumulation of non-reducing sugars, such as sucrose and raffi nose.
@@ Line 8: / Line 9: @@
 ===Expression===
 Please input expression information here.
 The encoded OsLEA1a protein has an N-terminal sequence similar to that of other plant Em proteins but lacks a 20-mer motif that is the most significant feature of typical Em proteins. The similarity in the N-terminus between Em-like and typical Em proteins can be 60–80 %, depending on the species. The location of the sole intron indicates that the second exon of OsLEA1a is the mutated product of a typical Emgene. Transcriptome analysis revealed OsLEA1amainly expressed in embryos, with no or only a few transcripts in osmotic stress-treated vegetative tissues. the OsLEA1a protein adopts high amounts of disordered conformations in solution and undergoes desiccation-induced conformational changes. And the protein interacts with non-reducing sugars and phospholipids but not poly- L-lysine, Thus, although the OsLEA1a protein lost its 20-mer motif, it is still involved in the formation of bioglasses with non-reducing sugars or plasma membrane.
 ===Evolution===
 Please input evolution information here.
 The orthologs of the OsLEA1a gene had been indentified from various grasses but not in dicot plants. Genetic analysis indicated that rice OsLEA1a locates at a 193 kb segment in chromosome 1 and is conserved in several published cereal genomes. Thus, the ancestor of Em-like genes might have evolved after the divergence of monocot plants.

@@ Line 1: / Line 1: @@
 Please input one-sentence summary here.
+Proteins abundant in seeds during the late stages of development, late embryogenesis abundant (LEA) proteins, are associated with desiccation tolerance.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+.Several functional studies showed that the accumulation of LEA proteins might improve plant survival during osmotic stress.
+.the accumulation of LEA proteins is tightly associated with the accumulation of non-reducing sugars, such as sucrose and raffi nose.
 ===Expression===
 Please input expression information here.
+The encoded OsLEA1a protein has an N-terminal sequence similar to that of other plant Em proteins but lacks a 20-mer motif that is the most significant feature of typical Em proteins. The similarity in the N-terminus between Em-like and typical Em proteins can be 60–80 %, depending on the species. The location of the sole intron indicates that the second exon of OsLEA1a is the mutated product of a typical Emgene. Transcriptome analysis revealed OsLEA1amainly expressed in embryos, with no or only a few transcripts in osmotic stress-treated vegetative tissues. the OsLEA1a protein adopts high amounts of disordered conformations in solution and undergoes desiccation-induced conformational changes. And the protein interacts with non-reducing sugars and phospholipids but not poly- L-lysine, Thus, although the OsLEA1a protein lost its 20-mer motif, it is still involved in the formation of bioglasses with non-reducing sugars or plasma membrane.
 ===Evolution===
 Please input evolution information here.
+The orthologs of the OsLEA1a gene had been indentified from various grasses but not in dicot plants. Genetic analysis indicated that rice OsLEA1a locates at a 193 kb segment in chromosome 1 and is conserved in several published cereal genomes. Thus, the ancestor of Em-like genes might have evolved after the divergence of monocot plants.
 You can also add sub-section(s) at will.

@@ Line 15: / Line 15: @@
 ==Labs working on this gene==
 Please input related labs here.
+.Institute of Plant and Microbial Biology, Academia Sinica, Taipei, 11529, Taiwan, ROC.
 ==References==
 Please input cited references here.

@@ Line 18: / Line 18: @@
 ==References==
 Please input cited references here.
+Ming-Der Shih; Lin-Tzu Huang; Fu-Jin Wei; Ming-Tsung Wu; Folkert A. Hoekstra; Yue-Ie C. Hsing (2010). OsLEA1a, a new Em-like protein of cereal plants. Plant and Cell Physiology, 51(12): 2132-2144.
 ==Structured Information==
 {{JaponicaGene|

← Older revision		Revision as of 18:44, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os01g0159600\|		GeneName = Os01g0159600\|