Os01g0263300 - Revision history

192.168.72.52 at 04:39, 14 May 2015

2015-05-14T04:39:38Z

Meddy: /* Labs working on this gene */

2014-06-10T08:03:19Z

‎Labs working on this gene

Meddy: /* Labs working on this gene */

2014-06-10T07:58:41Z

‎Labs working on this gene

Meddy: /* Labs working on this gene */

2014-06-10T07:52:29Z

‎Labs working on this gene

Meddy: /* Expression */

2014-06-10T07:46:17Z

‎Expression

Meddy: /* Function */

2014-06-10T01:58:04Z

‎Function

Meddy: /* Expression */

2014-06-10T01:53:39Z

‎Expression

Meddy: /* Expression */

2014-06-10T01:50:25Z

‎Expression

Meddy: /* Expression */

2014-06-10T01:43:44Z

‎Expression

Meddy: /* Expression */

2014-06-10T01:22:17Z

‎Expression

← Older revision		Revision as of 04:39, 14 May 2015
Line 110:		Line 110:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0263300\|~~
−	~~Description = Similar to Peroxidase 72 precursor (EC 1.11.1.7) (Atperox P72) (PRXR8) (ATP6a)\|~~
−	~~Version = NM_001049192.1 GI:115435797 GeneID:4325129\|~~
−	~~Length = 2213 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0263300, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:8916736..8918948\|~~
−	~~CDS = 8916843..8917070,8917725..8917916,8918095..8918260,8918353..8918774\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:8916736..8918948~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:8916736..8918948~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgggttgcctgttgatgctctgcttggtttctcccctcctcctcgccacctctgtccacggcaacccgtggtatgggtatgggtatggcttgttcccgcagttctacgaccactcgtgccccaaggcgaaggagatcgtgcagtccatcgtagcacaggcggtggccagggagaccaggatggcggcatccttggtcaggctgcattttcatgactgctttgtcaaggggtgtgacgcgtctgtgctcctggacaacagcaccaccatcatcagtgagaaggggtcaaaccctaacatgaactccctcaggggtttcgaggtcgtcgacgagatcaaggccgccctcgaagcagcttgccccggcaccgtctcctgcgccgacatactcgccctcgctgcacgcgattccactgtcctcgttggtggcccgtactgggatgtgccacttggccggagggactcactgggtgccagcatccagggctccaacaacgacatcccagctcccaacaacaccctccccaccatcatcaccaagttcaagcgccagggccttaacatcgtcgacgtcgtagccctctcaggtggccacaccattggcatgtctcggtgcaccagcttccgtcagaggctctacaatcagagcggcaatggcatggctgactacacactggatgtgtcctacgcggcacagctgaggcagggatgcccccgttctggtggtgacaacaacctcttcccgctagactttgtcagccccgcaaagttcgacaacttctacttcaagaacatcctgtctggcaagggccttctcagctctgatcaggtcctgcttaccaagagcgctgaaacagcggcgctcgtgaaggcgtatgctgatgatgtcaacctcttcttcaagcacttcgcacagtcaatggtgaatatgggcaacatctcgcctctgactggatcacagggggagatcaggaagaactgcaggaggctcaacaactactaccactga</cdnaseq>\|
−	AA = <aaseq>MGCLLMLCLVSPLLLATSVHGNPWYGYGYGLFPQFYDHSCPKAK EIVQSIVAQAVARETRMAASLVRLHFHDCFVKGCDASVLLDNSTTIISEKGSNPNMNS LRGFEVVDEIKAALEAACPGTVSCADILALAARDSTVLVGGPYWDVPLGRRDSLGASI QGSNNDIPAPNNTLPTIITKFKRQGLNIVDVVALSGGHTIGMSRCTSFRQRLYNQSGN GMADYTLDVSYAAQLRQGCPRSGGDNNLFPLDFVSPAKFDNFYFKNILSGKGLLSSDQ VLLTKSAETAALVKAYADDVNLFFKHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNYY H</aaseq>\|
