Os01g0248900 - Revision history

Xysj1987: /* Annotated Information */

2016-10-09T13:09:59Z

‎Annotated Information

Xysj1987: /* Annotated Information */

2016-10-09T13:09:33Z

‎Annotated Information

Xysj1987: /* Phenotypic analysis */

2016-10-09T13:07:39Z

‎Phenotypic analysis

Xysj1987 at 13:07, 9 October 2016

2016-10-09T13:07:18Z

Xysj2012: /* Structured Information */

2015-05-13T07:07:09Z

‎Structured Information

Doramusic: /* protein 3D structure */

2014-06-11T13:21:54Z

‎protein 3D structure

Doramusic: /* Expression */

2014-06-11T13:02:21Z

‎Expression

Doramusic: /* Expression */

2014-06-11T13:01:25Z

‎Expression

Doramusic: /* protein 3D structure */

2014-06-11T12:58:15Z

‎protein 3D structure

Doramusic: /* protein 3D structure */

2014-06-11T11:54:25Z

‎protein 3D structure

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 [[File:28-Os01g0248900.png|right|thumb|327px|'''Figure 3.''' ''Morphological changes in 35S :: OsEXPA8 transgenic lines.<ref name="ref1" />.'']]
 ===Function===
 * Accumulation of '''''OsEXPA8''''' in Cell Wall Enlarges Cell Size.

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Function===
 * Accumulation of '''''OsEXPA8''''' in Cell Wall Enlarges Cell Size.

@@ Line 8: / Line 8: @@
 ===Phenotypic analysis===
-* Overexpression of OsEXPA8 yielded pleiotropic phenotypes in the root system architecture (Figure 3A–F), plant height, leaf number and leaf size (Figure 3G and H).
+* Overexpression of '''''OsEXPA8''''' yielded pleiotropic phenotypes in the root system architecture (Figure 3A–F), plant height, leaf number and leaf size (Figure 3G and H).
 * Compared to wild-type plants, 35S::OsEXPA8 transgenic lines showed similar morphological phenotypes: the length of primary roots (Figure 3A) and number of lateral roots were significantly increased (t-test, P,0.01).
 * The size of root hairs in the root apex of 35S::OsEXPA8 plants has been increased clearly by stereoscope (Figure 3B and C) and Cryo-SEM images (Figure 3D and E). At maturity, the difference of the root system architecture between transgenic lines and wild-type plants was also significant, and transgenic lines developed more and longer roots (including lateral and adventurous roots) (Figure 3F).

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os01g0248900''''' was reported as '''''OsEXPA8''''' in 2013 <ref name="ref1" /> by researchers from Korea, Mongolia, Russia.
 ==Annotated Information==
 ===Function===
-Please input function information here.
+* Accumulation of '''''OsEXPA8''''' in Cell Wall Enlarges Cell Size.
-===Expression===
+===Phenotypic analysis===
-Rare lipoprotein A (RlpA) contains a conserved region that has the double-psi beta-barrel (DPBB) fold. The function of RlpA is not well understood, but it has been shown to act as a prc mutant suppressor in Escherichia coli. The DPBB fold is often an enzymatic domain. The members of this family are quite diverse, and if catalytic this family may contain several different functions. Another example of this domain is found in the N terminus of pollen allergen.
+* Overexpression of OsEXPA8 yielded pleiotropic phenotypes in the root system architecture (Figure 3A–F), plant height, leaf number and leaf size (Figure 3G and H).
-＝RNA coding sequence=
+* Compared to wild-type plants, 35S::OsEXPA8 transgenic lines showed similar morphological phenotypes: the length of primary roots (Figure 3A) and number of lateral roots were significantly increased (t-test, P,0.01).
-/translation="MAAARMLVLLASLCALLLTASAAKWTPAFATFYGGSDASGTMGG
+* The size of root hairs in the root apex of 35S::OsEXPA8 plants has been increased clearly by stereoscope (Figure 3B and C) and Cryo-SEM images (Figure 3D and E). At maturity, the difference of the root system architecture between transgenic lines and wild-type plants was also significant, and transgenic lines developed more and longer roots (including lateral and adventurous roots) (Figure 3F).
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* Bioengineering College, Chongqing University, Chongqing, China
 ==References==
-. The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan.
+<references>
+* <ref name="ref1">
-. Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb.
+Ma N, Wang Y, Qiu S, Kang Z, Che S, Wang G, Huang J. Overexpression of
+OsEXPA8, a root-specific gene, improves rice growth and root system architecture
-. The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1.
+by facilitating cell extension. PLoS One. 2013 Oct 4;8(10):e75997. doi:
+.1371/journal.pone.0075997. eCollection 2013. PubMed PMID: 24124527;
-. The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11.
+</ref>
 ==Structured Information==

