Os01g0730700 - Revision history

192.168.72.52 at 04:55, 14 May 2015

2015-05-14T04:55:12Z

Shaowenbo at 14:45, 28 May 2014

2014-05-28T14:45:12Z

Shaowenbo: /WRKY14 is a candidate transcription factor for MeOH-induced Trp and serotonin biosynthesis /

2014-05-28T14:29:53Z

‎WRKY14 is a candidate transcription factor for MeOH-induced Trp and serotonin biosynthesis

Shaowenbo: /* Annotated Information */

2014-05-28T14:17:24Z

‎Annotated Information

Shaowenbo: /* Annotated Information */

2014-05-28T14:00:49Z

‎Annotated Information

Shaowenbo: /* Annotated Information */

2014-05-28T13:45:23Z

‎Annotated Information

Shaowenbo: /* Annotated Information */

2014-05-28T13:28:41Z

‎Annotated Information

Shaowenbo at 12:31, 28 May 2014

2014-05-28T12:31:08Z

Shaowenbo: /* Annotated Information */

2014-05-28T11:39:19Z

‎Annotated Information

Shaowenbo: /* Labs working on this gene */

2014-05-28T11:26:50Z

‎Labs working on this gene

← Older revision		Revision as of 04:55, 14 May 2015
Line 35:		Line 35:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0730700\|~~
−	~~Description = WRKY transcription factor 14 (WRKY14)\|~~
−	~~Version = NM_001050679.1 GI:115439728 GeneID:4324426\|~~
−	~~Length = 1736 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0730700, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:32235960..32237695\|~~
−	~~CDS = 32236503..32237121,32237255..32237595\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:32235960..32237695~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:32235960..32237695~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggacggcgagtggagcgacggggcggcggtgtcgtcgccgacgatgtccggcggcggcgggcgggagcagatgaagggcggggaggacgtcgctgcggcggattgcccggggtcgccggtgtcaccgtcaccggcagctgctcagcggtcggcggctggggcggcggcgtcgcctagcgggaggtcgaggcggtcggcgcagaagcgggtggtgaccgtgccgctggccgacgtgaccgggccgcggccgaagggcgtcggggagggcaacacgccgaccgactcgtgggcgtggcggaagtacggccagaagcccatcaaaggctcaccctttccaagggcttactaccggtgcagcagctcgaaggggtgcccggcgaggaagcaggtggagaggagccggaacgacccggacacggtgatcgtcacctactccttcgagcacaaccactccgccacggtgcccagggcgcagaaccggcaggcggcgccgcagaagcccaaggcgcaggcctgcagtccgccggagccggtggtggaagtggaacccgaggaaacgcaccagtacggcgtcaccgccgggcctgccaccggtggcggcggcggcgcggcggccatcgaggtgcgcgacgagttccggtggctctacgacgtcgtgtccgtcccagccacgtcgacctcgccctccgacatcgacgcggccgacgagatgcagctgtacgatcagccgatgttctttggcggcgccgtcgtcggcacggccgcgctcctccccgacgagttcggcgacgtcggcgggttaggcggggaggggctgggcgaggaggaggcgttgttcgaggggctcggcgagctgccggagtgcgccatggtgttccggcggcgcgccggcgacgggctggagatgggaggaggggttaagatcgagcagccggcggagagcacggccatgacatga</cdnaseq>\|
−	AA = <aaseq>MDGEWSDGAAVSSPTMSGGGGREQMKGGEDVAAADCPGSPVSPS PAAAQRSAAGAAASPSGRSRRSAQKRVVTVPLADVTGPRPKGVGEGNTPTDSWAWRKY GQKPIKGSPFPRAYYRCSSSKGCPARKQVERSRNDPDTVIVTYSFEHNHSATVPRAQN RQAAPQKPKAQACSPPEPVVEVEPEETHQYGVTAGPATGGGGGAAAIEVRDEFRWLYD VVSVPATSTSPSDIDAADEMQLYDQPMFFGGAVVGTAALLPDEFGDVGGLGGEGLGEE EALFEGLGELPECAMVFRRRAGDGLEMGGGVKIEQPAESTAMT</aaseq>\|
−	DNA = <dnaseqindica>575..1193#101..441#gtagctggcgctggtgacggcatccatccaagaactgcctccttgatccatccattcccggcggacagatcacgccgccggccggctcttgtgtatatatatggacggcgagtggagcgacggggcggcggtgtcgtcgccgacgatgtccggcggcggcgggcgggagcagatgaagggcggggaggacgtcgctgcggcggattgcccggggtcgccggtgtcaccgtcaccggcagctgctcagcggtcggcggctggggcggcggcgtcgcctagcgggaggtcgaggcggtcggcgcagaagcgggtggtgaccgtgccgctggccgacgtgaccgggccgcggccgaagggcgtcggggagggcaacacgccgaccgactcgtgggcgtggcggaagtacggccagaagcccatcaaaggctcaccctttccaaggtaaaatacacaccacgacacacgaatcgatgccatggcatcgaatatcgatcgagttcttttgtaagttttgccatgaattggaggggtttttgtgctgatctagctaggcttggggcttcgtgatgagcagggcttactaccggtgcagcagctcgaaggggtgcccggcgaggaagcaggtggagaggagccggaacgacccggacacggtgatcgtcacctactccttcgagcacaaccactccgccacggtgcccagggcgcagaaccggcaggcggcgccgcagaagcccaaggcgcaggcctgcagtccgccggagccggtggtggaagtggaacccgaggaaacgcaccagtacggcgtcaccgccgggcctgccaccggtggcggcggcggcgcggcggccatcgaggtgcgcgacgagttccggtggctctacgacgtcgtgtccgtcccagccacgtcgacctcgccctccgacatcgacgcggccgacgagatgcagctgtacgatcagccgatgttctttggcggcgccgtcgtcggcacggccgcgctcctccccgacgagttcggcgacgtcggcgggttaggcggggaggggctgggcgaggaggaggcgttgttcgaggggctcggcgagctgccggagtgcgccatggtgttccggcggcgcgccggcgacgggctggagatgggaggaggggttaagatcgagcagccggcggagagcacggccatgacatgatgctgacacagacaggtgggcccggtccggcctccaataagaccagacaagctcctgtagtttttggcttcttgttcacttgccaattgtcggttagtttttttccctcctcattttggttattctctacagtagcatacagaaaagaatcggtacaatattattattgcacactgttgattggagaaaggattgagagagacaagtcactttgtcaatggtttggttgaagatttttgttttctcctttggaaccatcaatggatacataaataaagattggaaaaaagaaacacagaaggattggaactccattttttgctctgaaaactctgcctatgtccttgtcatgttgcgcaaatggataacattgaattgttcattactacagaaaaaagttccacttaacgatttcgtgtcagacccaaattctgagcattgtctgcaatagaagggctgtctttgttcacgatctgatcgacggaacatcatgttatatatgaattgcaacgacagatgaatcaaataaaatgtaattttatt</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050679.1 RefSeq:Os01g0730700]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 1: / Line 1: @@
-Please input one-sentence summary here.
+WRKY14 is a candidate transcription factor for MeOH-induced Trp and serotonin biosynthesis.
 ==Annotated Information==
 ===Function===

@@ Line 13: / Line 13: @@
 [[File:Pic4.jpg]]
 ===Expression===
-Please input expression information here.
+Among the dozen genes tested, OsWRKY24, -51, -71, and -72 are induced by abscisic acid (ABA) in aleurone cells. Using a transient expression system, we have demonstrated that OsWRKY24 and -45 repress ABA induction of the HVA22 promoter-β-glucuronidase construct, while OsWRKY72 and -77 synergistically interact with ABA to activate this reporter construct. This study provides a solid base for functional genomics studies of this important superfamily of regulatory genes in monocotyledonous plants and reveals a novel function for WRKY genes, i.e. mediating plant responses to ABA.
 ===Evolution===
 WRKY domains were initially defined by a nearly 60 amino acid long motif possessing the well-conserved amino acid signa-ture WRKYGQK at their N-terminus and containing a novel zinc finger-like structure of the form CX4–5CX22–23HXH.Variants of the WRKYGQK signa-ture motif include WRKYGKK and WRKYGEK. WRKY proteins containing a single WRKY domain are group II proteins; those with two are group I.Zhang and Wang (2005) have also proposed a different set of subgroups based on phylogenetic relationships.A third group, group III, contains a single WRKY domain with a variant zinc-finger CX7CX23HXC.Group IV WRKY proteins contain the WRKY