−	DNA = <dnaseqindica>108..335#990..1181#1360..1525#1618..2039#acccacaaccaagagaagtagaaacaaacagagagcaattctcttctcctacctagcaacctagtgcagtgcagtgcagtgcagcgaaggtttacttggcgacttccatgggttgcctgttgatgctctgcttggtttctcccctcctcctcgccacctctgtccacggcaacccgtggtatgggtatgggtatggcttgttcccgcagttctacgaccactcgtgccccaaggcgaaggagatcgtgcagtccatcgtagcacaggcggtggccagggagaccaggatggcggcatccttggtcaggctgcattttcatgactgctttgtcaaggtactgtgatttctcttctgctgtagcattctttacttgtcttcacaaagctaatggtgctcggttgacatagcacctgcagtgtagcctgcaaaaacataattcaaatgagttgtatgcttagtgcaactagaaaggcaattatatgcgtttcacttgcttttgcgatggttaaatccatatgaaggtattgcaaatagtcatcaaaaatagagaaaaaaaagacatgtatttgcagatgcaactttagctgttacataacgaaaacgcaaagtgtaggagatcaaacctttgttatatttgtacctaggtattaaaaaaggtacccttaggagcatggaagaatctatagttattaggcaaactttttaccactgataagatagcctaccaacattgcccatgcgagcactactttctgccttggtgatatgatgagtccgtaccatgatttcttgattattcactttcttttcaaagagaggatgactatttaattcaaatgcacaataattggcgctctcgatgtttcatttatcagagaccttcacccagtacaggaccctaaatcaatatatattttgctgttccgttgcatgtgcctaatctatgtactacttccatgtacctaatctatgtaccaacattgtgtaggggtgtgacgcgtctgtgctcctggacaacagcaccaccatcatcagtgagaaggggtcaaaccctaacatgaactccctcaggggtttcgaggtcgtcgacgagatcaaggccgccctcgaagcagcttgccccggcaccgtctcctgcgccgacatactcgccctcgctgcacgcgattccactgtcctcgtatgtagcagagataagctctatcagaaccacacaaaagaatatcacattcggaaatagaaggagaaatgaactgtgtattattattatttctgtatgagcttagagaaaagaaccgctcctaggatgagctcaacagtgccgtgttttgtgactgaatttgcactcaaacctgcaggttggtggcccgtactgggatgtgccacttggccggagggactcactgggtgccagcatccagggctccaacaacgacatcccagctcccaacaacaccctccccaccatcatcaccaagttcaagcgccagggccttaacatcgtcgacgtcgtagccctctcaggtgaacttcttcttaccatcttatgagtatgtgcgtccatttcttgagagagatctttcttacattgcacaaaaatgggtgcatacatacaggtggccacaccattggcatgtctcggtgcaccagcttccgtcagaggctctacaatcagagcggcaatggcatggctgactacacactggatgtgtcctacgcggcacagctgaggcagggatgcccccgttctggtggtgacaacaacctcttcccgctagactttgtcagccccgcaaagttcgacaacttctacttcaagaacatcctgtctggcaagggccttctcagctctgatcaggtcctgcttaccaagagcgctgaaacagcggcgctcgtgaaggcgtatgctgatgatgtcaacctcttcttcaagcacttcgcacagtcaatggtgaatatgggcaacatctcgcctctgactggatcacagggggagatcaggaagaactgcaggaggctcaacaactactaccactgaggttgtcttgtgtgctgagttttacaaggtggtggtagtggcatgttttgtttaaataagtaaagctggttgtaatgcgtcaaggctgtttgatcatttgtgttattgtgattgcgttgcaaaacgtgtatgtttaataattcaatatataaaatgagttcatttggttgttct</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049192.1 RefSeq:Os01g0263300]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 89: / Line 89: @@
      GUS Assay
 GUS assay was performed according to Jefferson et al.(1987). Various tissues of transgenic plants at 5–10 days before heading were incubated in 100 mM sodium
-phosphate buffer (pH 7.0) containing 0.1% (w/v)5-bromo-4-chloro-3-indolyl-β-D-glucuronide (X-Gluc), 10 mM EDTA, 0.5% (v/v) Triton X-100, 5 mM potassium ferrocyanide, 5 mM potassium ferricyanide, and 20% methanol at 37°C in the dark for 10 to 13 h. To allow a better penetration of substrate, vacuum was applied to samples in the X-Gluc solution for 2 min. After staining, the tissues were cleared using ethanol at 50°C several times and observed under a microscope (Leica, Germany) using dark-field illumination.
+phosphate buffer (pH 7.0) containing 0.1% (w/v)5-bromo-4-chloro-3-indolyl-β-D-glucuronide (X-Gluc), 10 mM EDTA, 0.5% (v/v) Triton X-100, 5 mM potassium ferrocyanide, 5 mM potassium ferricyanide, and 20% methanol at 37°C in the dark for 10 to 13 h. To allow a better penetration of substrate, vacuum was applied to samples in the X-Gluc solution for 2 min. After staining, the tissues were cleared using ethanol at 50°C several times and observed under a microscope (Leica, Germany) using dark-field illumination.[[File:xitu.png|200px|thumb|left| cGerminating seed
 ==References==

