Os01g0307500 - Revision history

Xysj1980: /* References */

2017-03-27T01:24:38Z

‎References

Xysj1980 at 01:24, 27 March 2017

2017-03-27T01:24:10Z

Liushuaiye at 13:57, 7 June 2014

2014-06-07T13:57:12Z

Liushuaiye at 13:46, 7 June 2014

2014-06-07T13:46:20Z

Liushuaiye at 13:06, 7 June 2014

2014-06-07T13:06:22Z

Liushuaiye: /* Annotated Information */

2014-06-07T12:59:36Z

‎Annotated Information

124.16.129.48 at 18:49, 22 July 2012

2012-07-22T18:49:34Z

127.0.0.1: Created page with "{{JaponicaGene| GeneName = Os01g0307500| Description = Cation transporter family protein| Version = NM_001049383.1 GI:115436179 GeneID:4327757| Length = 4487 bp| Definiti..."

2012-06-25T04:36:52Z

Created page with "{{JaponicaGene| GeneName = Os01g0307500| Description = Cation transporter family protein| Version = NM_001049383.1 GI:115436179 GeneID:4327757| Length = 4487 bp| Definiti..."

New page

{{JaponicaGene|
GeneName = Os01g0307500|
Description = Cation transporter family protein|
Version = NM_001049383.1 GI:115436179 GeneID:4327757|
Length = 4487 bp|
Definition = Oryza sativa Japonica Group Os01g0307500, complete gene.|
Source = Oryza sativa Japonica Group

ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
Chromosome = [[:category:Japonica Chromosome 1|Chromosome 1]]|
AP = Chromosome 1:11506912..11511398|
CDS = 11507243..11507441,11508119..11508349,11509997..11511231|
GCID = <gbrowseImage1>
name=NC_008394:11506912..11511398
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage1>|
GSID = <gbrowseImage2>
name=NC_008394:11506912..11511398
source=RiceChromosome01
preset=GeneLocation
</gbrowseImage2>|
CDNA = <cdnaseq>atgagttctctggatgccactactcctagatatgacgagtttaaaaggatctaccaccttttccttttccatgcacacccattctggctccaactgctgtacttcctcttcatctccctcttgggtttcttgatgctgaaagctctgccgatgaagaccagcatggtgccgaggcccatggacttggacctgatcttcacgtcggtgtcggcgacgacggtgtcgagcatggtcgccgtcgagatggagtccttctccaactcccagctcctcctcatcaccctcctcatgctgcttggtggtgaggtcttcaccagcatccttggcctctacttcaccaacgccaagtactcctccaagatgatagcaaccttacctgatgatgacgaccatggtggcagtggcaaaccaccaccaccaacgacgtcaccttcgtctaccctagtggagctcgagctcgctcctcccatggacgtcgtcgtcgtcaaccctaccaccactgcgacgacgcacgacgaggtagagctagggttaggacgtcggaacaagcgcggctgcacctgcactactactcacacgtcgtcgtcatcatcggcatcgaagacgacgacgacgaggctactgatgttcgtggtgatggggtaccacgcggtggtgcacgtcgccgggtacacggccatcgtcgtgtacctcagcgccgtcggcggcgcgggggcggtggtcgccgggaaggggatcagcgcgcacacgttcgccatcttcaccgtcgtctcgacgttcgccaactgcgggttcgtgccgacgaacgaagggatggtgtcgttcaggtcgttcccggggctcctcctcctcgtcatgccgcacgtcctcctcgggaacacgctcttcccggtcttcctcaggctggccatcgccgcgctcgagagggtcaccgggtggccggagctcggcgagctcctgatccggcggcggaggggcggcggcgagggctaccaccacctgttgccgagctcgcgcacgcggttcctggccctcaccgtggccgtgctcgtggtggcgcagctggcgctcttctgcgccatggagtggggctccgacgggctgcgggggctcaccgcgggccagaagctcgtcggcgcgctcttcatggcggtcaactcgaggcactccggtgagatggtgctcgacctctccaccgtgtcgtcggccgtcgtcgtgctctacgtggtgatgatgtacctgccaccttacaccactttcgtacctgtccaagacaaacaccagcaaacgggagcacagtccgggcaggagggcagcagcagcagcagcatatggcagaagctgctcatgtcgccgctctcgtgcctagccatcttcatcgtcgtcatctgcatcacggagcggcggcaaatcgccgacgaccccatcaactacagcgtcctcaacatcgtcgtcgaggttatcagtgcgtatggcaatgtggggttcagcacggggtacagctgcgcgaggcaggtgaggcccgacggcagctgcagagacctgtgggttggcttctcagggaagtggagcaaacaagggaagctcactctcatggccgtcatgttctacggcaggctcaagaagttcagcctgcacggtggtcaggcatggaagatagaataa</cdnaseq>|
AA = <aaseq>MSSLDATTPRYDEFKRIYHLFLFHAHPFWLQLLYFLFISLLGFL MLKALPMKTSMVPRPMDLDLIFTSVSATTVSSMVAVEMESFSNSQLLLITLLMLLGGE VFTSILGLYFTNAKYSSKMIATLPDDDDHGGSGKPPPPTTSPSSTLVELELAPPMDVV VVNPTTTATTHDEVELGLGRRNKRGCTCTTTHTSSSSSASKTTTTRLLMFVVMGYHAV VHVAGYTAIVVYLSAVGGAGAVVAGKGISAHTFAIFTVVSTFANCGFVPTNEGMVSFR SFPGLLLLVMPHVLLGNTLFPVFLRLAIAALERVTGWPELGELLIRRRRGGGEGYHHL LPSSRTRFLALTVAVLVVAQLALFCAMEWGSDGLRGLTAGQKLVGALFMAVNSRHSGE MVLDLSTVSSAVVVLYVVMMYLPPYTTFVPVQDKHQQTGAQSGQEGSSSSSIWQKLLM SPLSCLAIFIVVICITERRQIADDPINYSVLNIVVEVISAYGNVGFSTGYSCARQVRP DGSCRDLWVGFSGKWSKQGKLTLMAVMFYGRLKKFSLHGGQAWKIE</aaseq>|
DNA = <dnaseqindica>3958..4156#3050..3280#168..1402#gctgttgctcttgttcacttgtgctcacagcacctggtaaccccacatacagtgatcacacaacaaacaatatctgttgtttgtgtataaatagccctaacatggcttcctaattcctataaacaacaagtgtgagaaaacccaagaacgaaacacataggagagaaatgagttctctggatgccactactcctagatatgacgagtttaaaaggatctaccaccttttccttttccatgcacacccattctggctccaactgctgtacttcctcttcatctccctcttgggtttcttgatgctgaaagctctgccgatgaagaccagcatggtgccgaggcccatggacttggacctgatcttcacgtcggtgtcggcgacgacggtgtcgagcatggtcgccgtcgagatggagtccttctccaactcccagctcctcctcatcaccctcctcatgctgcttggtggtgaggtcttcaccagcatccttggcctctacttcaccaacgccaagtactcctccaagatgatagcaaccttacctgatgatgacgaccatggtggcagtggcaaaccaccaccaccaacgacgtcaccttcgtctaccctagtggagctcgagctcgctcctcccatggacgtcgtcgtcgtcaaccctaccaccactgcgacgacgcacgacgaggtagagctagggttaggacgtcggaacaagcgcggctgcacctgcactactactcacacgtcgtcgtcatcatcggcatcgaagacgacgacgacgaggctactgatgttcgtggtgatggggtaccacgcggtggtgcacgtcgccgggtacacggccatcgtcgtgtacctcagcgccgtcggcggcgcgggggcggtggtcgccgggaaggggatcagcgcgcacacgttcgccatcttcaccgtcgtctcgacgttcgccaactgcgggttcgtgccgacgaacgaagggatggtgtcgttcaggtcgttcccggggctcctcctcctcgtcatgccgcacgtcctcctcgggaacacgctcttcccggtcttcctcaggctggccatcgccgcgctcgagagggtcaccgggtggccggagctcggcgagctcctgatccggcggcggaggggcggcggcgagggctaccaccacctgttgccgagctcgcgcacgcggttcctggccctcaccgtggccgtgctcgtggtggcgcagctggcgctcttctgcgccatggagtggggctccgacgggctgcgggggctcaccgcgggccagaagctcgtcggcgcgctcttcatggcggtcaactcgaggcactccggtgagatggtgctcgacctctccaccgtgtcgtcggccgtcgtcgtgctctacgtggtgatgatgtatgtatatttgtcctcctcaattattatatttttgacaggccctccttaatatattaattactatcacatgcatgtgtgcacacgtaaaaactaaataaattaccatatcatacatgtgggtacttaatttagtactctggcctgggacatattttaaatcctattggacatctcctttcaattttttttttgaaacaaagtaaaaacgcaggcgcttataacgcgtgcacactcacccttatgaatacaaatcttacccctataagtaccttcgaaagactgagctgacatatcttgagattgacgaagtcatcacgggtatctcactgtcaacaagtacatcactacctaccactaaaagaataattagccataaatacaagcacccgtgtcaaatttattatttgaatctttcattctaattatatgcgatcaaaatagttatgaaaaattctactttatatgggggtgcagggtctcgaggcatctaaatagttatgaaaaaatctataaaaatataagagatatatggtcttcgatgctgtggcacaagtggactagtggttgtcattttacgcgctcaaaatgtaaccgaacgaggcgccgtcatggatcactatcaaaagcagcttagtaccgaattaacatatgtggctacaaatgctaatcagctaaatgataggaaagattgattgctactgatagacatggattgacgctttcagtttgttggagcccttgatttggcactttcacgacgataatccgcaaggataattctccaagtcatattttgcaacaaaatacaactacatctagtttaatttcctctaagttagtaagttgtgactgcaaattaacaagtgtattgatgtccgaaacctagctagatgaaggttatgtacattggatagggatcgaaagaaaatagacagaaacagagaacgataagtcaactgcaagcacatactcccttcatactcataaaggaagtcgtttaagacaatgtttaagtcaaaccttgagattataaatcataaataactctcaagttgttgagtttgaaaatgtaaaaattatatgaataaatttgtcttgaaaaatactttcataaaagtatacatatatcacttttcaatgaatatttttatagaaagaagaagtcaaagttgtattttggagaccgtgtcgatgtcctaaacgactttctttatgaggatggagggagtatatatactctgtacttaagtatacgataatgttatctttgttcagtgaaacttttggaactttgattgttactagctatcaaaatgtttagtttgagaatataaaaattattaatattataattttgttagatattatcgttatgttttaataaaacaacggtggtcaaagtagtacacaccaaacaccgaatgaagtcaacatcggtgtgtgtatatatatacgcggaggtagtacatggtacaacttttgaattaaactcccgaaaaacatatgttctcatgcatgcttttgtatacagatatgatatagctctaaattaataacttgcatgacggaaattgaacatatttgctacactgaattatactgcgtgaaccttaatttgcttatatattctcatgcttgctgcaggtacctgccaccttacaccactttcgtacctgtccaagacaaacaccagcaaacgggagcacagtccgggcaggagggcagcagcagcagcagcatatggcagaagctgctcatgtcgccgctctcgtgcctagccatcttcatcgtcgtcatctgcatcacggagcggcggcaaatcgccgacgaccccatcaactacagcgtcctcaacatcgtcgtcgaggttatcaggtacgcatagtggtggtctaaccttaattttaactgctggcaagtgccaaaaaattactctctccatctctaaatatttgacgccgttgactttttaaaacattttgaccgttcgtcttatcaaaatttttaagtaattattaattcttttcctatcatttgatttattactaaatatatttttatgtatacatataattttacatatttctcaaaagtttttgaataagacgaacggttaaacatgtttaaaaaagtcaacaacgtcaaatatttagggacagagagtatatttcccccttgagggtacatacatttctcctcgtttttatatgtcatcccaaaaattacaaaagaaaatctaaaagttattgataaaatggacatgtgatatattactacactaatatatacacgttcaaatataacttgaacacatgttagaaaaacacaataaatttaactataaatggcatgttcaattcgcaattaaatttaatattttatttctgtttgaacaaattgaatatcatatatttaaaaagagattaattaatgattttttaaacgaatggataaaataagagaaagtgaggaaaatccacatccacggagataatatatataactagaaccatcgtgtaaactaactatatgttacatactcctggatgcagtgcgtatggcaatgtggggttcagcacggggtacagctgcgcgaggcaggtgaggcccgacggcagctgcagagacctgtgggttggcttctcagggaagtggagcaaacaagggaagctcactctcatggccgtcatgttctacggcaggctcaagaagttcagcctgcacggtggtcaggcatggaagatagaataacgcctaactgcaagcacccatgcatgcatgacaacttcgttactaattaatggggcatttcagccggccgccgtactagactacaagagatcgatcgataggtctcccctcctaaaactcctccttaatctgatctccacgagttcttgatcagggttacttatatattataaaggaatgatcagataaatatatgtctatatcaggatctggtcgatctctagatatctgtcttttttttttttgggtaatgcatgtaagcaagtagcaattgctagacatatatatgtgttagcttacgagagtatatactggcgcttgagtcgtgatg</dnaseqindica>|
Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001049383.1 RefSeq:Os01g0307500]|
}}
[[Category:Genes]]
[[Category:Japonica mRNA]]
[[Category:Oryza Sativa Japonica Group]]
[[Category:Japonica Genes]]
[[Category:Japonica Chromosome 1]]
[[Category:Chromosome 1]]

