Os01g0733200 - Revision history

Xysj2012: /* References */

2017-03-21T13:40:50Z

‎References

FuhinWong at 03:56, 31 May 2014

2014-05-31T03:56:05Z

FuhinWong at 15:19, 30 May 2014

2014-05-30T15:19:10Z

FuhinWong at 14:46, 30 May 2014

2014-05-30T14:46:24Z

FuhinWong: /* Knowledge Extension */

2014-05-29T08:57:52Z

‎Knowledge Extension

FuhinWong at 08:48, 29 May 2014

2014-05-29T08:48:45Z

FuhinWong at 08:46, 29 May 2014

2014-05-29T08:46:47Z

FuhinWong at 08:02, 29 May 2014

2014-05-29T08:02:43Z

FuhinWong: Blanked the page

2014-05-29T08:02:01Z

Blanked the page

FuhinWong at 07:54, 29 May 2014

2014-05-29T07:54:40Z

@@ Line 41: / Line 41: @@
 <ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
 <ref name="ref4">Nover, L., Bharti, K., Doring, P., Mishra, S.K., Ganguli, A.,Scharf, K.D. et al.(2001)Arabidopsis and the heat stress transcription factor world: how many heat stress transcription factors do we need?Cell Stress Chaperones 6:177-89.</ref>
 [[Category:Genes]]
 [[Category:Japonica mRNA]]

@@ Line 4: / Line 4: @@
 OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.
-Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions.In contrast to class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.
+Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.
 ===Expression===

@@ Line 4: / Line 4: @@
 OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.
-Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
+Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions.In contrast to class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.
 ===Expression===

@@ Line 72: / Line 72: @@
 </gbrowseImage2>|
 CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>|
-AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW                     GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR                     GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ                     RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG                     RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>|
+AA = <aaseq>
 DNA = <dnaseqindica>152..400#510..1013#
 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa

@@ Line 18: / Line 18: @@
 A typical Hsf protein contains a modular structure with an N-terminal DNA-binding domain (DBD), an adjacent bipartite oligomerization domain composed of heptads repeat of hydrophobic amino acid residues (HR-A/B), a nuclear localization signal (NLS) essential for nuclear uptake of the protein, a nuclear export signal (NES),and in many cases a less conserved C-terminal activation domain (CTAD) rich in aromatic, hydrophobic and acidic amino acids (AHA) that have been reported
 to be crucial for activation function<ref name="ref4" />.Based on the conservative DBD and the HR-A/B regions, 21 putative Hsfs from the Arabidopsis,23 from rice, and 18 from tomato have been identified through the genome-wide analysis. Plant Hsf gene family is divided into three classes, HsfA, HsfB, and HsfC, according to
-their protein structures<ref name="ref4" />.
+their protein structures<ref name="ref4" />.HsfA and HsfC have insertions of 21 and 7 amino acids, between the hydrophobic regions HR-A and HR-B,respectively. HsfB and HsfC are also characterized bylack of AHA motifs in their C-terminal regions(CTRs).
 ==Labs working on this gene==

@@ Line 23: / Line 23: @@
 ==Labs working on this gene==
 Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
 Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
 CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
 State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
 National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
 State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
 Graduate School of the Chinese Academy of Sciences, Beijing 100039, China
 Biocenter of the Goethe University, Frankfurt/Main, Germany
 ==References==

@@ Line 15: / Line 15: @@
 To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
 [[File:tileshop.jpg]]
 ==Labs working on this gene==
@@ Line 26: / Line 29: @@
 State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
 Graduate School of the Chinese Academy of Sciences, Beijing 100039, China
+Biocenter of the Goethe University, Frankfurt/Main, Germany
 ==References==
 <references>
@@ Line 32: / Line 35: @@
 <ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
 <ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
 ==Structured Information==

← Older revision	Revision as of 08:02, 29 May 2014
Line 1:	Line 1:
	+	The rice ''OsHsfC1b'' gene is well known as the "heat shock transcription factor gene" and regulates salt tolerance and development in Oryza sativa ssp. japonica.
	+	==Annotated Information==
	+	===Function===
	+	OsHsfC1b plays a role in ABA-mediated salt stress tolerance in rice<ref name="ref1" />.The role of class C HSFs in stress response is currently unknown;however, expression patterns of class C HSF genes from rice suggest, in addition to a role in the heat shock response, a participation in non-thermal stress responses such as salt,drought and oxidative stress.In particular, OsHsfC1b and OsHsf2b are highly responsive to salt and drought stress<ref name="ref2" />.