@@ Line 51: / Line 51: @@
 ==Structured Information==
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 31: / Line 31: @@
 =protein 3D structure=
-[[File:[[File:Os01g0248900_protein_3D_structure.png]]]]
+[[File:Os01g0248900_protein_3D_structure.png]]
 ===Evolution===

@@ Line 14: / Line 14: @@
                       RVQADDGRVVTAADVAPAGWSFGATYTSSAQFY"
 ORIGIN
-gacgcgacaa tggcggccgc cagaatgctc gtgctcctgg cctctctctg cgctctcctg/
+gacgcgacaa tggcggccgc cagaatgctc gtgctcctgg cctctctctg cgctctcctg
-ctcacggcgt ccgcggccaa atggactcct gccttcgcga cgttctacgg cggcagcgac/
+ctcacggcgt ccgcggccaa atggactcct gccttcgcga cgttctacgg cggcagcgac
-gcctccggca ccatgggcgg cgcatgcggg tacggcgacc tgtacggcgc cgggtacggg/
+gcctccggca ccatgggcgg cgcatgcggg tacggcgacc tgtacggcgc cgggtacggg
-acgcggacgg cggcgctgag cacggcgctg ttcaacggcg gcgcgtcgtg cggcgcctgc/
+acgcggacgg cggcgctgag cacggcgctg ttcaacggcg gcgcgtcgtg cggcgcctgc
-ttcaccatcg cctgcgacac ccgcaagacg cagtggtgca agccggggac gtccatcacc/
+ttcaccatcg cctgcgacac ccgcaagacg cagtggtgca agccggggac gtccatcacc
-gtgacggcga ccaacttctg ccctccaaac tacgccctgt ccggcgacgc cggcgggtgg/
+gtgacggcga ccaacttctg ccctccaaac tacgccctgt ccggcgacgc cggcgggtgg
-tgcaacccgc cgcgccgcca cttcgacatg tcgcagccgg cgtgggagac gatcgcggtg/
+tgcaacccgc cgcgccgcca cttcgacatg tcgcagccgg cgtgggagac gatcgcggtg
-taccgcgccg ggatcgtgcc cgtgaactac cgccgcgtgc cgtgccagcg gagcggcggc/
+taccgcgccg ggatcgtgcc cgtgaactac cgccgcgtgc cgtgccagcg gagcggcggc
-atccggttcg ccgtgaacgg gcacagctac ttcgagctgg tgctggtgac gaacgtcggc/
+atccggttcg ccgtgaacgg gcacagctac ttcgagctgg tgctggtgac gaacgtcggc
-ggcagcggcg cggtggcgca gatgtggatc aaggggtccg ggacggggtg gatggcgatg/
+ggcagcggcg cggtggcgca gatgtggatc aaggggtccg ggacggggtg gatggcgatg
-agccgcaact ggggcgcgaa ctggcagagc aacgcgcgcc tcgacgggca ggcgctgtcg/
+agccgcaact ggggcgcgaa ctggcagagc aacgcgcgcc tcgacgggca ggcgctgtcg
-ttccgggtgc aggccgacga cggccgcgtc gtcacggcgg ccgacgtcgc gccggcgggg/
+ttccgggtgc aggccgacga cggccgcgtc gtcacggcgg ccgacgtcgc gccggcgggg
-tggtcgttcg gcgccaccta cacctcctcg gctcagttct actgatgagc attaattgca/
+tggtcgttcg gcgccaccta cacctcctcg gctcagttct actgatgagc attaattgca
-agcctatctc atttaattaa tctggaccgt tcgatgtagt atattgtatg ctttgatcga/
+agcctatctc atttaattaa tctggaccgt tcgatgtagt atattgtatg ctttgatcga
 cgtggcatag gatggaagag gccgcccacg aagaaaattt gggacttgtg tat