Os01g0704100 - Revision history

192.168.72.52 at 04:53, 14 May 2015

2015-05-14T04:53:42Z

Lynne: /* Evolution */

2014-06-09T13:14:49Z

‎Evolution

Lynne: /* References */

2014-06-09T13:13:45Z

‎References

Lynne: /* Annotated Information */

2014-06-09T11:25:51Z

‎Annotated Information

Lynne: /* Annotated Information */

2014-06-09T11:21:12Z

‎Annotated Information

Lynne: /* References */

2014-06-09T11:20:10Z

‎References

Lynne: /* References */

2014-06-09T11:19:35Z

‎References

Lynne: /* Labs working on this gene */

2014-06-09T11:18:49Z

‎Labs working on this gene

Lynne: /* Expression */

2014-06-09T10:00:29Z

‎Expression

Lynne: /* Labs working on this gene */

2014-06-09T09:47:50Z

‎Labs working on this gene

← Older revision		Revision as of 04:53, 14 May 2015
Line 45:		Line 45:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0704100\|~~
−	~~Description = Similar to Membrane transporter\|~~
−	~~Version = NM_001050538.1 GI:115439446 GeneID:4324249\|~~
−	~~Length = 2087 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0704100, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:30944695..30946781\|~~
−	~~CDS = 30944917..30945104,30945195..30946467\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:30944695..30946781~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:30944695..30946781~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggaggctaagccggtggcgatggaggtggagggggtcgaggcggcggggggcaagccgcggttcaggatgccggtggactccgacctcaaggcgacggagttctggctcttctccttcgcgaggccacacatggcctccttccacatggcgtggttctccttcttctgctgcttcgtgtccacgttcgccgtgttcgcgcgtctggccatgggcacggcgtgcgacctggtcgggcccaggctggcctccgcgtctctgatcctcctcaccacaccggcggtgtactgctcctccatcatccagtccccgtcggggtacctcctcgtgcgcttcttcacgggcatctcgctggcgtcgttcgtgtcggcgcagttctggatgagctccatgttctcggcccccaaagtggggctggccaacggcgtggccggcggctggggcaacctcggcggcggcgccgtccagctgctcatgccgctcgtgtacgaggccatccacaagatcggtagcacgccgttcacggcgtggcgcatcgccttcttcatcccgggcctgatgcagacgttctcggccatcgccgtgctggcgttcgggcaggacatgcccggcggcaactacgggaagctccacaagactggcgacatgcacaaggacagcttcggcaacgtgctgcgccacgccctcaccaactaccgcggctggatcctggcgctcacctacggctacagcttcggcgtcgagctcaccatcgacaacgtcgtgcaccagtacttctacgaccgcttcgacgtcaacctccagaccgccgggctcatcgccgccagcttcgggatggccaacatcatctcccgccccggcggcgggctactctccgactggctctccagccggtacggcatgcgcggcaggctgtgggggctgtggactgtgcagaccatcggcggcgtcctctgcgtggtgctcggaatcgtcgacttctccttcgccgcgtccgtcgccgtgatggtgctcttctccttcttcgtccaggccgcgtgcgggctcaccttcggcatcgtgccgttcgtgtcgcggaggtcgctggggctcatctccgggatgaccggcggcgggggcaacgtgggcgccgtgctgacgcagtacatcttcttccacggcacaaagtacaagacggagaccgggatcaagtacatggggctcatgatcatcgcgtgcacgctgcccgtcatgctcatctacttcccgcagtggggcggcatgctcgtaggcccgaggaagggggccacggcggaggagtactacagccgggagtggtcggatcacgagcgcgagaagggtttcaacgcggccagcgtgcggttcgcggagaacagcgtgcgcgagggcgggaggtcgtcggcgaatggcggacagcccaggcacaccgtccccgtcgacgcgtcgccggccggggtgtga</cdnaseq>\|
−	AA = <aaseq>MEAKPVAMEVEGVEAAGGKPRFRMPVDSDLKATEFWLFSFARPH MASFHMAWFSFFCCFVSTFAVFARLAMGTACDLVGPRLASASLILLTTPAVYCSSIIQ SPSGYLLVRFFTGISLASFVSAQFWMSSMFSAPKVGLANGVAGGWGNLGGGAVQLLMP LVYEAIHKIGSTPFTAWRIAFFIPGLMQTFSAIAVLAFGQDMPGGNYGKLHKTGDMHK DSFGNVLRHALTNYRGWILALTYGYSFGVELTIDNVVHQYFYDRFDVNLQTAGLIAAS FGMANIISRPGGGLLSDWLSSRYGMRGRLWGLWTVQTIGGVLCVVLGIVDFSFAASVA VMVLFSFFVQAACGLTFGIVPFVSRRSLGLISGMTGGGGNVGAVLTQYIFFHGTKYKT ETGIKYMGLMIIACTLPVMLIYFPQWGGMLVGPRKGATAEEYYSREWSDHEREKGFNA ASVRFAENSVREGGRSSANGGQPRHTVPVDASPAGV</aaseq>\|