	+	Furthermore, OsHsfC1b is involved in the response to osmotic stress and is required for plant growth under non-stress conditions<ref name="ref1" />.In contrast to
	+	class A HSFs, OsHsfC1b acts as a positive regulator of growth under standard growth conditions. We therefore propose that class C HSFs play an opposite role to class A members in plant growth control.
	+
	+	===Expression===
	+	Expression of OsHsfC1b was induced by salt, mannitol and ABA, but not by H2O2<ref name="ref1" />.OsHsfC1b was significantly induced in roots after 30 min treatment with salt, mannitol and ABA. In addition, OsHsfC1b was also significantly upregulated in leaves after 30 min of salt treatment. After 3 h,the expression level of OsHsfC1b in roots was significantly increased by salt and ABA, but not by mannitol. Again,salt stress resulted in an upregulation of expression in leaves. H2O2 had no effect on OsHsfC1b transcript level.
	+
	+	OsHsfC1b is localized in the nucleus in the absence of stress,which indicates that a stress-dependent modification is not required for nuclear accumulation.
	+
	+	===Evolution===
	+	To determine the phylogenetic relationship among the OsHsfs, neighbor-joining phylogenetic trees were constructed using the amino acid sequences of DBD, the HR-A/B region, and the linker between them <ref name="ref3" />. As expected, the classes A, B and C Hsfs formed three individual clusters. Furthermore, the class A Hsfs were divided into two sub-clusters. In a previous study, the N-terminal part and C-terminal part of DBD and HR-A/B regions were used separately to draw phylogenetic trees. Although most proteins fixed their positions in the different phylogenetic trees, a few Hsfs changed theirpositions (Nover et al., 2001). Similar phenomenon was also observed on the OsHsfs (data not shown). A more convinced relationship of the Hsfs was revealed by combining the DBD, HR-A/B, and the flexible linker between DBD and HR-A/B.
	+	[[File:tileshop.jpg]]
	+
	+	You can also add sub-section(s) at will.
	+
	+	==Labs working on this gene==
	+	Institute of Biochemistry and Biology, University of Potsdam, Karl-Liebknecht-Str. 24–25, 14476 Potsdam, Germany
	+	Max Planck Institute of Molecular Plant Physiology, Am Muehlenberg 1, 14476 Potsdam, Germany
	+	CIRAD, UMR AGAP, Avenue Agropolis, 34398 Montpellier, Cedex 5, France
	+	State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China
	+	National Center for Gene Research and Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 500 Caobao Road, Shanghai 200233, China
	+	State Key Lab of Rice Biology, China National Rice Research Institute, 359 Tiyuchang Road, Hangzhou 30016, China
	+	Graduate School of the Chinese Academy of Sciences, Beijing 100039, China
	+
	+	==References==
	+	<references>
	+	<ref name="ref1">Romy Schmidt, Jos H.M. Schippers, Annelie Welker, Delphine Mieulet, Emmanuel Guiderdoni and Bernd Mueller-Roeber,et al.（2009）Transcription factor OsHsfC1b regulates salt tolerance and development in Oryza sativa ssp. japonica.AoB PLANTS 011:1-17.</ref>
	+	<ref name="ref2">Wenhuo Hua, Guocheng Hua, Bin Han et al.(2009)Genome-wide survey and expression profiling of heat shock proteins and heat shock factors revealed overlapped and stress specific response under abiotic stresses in rice.Journal of Zhejiang University SCIENCE B 10:291-300.</ref>
	+	<ref name="ref3">Chuang WANG, Qian ZHANG, Hui-xia SHOU et al.(2009)Identification and expression analysis of OsHsfs in rice.Plant Science 176:583–590.</ref>
	+
	+	==Structured Information==
	+	{{JaponicaGene\|
	+	GeneName = Os01g0733200\|