@@ Line 67: / Line 67: @@
 a nylon membrane, and hybridized with radio-labeledOsPOX1cDNA]]
      Isolation of the OsPOX1Promoter
-For obtaining the promoter region ofOsPOX1, PCR was performed with genomic DNA using specific primers designed based on its genome sequence in the NCBI database. The primary PCR was in 50 μl solution containing 0.1 μg of rice genomic DNA, 0.2 μMof specific primers (POX1-P5, 5′-GAT CTA CAT CAG AAC AAG G-3′; POX1-P7, 5′- AGC ATC AAC AGG CAA CC-3′), 0.2 mM dNTPs, and 2.5 units of Ex-Taq DNA polymerase (TakaRa, Japan). The reaction included an initial 5-min denaturation at 94°C, followed by 30 cycles of PCR (94°C, 1 min; 53°C, 1 min 30 sec; 72°C, 2 min 10 sec), and a final 10 min at 72°C. Aliquots (1μl) from 20-fold dilutions of the primary PCR products were applied directly to nested PCR reaction (50μl) containing 0.2 μM of specific primers (POX1-P6, 5′-GTT CTA GAG CTA TAC ACG-3′; POX1-P8, 5′-AAG GTA CCG GAA GTC GCC AAG-3′), 0.2 mM dNTPs, and 2.5 units of Ex-Taq DNA polymerase. The reaction included an initial 5-min denaturation at 94°C, followed by four cycles of PCR (94°C,1 min; 42°C, 1 min 30 sec; 72°C, 2 min 10 sec), and then by 26 cycles of PCR (94°C, 1 min; 59°C, 1 min 30 sec; 72°C,2 min 10 sec) and a final 10 min at 72°C.
+For obtaining the promoter region ofOsPOX1, PCR was performed with genomic DNA using specific primers designed based on its genome sequence in the NCBI database. The primary PCR was in 50 μl solution containing 0.1 μg of rice genomic DNA, 0.2 μMof specific primers (POX1-P5, 5′-GAT CTA CAT CAG AAC AAG G-3′; POX1-P7, 5′- AGC ATC AAC AGG CAA CC-3′), 0.2 mM dNTPs, and 2.5 units of Ex-Taq DNA polymerase (TakaRa, Japan). The reaction included an initial 5-min denaturation at 94°C, followed by 30 cycles of PCR (94°C, 1 min; 53°C, 1 min 30 sec; 72°C, 2 min 10 sec), and a final 10 min at 72°C. Aliquots (1μl) from 20-fold dilutions of the primary PCR products were applied directly to nested PCR reaction (50μl) containing 0.2 μM of specific primers (POX1-P6, 5′-GTT CTA GAG CTA TAC ACG-3′; POX1-P8, 5′-AAG GTA CCG GAA GTC GCC AAG-3′), 0.2 mM dNTPs, and 2.5 units of Ex-Taq DNA polymerase. The reaction included an initial 5-min denaturation at 94°C, followed by four cycles of PCR (94°C,1 min; 42°C, 1 min 30 sec; 72°C, 2 min 10 sec), and then by 26 cycles of PCR (94°C, 1 min; 59°C, 1 min 30 sec; 72°C,2 min 10 sec) and a final 10 min at 72°C.[[File:tupu.png|200px|thumb|left|OsPOX1promoter sequence, a schematic diagram of POsPOX1-GUSconstruct, and histochemical localization of GUS activity in the
     DNA Sequence Analysis
 Both strands of the PCR-amplified promoter as well as cDNA were sequenced by the dideoxynucleotide chain termination method (Sanger et al. 1977) with an ABIPRISM Autosequencer (Perkin-Elmer, USA). The sequences were then compared with those in the NCBI database,using the BLAST program (Altschul et al.1990), and the