−	DNA = <dnaseqindica>223..410#501..1773#agcgccggcctcccaccggtcgcgtaagatcacgcccgaaatctttattcattttctctccaccggttgccctctcgccgcacccaaccatcgcgccacgccgcgccgcgctgccggagccgcgctttccgctatgctataagagctgacgcgcagggcacagcggatgtacgtacacacagtcactagctaagctgctagccttgctaccacgtgttggagatggaggctaagccggtggcgatggaggtggagggggtcgaggcggcggggggcaagccgcggttcaggatgccggtggactccgacctcaaggcgacggagttctggctcttctccttcgcgaggccacacatggcctccttccacatggcgtggttctccttcttctgctgcttcgtgtccacgttcgccgcgccgccgctgctgccgctcatccgcgacaccctcgggctcacggccacggacatcggcaacgccgggatcgcgtccgtgtcgggcgccgtgttcgcgcgtctggccatgggcacggcgtgcgacctggtcgggcccaggctggcctccgcgtctctgatcctcctcaccacaccggcggtgtactgctcctccatcatccagtccccgtcggggtacctcctcgtgcgcttcttcacgggcatctcgctggcgtcgttcgtgtcggcgcagttctggatgagctccatgttctcggcccccaaagtggggctggccaacggcgtggccggcggctggggcaacctcggcggcggcgccgtccagctgctcatgccgctcgtgtacgaggccatccacaagatcggtagcacgccgttcacggcgtggcgcatcgccttcttcatcccgggcctgatgcagacgttctcggccatcgccgtgctggcgttcgggcaggacatgcccggcggcaactacgggaagctccacaagactggcgacatgcacaaggacagcttcggcaacgtgctgcgccacgccctcaccaactaccgcggctggatcctggcgctcacctacggctacagcttcggcgtcgagctcaccatcgacaacgtcgtgcaccagtacttctacgaccgcttcgacgtcaacctccagaccgccgggctcatcgccgccagcttcgggatggccaacatcatctcccgccccggcggcgggctactctccgactggctctccagccggtacggcatgcgcggcaggctgtgggggctgtggactgtgcagaccatcggcggcgtcctctgcgtggtgctcggaatcgtcgacttctccttcgccgcgtccgtcgccgtgatggtgctcttctccttcttcgtccaggccgcgtgcgggctcaccttcggcatcgtgccgttcgtgtcgcggaggtcgctggggctcatctccgggatgaccggcggcgggggcaacgtgggcgccgtgctgacgcagtacatcttcttccacggcacaaagtacaagacggagaccgggatcaagtacatggggctcatgatcatcgcgtgcacgctgcccgtcatgctcatctacttcccgcagtggggcggcatgctcgtaggcccgaggaagggggccacggcggaggagtactacagccgggagtggtcggatcacgagcgcgagaagggtttcaacgcggccagcgtgcggttcgcggagaacagcgtgcgcgagggcgggaggtcgtcggcgaatggcggacagcccaggcacaccgtccccgtcgacgcgtcgccggccggggtgtgaagaatgccacggacaataaggtcgcggttgtagtacaactgtacaaattgatggtacgtgtcgtttgaccgcgcgcgcgcacagtgtgggtcgtggcctcgtgggcttagtggagtacagtgaggggtgtacgtgtgtcgtggcgcgcgcggtcacctcggtggccttgggattgggggggcactatacgctagtactccagatatatacgggtttgatttacttctgtggatcggcgcttgttggtggtttgctccctgtggtttttgtgatggtaatcatactcatactcaaacagtcaaaactttttgatg</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050538.1 RefSeq:Os01g0704100]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 26: / Line 26: @@
 ===Evolution===
-Please input evolution information here.
+ One gene OsNRT2.3 was mRNA spliced into OsNRT2.3a and OsNRT2.3b and OsNAR2.1 interacts with OsNRT2.1/2.2 and OsNRT2.3a to provide nitrate uptake. Using promoter-GUS reporter plants and semi-quantitative RT-PCR analyses, it was observed that OsNAR2.1 was expressed mainly in the root epidermal cells, differently from the five OsNRT2 genes. OsNAR2.1, OsNRT2.1, OsNRT2.2, and OsNRT2.3a were up-regulated by nitrate and suppressed by NH(4)(+) and high root temperature (37 °C). Expression of all these genes was increased by light or external sugar supply. Root transcripts of OsNRT2.3b and OsNRT2.4 were much less abundant and not affected by temperature. Expression of OsNRT2.3b was insensitive to the form of N supply. Expression of OsNRT2.4 responded to changes in auxin supply unlike all the other NRT2 genes. A region from position -311 to -1, relative to the translation start site in the promoter region of OsNAR2.1, was found to contain the cis-element(s) necessary for the nitrate-, but not light- and sugar-dependent activation. However, it was difficult to define a conserved cis-element in the promoters of the nitrate-regulated OsNRT2/OsNAR2 genes. The results imply distinct physiological functions for each OsNRT2 transporter, and differential regulation pathways by N and C status.
 ==Labs working on this gene==