← Older revision		Revision as of 01:24, 27 March 2017
Line 31:		Line 31:
	<ref name="pmid: 10759522">Uozumi, N. et al. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus laevis Oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiol.122, 1249–1259 (2000). </ref>		<ref name="pmid: 10759522">Uozumi, N. et al. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus laevis Oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiol.122, 1249–1259 (2000). </ref>
	</references>		</references>
		+	<br>

← Older revision		Revision as of 01:24, 27 March 2017
Line 1:		Line 1:
−	~~Please input one-sentence summary here.~~
	The introduction of the gene SKC1.		The introduction of the gene SKC1.
	==Annotated Information==		==Annotated Information==

@@ Line 14: / Line 14: @@
 ===Evolution===
-Comparison of the genomic and cDNA sequences of the Nona Bokra allele of SKC1 identified three exons and two introns. SKC1 is predicted to encode a 554–amino acid polypeptide of B60 kDa. Database searches showed substantial similarity between SKC1 and the HKT-type transporters found in plants, bacteria and fungi8–10. SKC1 protein showed 44%, 48%, 44%, and 41% identity to wheat TaHKT1, Arabidopsis thaliana AtHKT1 <ref name="pmid: 10759522"/> and rice OsHKT1 and OsHKT4 <ref name="pmid:12795699"/>, respectively. Seven HKT members and two pseudo genes have been identified from the rice genomic database by homology search12. SKC1 corresponded to OsHKT8. The physiological function of HKT members in rice has not previously been studied.
+Comparison of the genomic and cDNA sequences of the Nona Bokra allele of SKC1 identified three exons and two introns. SKC1 is predicted to encode a 554–amino acid polypeptide of B60 kDa. Database searches showed substantial similarity between SKC1 and the HKT-type transporters found in plants, bacteria and fungi8–10. SKC1 protein showed 44%, 48%, 44%, and 41% identity to wheat TaHKT1, Arabidopsis thaliana AtHKT1 <ref name="pmid: 10759522"/> and rice OsHKT1 and OsHKT4, respectively. Seven HKT members and two pseudo genes have been identified from the rice genomic database by homology search12. SKC1 corresponded to OsHKT8. The physiological function of HKT members in rice has not previously been studied.SKC1 also controlled Na+ accumulation and encoded a Na+ transporter belonging to the HKT family.
 ==Labs working on this gene==

