Os01g0174000 - Revision history

Xysj2018: /* Evolution */

2017-02-20T12:02:35Z

‎Evolution

Xysj2018: /* Evolution */

2017-02-20T12:02:22Z

‎Evolution

Xysj2018: /* Evolution */

2017-02-20T12:02:02Z

‎Evolution

Xysj2018: /* Expression */

2017-02-20T12:01:08Z

‎Expression

Xysj2018: /* Function */

2017-02-20T11:56:44Z

‎Function

Xysj2018: /* Function */

2017-02-20T11:56:21Z

‎Function

Xysj2018: /* Function */

2017-02-20T11:55:08Z

‎Function

Xysj2018 at 11:54, 20 February 2017

2017-02-20T11:54:56Z

192.168.72.52 at 04:34, 14 May 2015

2015-05-14T04:34:28Z

124.16.129.48 at 18:45, 22 July 2012

2012-07-22T18:45:13Z

@@ Line 17: / Line 17: @@
 * Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.
 * Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.
-<br><br>
+<br>
 '''''You can also add sub-section(s) at will.'''''

@@ Line 17: / Line 17: @@
 * Similar intron/exon structural patterns were observed in the basic and hinge regions of their bZIP domains.
 * Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.
+<br><br>
 '''''You can also add sub-section(s) at will.'''''

@@ Line 18: / Line 18: @@
 * Detailed sequence analysis has been done to identify additional conserved motifs outside the bZIP domain and to predict their DNA-binding site specificity as well as dimerization properties, which has helped classify them into different groups and subfamilies, respectively.
-You can also add sub-section(s) at will.
+'''''You can also add sub-section(s) at will.'''''
 ==Labs working on this gene==

@@ Line 10: / Line 10: @@
 ===Expression===
-* The researchers from India find that specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
+* The researchers from India find specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
 * bZIP transcription factor-encoding genes in rice also displayed differential expression patterns in rice seedlings in response to abiotic stress and light irradiation.

@@ Line 7: / Line 7: @@
 * The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
 * The '''''OsbZIP''''' proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region and the Leu zipper dimerization region.
-* They have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.
+* bZIP proteins have been shown to regulate diverse plant-specific phenomena, including seed maturation and germination, floral induction and development, and photomorphogenesis, and are also involved in stress and hormone signaling.
 ===Expression===

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os01g0174000''''' was reported as '''''OsbZIP01''''' in 2008 <ref name="ref1" /> by researchers from India.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+* The basic leucine (Leu) zipper (bZIP) proteins compose a family of transcriptional regulators present exclusively in eukaryotes.
+* The bZIP proteins characteristically harbor a bZIP domain composed of two structural features: a DNA-binding basic region
 ===Expression===
-Please input expression information here.
+* The researchers from India find that specific or coexpression patterns of rice bZIP transcription factors starting from floral transition to various stages of panicle and seed development.
 ===Evolution===
-Please input evolution information here.
+* The phylogenetic relationship among rice bZIP domains as well as with bZIP domains from other plant bZIP factors suggests that homologous bZIP domains exist in plants.
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi 110021, India
 ==References==
-Please input cited references here.
+<references>
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]

← Older revision		Revision as of 04:34, 14 May 2015
Line 20:		Line 20:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0174000\|~~
−	~~Description = Similar to Transcription factor HY5-like (HY5 homolog). Splice isoform 2\|~~
−	~~Version = NM_001048695.1 GI:115434803 GeneID:4327123\|~~
−	~~Length = 780 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0174000, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:3810290..3811069\|~~
−	~~CDS = 3810290..3810397,3810469..3810851,3810949..3811069\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:3810290..3811069~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:3810290..3811069~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggcggcgcaggagcaggagcaggagaagcagcaggtgaagacgagcacgacgagctcgctgccgtcgagcagcgagcgctcctccagctcagcccccaacaacctcaaggaaggaggaggggtggagagcgacgaggagatacggcgggtgccggagatgggagggggcggcgggtcggcgtcgtcgggggcgggggcggacgagcggcaggggaaggaggacgggaagcagcagggtggtggcggcggcggggcggcggcggcggggggcgggcaggagcaggcgccgccggcgaggaagcgagggcggagcgccggcgacaaggagcagaaccggctgaagcggctgctgcggaaccgcgtgtcggcgcagcaggcgcgggagcggaagaaggcgtacatgacggagctcgaggccaaggccaaggacctcgagctccgcaatgccgagctcgagcagcgcgtctccaccctccagaacgagaacaacacgctccgccagatactcaagaacacgacggcgcacgccggcaagaggggcggcggcggcggaggcaagggcggcgatggcggcggcggcgggaagaagcaccatttcaccaagagctag</cdnaseq>\|
−	AA = <aaseq>MAAQEQEQEKQQVKTSTTSSLPSSSERSSSSAPNNLKEGGGVES DEEIRRVPEMGGGGGSASSGAGADERQGKEDGKQQGGGGGGAAAAGGGQEQAPPARKR GRSAGDKEQNRLKRLLRNRVSAQQARERKKAYMTELEAKAKDLELRNAELEQRVSTLQ NENNTLRQILKNTTAHAGKRGGGGGGKGGDGGGGGKKHHFTKS</aaseq>\|
−	DNA = <dnaseqindica>673..780#219..601#1..121#atggcggcgcaggagcaggagcaggagaagcagcaggtgaagacgagcacgacgagctcgctgccgtcgagcagcgagcgctcctccagctcagcccccaacaacctcaaggaaggaggaggtaacgtcacgttctccgtcggccgtccgtacgccggatttcctttgcttgttttgttgtttgctgctgaattgagcgagcgattcggtggcggcaggggtggagagcgacgaggagatacggcgggtgccggagatgggagggggcggcgggtcggcgtcgtcgggggcgggggcggacgagcggcaggggaaggaggacgggaagcagcagggtggtggcggcggcggggcggcggcggcggggggcgggcaggagcaggcgccgccggcgaggaagcgagggcggagcgccggcgacaaggagcagaaccggctgaagcggctgctgcggaaccgcgtgtcggcgcagcaggcgcgggagcggaagaaggcgtacatgacggagctcgaggccaaggccaaggacctcgagctccgcaatgccgagctcgagcagcgcgtctccaccctccagaacgagaacaacacgctccgccaggtaaagccccctcgagctttgcttcaccattctcaatctctcatggcgatttctcctctactctcctatagatactcaagaacacgacggcgcacgccggcaagaggggcggcggcggcggaggcaagggcggcgatggcggcggcggcgggaagaagcaccatttcaccaagagctag</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001048695.1 RefSeq:Os01g0174000]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

← Older revision		Revision as of 18:45, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os01g0174000\|		GeneName = Os01g0174000\|