@@ Line 44: / Line 44: @@
 、The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971
 、The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11. PMID 16100779
 ==Structured Information==

@@ Line 2: / Line 2: @@
 ==Annotated Information==
-   The gene name of High-affinity Nitrate Transporter is OsNRT2.3, it located on Chromosome 1.It's Genomic Sequence in NCBI is NC_008394.4.
+、The gene name of High-affinity Nitrate Transporter is OsNRT2.3, it located on Chromosome 1.It's Genomic Sequence in NCBI is NC_008394.4. It is a protein coding gene.
 ===Function===

@@ Line 2: / Line 2: @@
 ==Annotated Information==
-   The gene name of High-affinity Nitrate Transporter is OsNRT2.3, it located on Chromosome 1.
+   The gene name of High-affinity Nitrate Transporter is OsNRT2.3, it located on Chromosome 1.It's Genomic Sequence in NCBI is NC_008394.4.
 ===Function===

@@ Line 30: / Line 30: @@
    Knockdown of a Rice Stelar Nitrate Transporter Alters Long-Distance Translocation But Not Root Influx
    Plant Physiology, 2012, 160(4): 2052-2063
-、The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan. PMID 18089549, Free PMC Article
+、The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan. PMID 18089549
-、Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb. PMID 17210932, Free PMC Article
+、Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb. PMID 17210932
-、The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971, Free PMC Article
+、The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971
 、The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11. PMID 16100779

@@ Line 27: / Line 27: @@
 ==References==
-   Zhong Tang;Xiaorong Fan;Qing Li;Huimin Feng;Anthony J. Miller;Qirong Shen;Guohua Xu
+、Zhong Tang;Xiaorong Fan;Qing Li;Huimin Feng;Anthony J. Miller;Qirong Shen;Guohua Xu
    Knockdown of a Rice Stelar Nitrate Transporter Alters Long-Distance Translocation But Not Root Influx
    Plant Physiology, 2012, 160(4): 2052-2063
 ==Structured Information==

@@ Line 23: / Line 23: @@
 State Key Laboratory of Crop Genetics and Ge rmplas m E nhancement a nd Ke y Laboratory of Plant Nutrition
 and F erti lization in L ow -Mid dle R each es of th e Yan gtze River, Ministry of Agriculture, Nanjing Agricultural
-University, N anjing 210095, China (Z.T., X.F., Q.L., H .F. , Q.S., G .X.); a nd Diseas e a nd Stress Biology
+University, N anjing 210095, China ; Disease a nd Stress Biology
-Department, J ohn Innes Center, N orwich NR4 7UH, U ni te d Kingdom (A.J.M .)
+Department, J ohn Innes Center, N orwich NR4 7UH, U ni te d Kingdom
 ==References==

@@ Line 11: / Line 11: @@
 ===Expression===
     In the field growth conditions, OsNRT2.3 mainly express in the root, it also express in the leaf and other parts in a low expression level. In the whole growing period, the amount of OsNRT2.3 expression in leaves increased with the growth of the plant, it reaches a maximum value in the vegetative growth to reproductive growth transition stage , then decrease to a relatively stable range. Rice protoplast subcellular localization experiments showed that OsNRT2.3 is transmembrane protein of plasma membrane localization, this is consistent with bioinformatics prediction results.
 ===Evolution===