@@ Line 24: / Line 24: @@
 <ref name="pmid:14513218">Lin, H.X. et al. QTLs for Na+ and K+ uptake of shoot and root controlling rice salt tolerance. Theor. Appl. Genet. 108, 253–260 (2004). </ref>
-<ref name="pmid:15347782"/>Qi, Z. & Spalding, E.P. Protection of plasma membrane K+ transport by the salt overlysensitive1 Na+/H+ antiporter during salinity stress. Plant Physiol. 136, 2548–2555
+<ref name="pmid:15347782">Qi, Z. & Spalding, E.P. Protection of plasma membrane K+ transport by the salt overlysensitive1 Na+/H+ antiporter during salinity stress. Plant Physiol. 136, 2548–2555
 (2004). </ref>
-<ref name="pmid:21317882"/>Cao Y, Jin X, Huang H, Derebe MG, Levin EJ, et al. (2011) Crystal structure of a potassium ion transporter, TrkH. Nature 471: 336–340. </ref>.
+<ref name="pmid:21317882">Cao Y, Jin X, Huang H, Derebe MG, Levin EJ, et al. (2011) Crystal structure of a potassium ion transporter, TrkH. Nature 471: 336–340. </ref>.
-<ref name="pmid:7502075"/>Rubio, F., Gassmann, W. & Schroeder, J.I. Sodium-driven potassium uptake by theplant potassium transporter HKT1 and mutations conferring salt tolerance. Science
+<ref name="pmid:7502075">Rubio, F., Gassmann, W. & Schroeder, J.I. Sodium-driven potassium uptake by theplant potassium transporter HKT1 and mutations conferring salt tolerance. Science
 , 1660–1663 (1995). </ref>
-<ref name="pmid:8953248"/>Gassman, W., Rubio, F. & Schroeder, J.I. Alkali cation selectivity of the wheat root highaffinity potassium transporter HKT1. Plant J. 10, 869–882 (1996). </ref>
+<ref name="pmid:8953248">Gassman, W., Rubio, F. & Schroeder, J.I. Alkali cation selectivity of the wheat root highaffinity potassium transporter HKT1. Plant J. 10, 869–882 (1996). </ref>
-<ref name="pmid:12727868"/>Berthomieu, P. et al. Functional analysis of AtHKT1 in Arabidopsis shows that Na+recirculation by the phloem is crucial for salt tolerance. EMBO J. 22, 2004–2014 (2003). </ref>
+<ref name="pmid:12727868">Berthomieu, P. et al. Functional analysis of AtHKT1 in Arabidopsis shows that Na+recirculation by the phloem is crucial for salt tolerance. EMBO J. 22, 2004–2014 (2003). </ref>
-<ref name="pmid: 10759522"/>Uozumi, N. et al. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus laevis Oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiol.122, 1249–1259 (2000). </ref>
+<ref name="pmid: 10759522">Uozumi, N. et al. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus laevis Oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiol.122, 1249–1259 (2000). </ref>
 </references>

