Os01g0257300 - Revision history

Xysj2019: /* Expression */

2017-03-06T06:40:15Z

‎Expression

Xysj2019 at 06:40, 6 March 2017

2017-03-06T06:40:00Z

192.168.72.52 at 04:39, 14 May 2015

2015-05-14T04:39:19Z

Lizhitao: /* Labs working on this gene */

2014-05-31T13:10:05Z

‎Labs working on this gene

Mayamei0424: /* Labs working on this gene */

2014-05-31T03:31:11Z

‎Labs working on this gene

Mayamei0424: /* Function */

2014-05-31T03:25:18Z

‎Function

Mayamei0424: /* Function */

2014-05-31T03:24:59Z

‎Function

Mayamei0424: /* Function */

2014-05-31T03:24:14Z

‎Function

Mayamei0424: /* Function */

2014-05-31T03:23:38Z

‎Function

Mayamei0424: /* Function */

2014-05-31T03:23:23Z

‎Function

@@ Line 14: / Line 14: @@
 ===Expression===
-* Data of in situ hybridization and OsRAA1::GUS transgenic plant showed that OsRAA1 expressed specifically in the apical meristem, the elongation zone of root tip, steles of the branch zone, and the young lateral root.
+* Data of in situ hybridization and OsRAA1::GUS transgenic plant showed that '''''OsRAA1''''' expressed specifically in the apical meristem, the elongation zone of root tip, steles of the branch zone, and the young lateral root.
 ===Evolution===

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+The rice '''''Os01g0257300''''' was reported as '''''OsRAA1''''' in 2004 <ref name="ref1" /> by researchers from China.
 ==Annotated Information==
 ===Function===
-''OsRAA1''(Oryza sativa Root Architecture Associated1) encodes a small protein (109 aa in length) conserved in plants
+* '''''OsRAA1''''' is a new gene functions in the development of rice root systems, which are mediated by auxin.
-including -GVWV/IF domain, -GWERYY domain ,-DLIS/ALP- and -H/YMYDI/VVV/I- domain. The OsRAA1 promoter(1,987 bp in length)includes elements of GA and auxin response, but it was a very weak response to GA3 treatment and it probably regulated by auxin. The OsRAA1 mRNA was specifically transcripted in the organs of roots and spikes, including root apex, cortex of root apical meristem ,pericycle of root apex, lateral roots, apical meristem of young spikes, collenchyma cells of margin vascular bundles between shoot and roots.In Ubi::OsRAA1 transgenic plants, overexpression ''OsRAA1'' in the root results in reduced growth of primary root, increased number of adventitious roots and helix primary root, and delayed gravitropic, which are similar to the phenotypes of the wild-type plant treated with auxin. Furthermore, the leaves and filaments are longer at the last stage of plant development in the transgenic plants. ''OsRAA1''  expression is induced by auxin. At the same time, overexpression of ''OsRAA1'' also causes endogenous indole-3-acetic acid to increase. These data suggest that ''OsRAA1'' as a new gene functions in the development of rice root systems,which are mediated by auxin.
+* A positive feedback regulation mechanism of '''''OsRAA1''''' to indole-3-acetic acid metabolism may be involved in rice root development in nature.
-OsRAA1 Regulates Primary Root Development by Modulating Mitosis. OsRAA1 may function at the transition from metaphase to anaphase during cell division.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.
+===Phenotypic analysis===
 ===Expression===
-Please input expression information here.
+* Data of in situ hybridization and OsRAA1::GUS transgenic plant showed that OsRAA1 expressed specifically in the apical meristem, the elongation zone of root tip, steles of the branch zone, and the young lateral root.
 ===Evolution===
-Please input evolution information here.
+* '''''OsRAA1''''' encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating root development yet.
 You can also add sub-section(s) at will.
 ==Labs working on this gene==
-Please input related labs here.
+* Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, The Chinese Academy of Sciences, Beijing 100093, China
 ==References==
-*Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855
+<references>
-*Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513
+* <ref name="ref1">
 ==Structured Information==
       [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]

← Older revision		Revision as of 04:39, 14 May 2015
Line 31:		Line 31:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0257300\|~~
−	~~Description = Conserved hypothetical protein\|~~
−	~~Version = NM_001049166.1 GI:115435745 GeneID:4326229\|~~
−	~~Length = 785 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0257300, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:8585137..8585921\|~~
−	~~CDS = 8585497..8585826\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:8585137..8585921~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:8585137..8585921~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq>\|
−	~~AA = <aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq>\|~~
−	DNA = <dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049166.1 RefSeq:Os01g0257300]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 19: / Line 19: @@
 ==Labs working on this gene==
 Please input related labs here.
-*OsRAA1 Interaction Protein Screening
 *Research Center for Molecular and Developmental Biology, Key Laboratory of Photosynthesis and Environmental Molecular Physiology, Institute of Botany, The Chinese Academy of Sciences,Beijing 100093, China
 *State Key Laboratory of Plant Physiology and Biochemistry, Department of Plant Sciences, College of Biological Sciences, China Agricultural University, Beijing 100094,China

@@ Line 33: / Line 33: @@
 *Protein Degradation Assay in Vitro
 *Morphological Examination of Transformed S. pombeCells
 ==References==