@@ Line 55: / Line 55: @@
      Northern Blot Analysis
 Ten μg of total RNA was denatured and resolved by electrophoresis through 1.3% agarose gel, blotted onto anylon membrane, and then hybridized at 42°C with 32
-Plabeled OsPOX1probe for 16 to 24 h (Sambrook et al.1989). The membrane was washed in 0.1× SSC, 0.1% SDS at room temperature, and then exposed to either Hyperfilm™MP film (Amersham, UK) or a phosphoimage plate of BAS 1500 (Fuji, Japan).
+Plabeled OsPOX1probe for 16 to 24 h (Sambrook et al.1989). The membrane was washed in 0.1× SSC, 0.1% SDS at room temperature, and then exposed to either Hyperfilm™MP film (Amersham, UK) or a phosphoimage plate of BAS 1500 (Fuji, Japan).[[File:yinji.png|200px|thumb|left|Northern analysis ofOsPOX1in response to various stress. a
      Isolation of the OsPOX1Promoter
 For obtaining the promoter region ofOsPOX1, PCR was performed with genomic DNA using specific primers designed based on its genome sequence in the NCBI database. The primary PCR was in 50 μl solution containing 0.1 μg of rice genomic DNA, 0.2 μMof specific primers (POX1-P5, 5′-GAT CTA CAT CAG AAC AAG G-3′; POX1-P7, 5′- AGC ATC AAC AGG CAA CC-3′), 0.2 mM dNTPs, and 2.5 units of Ex-Taq DNA polymerase (TakaRa, Japan). The reaction included an initial 5-min denaturation at 94°C, followed by 30 cycles of PCR (94°C, 1 min; 53°C, 1 min 30 sec; 72°C, 2 min 10 sec), and a final 10 min at 72°C. Aliquots (1μl) from 20-fold dilutions of the primary PCR products were applied directly to nested PCR reaction (50μl) containing 0.2 μM of specific primers (POX1-P6, 5′-GTT CTA GAG CTA TAC ACG-3′; POX1-P8, 5′-AAG GTA CCG GAA GTC GCC AAG-3′), 0.2 mM dNTPs, and 2.5 units of Ex-Taq DNA polymerase. The reaction included an initial 5-min denaturation at 94°C, followed by four cycles of PCR (94°C,1 min; 42°C, 1 min 30 sec; 72°C, 2 min 10 sec), and then by 26 cycles of PCR (94°C, 1 min; 59°C, 1 min 30 sec; 72°C,2 min 10 sec) and a final 10 min at 72°C.

@@ Line 24: / Line 24: @@
 positions of amino acids on theright. Asteriskindicates the translation
 termination site. The forward and reverse primers used in the nested
-PCR areunderlined. .'']]
+PCR areunderlined..'']]
 ===Evolution===

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-The cDNA encodes a putative class III peroxidase of 335 amino acids with 77–98% identity with rice peroxidases and namedOsPOX1OsPOX1is coldinducible in floral-organ preferential manner. A promoter region of OsPOX1was isolated, and the transgenic rice plants ofGUSgene driven by the OsPOX1 promoter was investigated under cold-stressed and unstressed conditions.
+OsPOX1is the only flowerpreferential and cold-inducible peroxidase gene in rice.The cDNA encodes a putative class III peroxidase of 335 amino acids with 77–98% identity with rice peroxidases and namedOsPOX1OsPOX1is coldinducible in floral-organ preferential manner. A promoter region of OsPOX1was isolated, and the transgenic rice plants ofGUSgene driven by the OsPOX1 promoter was investigated under cold-stressed and unstressed conditions.
 ===Expression===

@@ Line 20: / Line 20: @@
 OsPOX1gene..'']]
    the expression ofOsPOX1in the seedling was not changed by various stress treatment as shown:
-[[File:jiyinbiaodatu.png|right|thumb|300px|jiyinbiaodatu.'']]
+[[File:jiyinbiaodatu.png|right|thumb|300px|The nucleotide and deduced amino acid sequences of
 ===Evolution===

@@ Line 14: / Line 14: @@
 vacuolated pollen stage, the GUS activity was highly
 induced by cold stress, suggesting that OsPOX1is a
-flower-preferential cold-responsive gene in ric.[[File:cold-responsive.png|left|thumb|300px|cold-responsive.'']]
+flower-preferential cold-responsive gene in ric.[[File:cold-responsive.png|left|thumb|300px|Genomic structure ofOsPOX1on chromosome 1. ATGand arrow
    the expression ofOsPOX1in the seedling was not changed by various stress treatment as shown:
 [[File:jiyinbiaodatu.png|right|thumb|300px|jiyinbiaodatu.'']]

@@ Line 6: / Line 6: @@
 ===Expression===
-  To understand the regulation ofOsPOX1expression, a 1.8 kb promoter region ofOsPOX1was isolated and fused toβ-glucuronidase(GUS) reporter gene. Transgenic rice plants expressing POsPOX1-GUSshowed minimal GUS activity in both shoots and roots at the vegetative stage. In the flowers at early young microspore stage, GUS activity was detected in the veins and anthers. Interestingly, at the later vacuolated pollen stage, the GUS activity was highly induced by cold stress, suggesting that OsPOX1is a flower-preferential cold-responsive gene in rice. the expression ofOsPOX1in the seedling was not changed by various stress treatment as shown:
+   To understand the regulation ofOsPOX1expression, a 1.8 kb
 [[File:jiyinbiaodatu.png|right|thumb|300px|jiyinbiaodatu.'']]