@@ Line 1: / Line 1: @@
 Please input one-sentence summary here.
+The introduction of the gene SKC1.
 ==Annotated Information==
 ===Function===
 This gene control the express of the protein HKT family. The HKT family of Na+ and Na+/K+ transporters is implicated in plant salinity tolerance. The cereal HKT1;4 and HKT1;5 are responsible for Na+ exclusion from photosynthetic tissues, a key mechanism for plant salinity tolerance.
-We previously mapped a rice QTL, SKC1, that maintained K+ homeostasis in the salt-tolerant variety under salt stress<ref name="pmid:14513218" />, consistent with the earlier finding that K+ homeostasis is important in salt tolerance <ref name="pmid:15347782" />.
+We previously mapped a rice QTL, SKC1, that maintained K+ homeostasis in the salt-tolerant variety under salt stress<ref name="pmid:14513218"/>, consistent with the earlier finding that K+ homeostasis is important in salt tolerance <ref name="pmid:15347782"/>.
 It encoded a member of HKT-type transporters. SKC1 is preferentially expressed in the parenchyma cells surrounding the xylem vessels. Voltage-clamp.
 SKC1 protein functions as a Na+-selective transporter. Physiological analysis suggested that SKC1 is involved in regulating K+/Na+ homeostasis under salt stress, providing a potential tool for improving salt tolerance in crops.
@@ Line 11: / Line 10: @@
 ===Expression===
-The work described here provides evidence for a crucial amino acid substitution which determines Na+ transport efficiency of OsHKT1;5. The recently solved structure of a highly similar TrkH K+ transporter<ref name="pmid:21317882 " />provided the basis for three-dimensional(3D) molecular modeling of OsHKT1;5 and OsHKT1;4.
+The work described here provides evidence for a crucial amino acid substitution which determines Na+ transport efficiency of OsHKT1;5. The recently solved structure of a highly similar TrkH K+ transporter<ref name="pmid:21317882"/>provided the basis for three-dimensional(3D) molecular modeling of OsHKT1;5 and OsHKT1;4.
-Different HKT members may have different transport properties.The founding member of the HKT family, TaHKT1, mediates K+/Na+symport and Na+ transport whereas AtHKT1 selectively transportsNa+. In rice, OsHKT1, like AtHKT1, transports Na+only and OsHKT2 mediates TaHKT1-like K+/Na+ symport. Toassess the functional property of SKC1.<ref name="pmid:7502075 " />,<ref name="pmid:8953248 " />. NSKC1 is a more active allele than KSKC1,which might contribute to the difference in ionic homeostasis and salt tolerance, a salt-sensitive allele of AtHKT1 encodes a mutant protein with lower transport activity<ref name="pmid:12727868 " />.The KSKC1 allele encodes a protein with lower transport activity that also leads to a salt sensitive phenotype in rice seedlings.
+Different HKT members may have different transport properties.The founding member of the HKT family, TaHKT1, mediates K+/Na+symport and Na+ transport whereas AtHKT1 selectively transportsNa+. In rice, OsHKT1, like AtHKT1, transports Na+only and OsHKT2 mediates TaHKT1-like K+/Na+ symport. Toassess the functional property of SKC1.<ref name="pmid:7502075"/>,<ref name="pmid:8953248"/>. NSKC1 is a more active allele than KSKC1,which might contribute to the difference in ionic homeostasis and salt tolerance, a salt-sensitive allele of AtHKT1 encodes a mutant protein with lower transport activity<ref name="pmid:12727868 " />.The KSKC1 allele encodes a protein with lower transport activity that also leads to a salt sensitive phenotype in rice seedlings.
 ===Evolution===
-Comparison of the genomic and cDNA sequences of the Nona Bokra allele of SKC1 identified three exons and two introns. SKC1 is predicted to encode a 554–amino acid polypeptide of B60 kDa. Database searches showed substantial similarity between SKC1 and the HKT-type transporters found in plants, bacteria and fungi8–10. SKC1 protein showed 44%, 48%, 44%, and 41% identity to wheat TaHKT1, Arabidopsis thaliana AtHKT1 <ref name="pmid: 10759522 " /> and rice OsHKT1 and OsHKT4 <ref name="pmid: 12795699 " />, respectively. Seven HKT members and two pseudo genes have been identified from the rice genomic database by homology search12. SKC1 corresponded to OsHKT8. The physiological function of HKT members in rice has not previously been studied.