@@ Line 4: / Line 4: @@
 ===Function===
 Most WRKY proteins show a high binding affinity for the DNA sequence (T)(T)TGAC(C/T),also known as a W-box.
-During senescence of detached rice leaves, tryptophan (Trp) and Trp-derived secondary metabolites such as serotonin and 4-coumaroylserotonin accumulated in concert with methanol (MeOH) production. This senescence-induced MeOH induction was closely associated with levels of pectin methylesterase (PME)1 mRNA and PME enzyme activity. Exogenous challenge of detached rice leaves with 1% MeOH accelerated Trp and serotonin biosynthesis with induction of the corresponding genes.MeOH acts as an endogenous elicitor to enhance Trp biosynthesis.Approximately 800 genes were induced more than twofold in MeOH-treated leaves relative to those induced in water-treated leaves.All Trp biosynthetic genes were induced together with WRKY, Myb4, AP2/EREBP and ethylene-responsive tran-scription factors (ERTF), which have been implicated in plant biotic and abiotic responses.Only two WRKY genes,WRKY26 and WRKY14, from six WRKY transcription factors were suppressed significantly in the presence of cytokinin, and strikingly induced in the presence of ABA, indicating that WRKY26and WRKY14 seemed to be major transcription factors.
+During senescence of detached rice leaves, tryptophan (Trp) and Trp-derived secondary metabolites such as serotonin and 4-coumaroylserotonin accumulated in concert with methanol (MeOH) production. This senescence-induced MeOH induction was closely associated with levels of pectin methylesterase (PME)1 mRNA and PME enzyme activity. Exogenous challenge of detached rice leaves with 1% MeOH accelerated Trp and serotonin biosynthesis with induction of the corresponding genes.MeOH acts as an endogenous elicitor to enhance Trp biosynthesis.Approximately 800 genes were induced more than twofold in MeOH-treated leaves relative to those induced in water-treated leaves.All Trp biosynthetic genes were induced together with WRKY, Myb4, AP2/EREBP and ethylene-responsive tran-scription factors (ERTF), which have been implicated in plant biotic and abiotic responses.Only two WRKY genes,WRKY26 and WRKY14, from six WRKY transcription factors were suppressed significantly in the presence of cytokinin, and strikingly induced in the presence of ABA,suggesting that Trp and serotonin biosynthesis is mediated by WRKY tran-scription factors.
 [[File:Pic2.jpg]]
 Among many transcription factors induced following MeOH treatment, the WRKY family showed significant induction patterns, of which WRKY14 appeared to play a key regulatory role in MeOH-induced Trp and Trp-derived secondary metabolite biosynthesis.
 [[File:Pic3.jpg]]
-The purified WRKY14 polypeptides were used for the EMSA experiment.As shown in Pic3(d), WRKY14 bound to the TSa and TDC1 promoter W-box elements. Among several candidate W-box elements in the promoter sequences of TSa and TDC1, the strongest binding activity was observed for the TDC W5 sequence, which yielded two major DNA–protein complexes. In contrast, TSa W2 and TDC W1 revealed one major DNA–protein complex, whereas binding to theTSa W1 was negligible. The results suggest that WRKY14 interacts with the W-box elements of TS and TDC genes essential for Trp and serotonin biosynthesis.
+As shown in Pic3(d), WRKY14 bound to the TSa and TDC1 promoter W-box elements. Among several candidate W-box elements in the promoter sequences of TSa and TDC1, the strongest binding activity was observed for the TDC W5 sequence, which yielded two major DNA–protein complexes. In contrast, TSa W2 and TDC W1 revealed one major DNA–protein complex, whereas binding to theTSa W1 was negligible. The results suggest that WRKY14 interacts with the W-box elements of TS and TDC genes essential for Trp and serotonin biosynthesis.
+PME1 mRNA induction started at 12 h after senes-cence, followed by the induction of WRKY 26and WRKY14,suggesting that PME1-mediated MeOH production precedes
 ===Expression===
 Please input expression information here.