+Comparison of the genomic and cDNA sequences of the Nona Bokra allele of SKC1 identified three exons and two introns. SKC1 is predicted to encode a 554–amino acid polypeptide of B60 kDa. Database searches showed substantial similarity between SKC1 and the HKT-type transporters found in plants, bacteria and fungi8–10. SKC1 protein showed 44%, 48%, 44%, and 41% identity to wheat TaHKT1, Arabidopsis thaliana AtHKT1 <ref name="pmid: 10759522"/> and rice OsHKT1 and OsHKT4 <ref name="pmid:12795699"/>, respectively. Seven HKT members and two pseudo genes have been identified from the rice genomic database by homology search12. SKC1 corresponded to OsHKT8. The physiological function of HKT members in rice has not previously been studied.
@@ Line 25: / Line 24: @@
 <ref name="pmid:14513218">Lin, H.X. et al. QTLs for Na+ and K+ uptake of shoot and root controlling rice salt tolerance. Theor. Appl. Genet. 108, 253–260 (2004). </ref>
-<ref name="pmid:15347782" />Qi, Z. & Spalding, E.P. Protection of plasma membrane K+ transport by the salt overlysensitive1 Na+/H+ antiporter during salinity stress. Plant Physiol. 136, 2548–2555
+<ref name="pmid:15347782"/>Qi, Z. & Spalding, E.P. Protection of plasma membrane K+ transport by the salt overlysensitive1 Na+/H+ antiporter during salinity stress. Plant Physiol. 136, 2548–2555
 (2004). </ref>
-<ref name="pmid:21317882 " />Cao Y, Jin X, Huang H, Derebe MG, Levin EJ, et al. (2011) Crystal structure of a potassium ion transporter, TrkH. Nature 471: 336–340. </ref>.
+<ref name="pmid:21317882"/>Cao Y, Jin X, Huang H, Derebe MG, Levin EJ, et al. (2011) Crystal structure of a potassium ion transporter, TrkH. Nature 471: 336–340. </ref>.
-<ref name="pmid: 7502075 " />Rubio, F., Gassmann, W. & Schroeder, J.I. Sodium-driven potassium uptake by theplant potassium transporter HKT1 and mutations conferring salt tolerance. Science
+<ref name="pmid:7502075"/>Rubio, F., Gassmann, W. & Schroeder, J.I. Sodium-driven potassium uptake by theplant potassium transporter HKT1 and mutations conferring salt tolerance. Science
 , 1660–1663 (1995). </ref>
-<ref name="pmid: 8953248 " />Gassman, W., Rubio, F. & Schroeder, J.I. Alkali cation selectivity of the wheat root highaffinity potassium transporter HKT1. Plant J. 10, 869–882 (1996). </ref>
+<ref name="pmid:8953248"/>Gassman, W., Rubio, F. & Schroeder, J.I. Alkali cation selectivity of the wheat root highaffinity potassium transporter HKT1. Plant J. 10, 869–882 (1996). </ref>
-<ref name="pmid:12727868 " />Berthomieu, P. et al. Functional analysis of AtHKT1 in Arabidopsis shows that Na+recirculation by the phloem is crucial for salt tolerance. EMBO J. 22, 2004–2014 (2003). </ref>
+<ref name="pmid:12727868"/>Berthomieu, P. et al. Functional analysis of AtHKT1 in Arabidopsis shows that Na+recirculation by the phloem is crucial for salt tolerance. EMBO J. 22, 2004–2014 (2003). </ref>
-<ref name="pmid: 10759522 " />Uozumi, N. et al. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus laevis Oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiol.122, 1249–1259 (2000). </ref>
+<ref name="pmid: 10759522"/>Uozumi, N. et al. The Arabidopsis HKT1 gene homolog mediates inward Na+ currents in Xenopus laevis Oocytes and Na+ uptake in Saccharomyces cerevisiae. Plant Physiol.122, 1249–1259 (2000). </ref>
 </references>

← Older revision		Revision as of 18:49, 22 July 2012
Line 1:		Line 1:
		+	Please input one-sentence summary here.
		+
		+	==Annotated Information==
		+	===Function===
		+	Please input function information here.
		+
		+	===Expression===
		+	Please input expression information here.
		+
		+	===Evolution===
		+	Please input evolution information here.
		+
		+	You can also add sub-section(s) at will.
		+
		+	==Labs working on this gene==
		+	Please input related labs here.
		+
		+	==References==
		+	Please input cited references here.
		+
		+	==Structured Information==
	{{JaponicaGene\|		{{JaponicaGene\|
	GeneName = Os01g0307500\|		GeneName = Os01g0307500\|