@@ Line 4: / Line 4: @@
 ===Function===
 Most WRKY proteins show a high binding affinity for the DNA sequence (T)(T)TGAC(C/T),also known as a W-box.
-During senescence of detached rice leaves, tryptophan (Trp) and Trp-derived secondary metabolites such as serotonin and 4-coumaroylserotonin accumulated in concert with methanol (MeOH) production. This senescence-induced MeOH induction was closely associated with levels of pectin methylesterase (PME)1 mRNA and PME enzyme activity. Exogenous challenge of detached rice leaves with 1% MeOH accelerated Trp and serotonin biosynthesis with induction of the corresponding genes.MeOH acts as an endogenous elicitor to enhance Trp biosynthesis.Approximately 800 genes were induced more than twofold in MeOH-treated leaves relative to those induced in water-treated leaves.All Trp biosynthetic genes were induced together with WRKY, Myb4, AP2/EREBP and ethylene-responsive tran-scription factors (ERTF), which have been implicated in plant biotic and abiotic responses.Only two WRKY genes,WRKY26 and WRKY14, from six WRKY transcription factors were suppressed significantly in the presence of cytokinin, and strikingly induced in the presence of ABA, indicating that WRKY26and WRKY14 seemed to be major transcription factors.[[File:Pic2.jpg]].
+During senescence of detached rice leaves, tryptophan (Trp) and Trp-derived secondary metabolites such as serotonin and 4-coumaroylserotonin accumulated in concert with methanol (MeOH) production. This senescence-induced MeOH induction was closely associated with levels of pectin methylesterase (PME)1 mRNA and PME enzyme activity. Exogenous challenge of detached rice leaves with 1% MeOH accelerated Trp and serotonin biosynthesis with induction of the corresponding genes.MeOH acts as an endogenous elicitor to enhance Trp biosynthesis.Approximately 800 genes were induced more than twofold in MeOH-treated leaves relative to those induced in water-treated leaves.All Trp biosynthetic genes were induced together with WRKY, Myb4, AP2/EREBP and ethylene-responsive tran-scription factors (ERTF), which have been implicated in plant biotic and abiotic responses.Only two WRKY genes,WRKY26 and WRKY14, from six WRKY transcription factors were suppressed significantly in the presence of cytokinin, and strikingly induced in the presence of ABA, indicating that WRKY26and WRKY14 seemed to be major transcription factors.
-Among many transcription factors induced following MeOH treatment, the WRKY family showed significant induction patterns, of which WRKY14 appeared to play a key regulatory role in MeOH-induced Trp and Trp-derived secondary metabolite biosynthesis.[[File:Pic3.jpg]]
+[[File:Pic2.jpg]]
 ===Expression===

@@ Line 11: / Line 11: @@
 Please input evolution information here.
-、Department of Biotechnology, Interdisciplinary Program of Graduate School for Bioenergy and Biomaterials；
+==Labs working on this gene==
-、Bioenergy Research Center, Chonnam National University, Gwangju, 500-757, Republic of Korea；
+.Department of Biotechnology, Interdisciplinary Program of Graduate School for Bioenergy and Biomaterials；
-、Departme nt of Biol ogical Sci ences, Uni versity of N evada；
+.Bioenergy Research Center, Chonnam National University, Gwangju, 500-757, Republic of Korea；
-、Bioinformatics Core, School of Life Sciences, University of Nevada
+.Departme nt of Biol ogical Sci ences, Uni versity of N evada；
 ==Structured Information==

Os01g0730700 - Revision history

192.168.72.52 at 04:55, 14 May 2015

Shaowenbo at 14:45, 28 May 2014

Shaowenbo: /*WRKY14 is a candidate transcription factor for MeOH-induced Trp and serotonin biosynthesis */

Shaowenbo: /* Annotated Information */

Shaowenbo: /* Annotated Information */

Shaowenbo: /* Annotated Information */

Shaowenbo: /* Annotated Information */

Shaowenbo at 12:31, 28 May 2014

Shaowenbo: /* Annotated Information */

Shaowenbo: /* Labs working on this gene */

Shaowenbo: /WRKY14 is a candidate transcription factor for MeOH-induced Trp and serotonin biosynthesis /