	+	Description = Similar to Heat shock transcription factor 29 (Fragment)\|
	+	Version = NM_001050695.1 GI:115439760 GeneID:4324158\|
	+	Length = 1210 bp\|
	+	Definition = Oryza sativa Japonica Group Os01g0733200, complete gene.\|
	+	Source = Oryza sativa Japonica Group
	+
	+	ORGANISM Oryza sativa Japonica Group
	+	Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
	+	Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
	+	clade; Ehrhartoideae; Oryzeae; Oryza.
	+	\|
	+	Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|
	+	AP = Chromosome 1:32338331..32339540\|
	+	CDS = 32338482..32338730,32338840..32339343\|
	+	GCID = <gbrowseImage1>
	+	name=NC_008394:32338331..32339540
	+	source=RiceChromosome01
	+	preset=GeneLocation
	+	</gbrowseImage1>\|
	+	GSID = <gbrowseImage2>
	+	name=NC_008394:32338331..32339540
	+	source=RiceChromosome01
	+	preset=GeneLocation
	+	</gbrowseImage2>\|
	+	CDNA = <cdnaseq>atgatgggcggcgagtgcaaggtccaccagctccaggccgccggcgacgggggcccaggcgccgtcgcgccgttcgtggcgaagacgttccacatggtgagcgacccgtcgacgaacgccgtcgtgcgctggggaggcgccggcaacacgttcctcgtgctcgaccccgccgccttctccgacttcctcctcccctcctacttcaagcaccgcaacttcgccagcttcgtccggcagctcaacacctacggattccgcaaggtggatccggacaggtgggagttcgcgcacgagtcgttcctgcgggggcaggcgcagctgctgccgcggatcgtgcgcaagaagaagaagggcggggcggcgccggggtgcagggagctgtgcgaggaaggggaggaggtgcggggcaccatcgaggcggtgcagcggctgcgggaggagcagaggggcatggaggaggagctccaggccatggaccagaggctgcgcgccgccgagagccgcccgggccagatgatggcgttcctcgccaagctcgccgacgaaccgggcgtcgtgctgcgcgccatgctcgccaagaaggaggagctggccgcggccggcaacaacgggtccgatccctgcaagaggcggcggatcggggccgacacggggcgcggcggcgtggcgaccggcggcgacgcggccgagatggcgcagagcagaggcaccgtgccgttcccgttctctgttcttggccaagtgttctactag</cdnaseq>\|
	+	AA = <aaseq>MMGGECKVHQLQAAGDGGPGAVAPFVAKTFHMVSDPSTNAVVRW GGAGNTFLVLDPAAFSDFLLPSYFKHRNFASFVRQLNTYGFRKVDPDRWEFAHESFLR GQAQLLPRIVRKKKKGGAAPGCRELCEEGEEVRGTIEAVQRLREEQRGMEEELQAMDQ RLRAAESRPGQMMAFLAKLADEPGVVLRAMLAKKEELAAAGNNGSDPCKRRRIGADTG RGGVATGGDAAEMAQSRGTVPFPFSVLGQVFY</aaseq>\|
	+	DNA = <dnaseqindica>152..400#510..1013#
	+	1 gcgcgctcac tccctccctt gcccccaccg acgaacggaa caaatcttag cgaggaaaaa
	+	61 gcgagcgctt ttttcttatc ctgttccgcg ggcgcgctgc cacgaccgaa ccgggaggat
	+	121 acttgcgaat tacacgatcg gttgtggcac tatgatgggc ggcgagtgca aggtccacca
	+	181 gctccaggcc gccggcgacg ggggcccagg cgccgtcgcg ccgttcgtgg cgaagacgtt
	+	241 ccacatggtg agcgacccgt cgacgaacgc cgtcgtgcgc tggggaggcg ccggcaacac
	+	301 gttcctcgtg ctcgaccccg ccgccttctc cgacttcctc ctcccctcct acttcaagca
	+	361 ccgcaacttc gccagcttcg tccggcagct caacacctac gtatgtatat gcgcctcctc
	+	421 tgcttctgcc atctgtgcat agctctgtgt gtggcttcgt gtgtcgtcat ggttgtaact
	+	481 ctttccgttg ctgctgtctt ctctctcagg gattccgcaa ggtggatccg gacaggtggg
	+	541 agttcgcgca cgagtcgttc ctgcgggggc aggcgcagct gctgccgcgg atcgtgcgca
	+	601 agaagaagaa gggcggggcg gcgccggggt gcagggagct gtgcgaggaa ggggaggagg
	+	661 tgcggggcac catcgaggcg gtgcagcggc tgcgggagga gcagaggggc atggaggagg
	+	721 agctccaggc catggaccag aggctgcgcg ccgccgagag ccgcccgggc cagatgatgg
	+	781 cgttcctcgc caagctcgcc gacgaaccgg gcgtcgtgct gcgcgccatg ctcgccaaga
	+	841 aggaggagct ggccgcggcc ggcaacaacg ggtccgatcc ctgcaagagg cggcggatcg
	+	901 gggccgacac ggggcgcggc ggcgtggcga ccggcggcga cgcggccgag atggcgcaga
	+	961 gcagaggcac cgtgccgttc ccgttctctg ttcttggcca agtgttctac tagccgcaac
	+	1021 agggccagat aggtgtacac gtacgcagtc ccccgttgta tatataacaa cagtgtaact
	+	1081 tcgcctcggt ttagttgcct actgttaagt tagtgtactt aagcataata ggagagtttg
	+	1141 gctaagtagc tatcgttgga tttgtgtgta tatatcgact atcgaggggc taataacgcc
	+	1201 tattttgttc</dnaseqindica>\|
	+	Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001050695.1 RefSeq:Os01g0733200]\|
	+	}}
	+	[[Category:Genes]]
	+	[[Category:Japonica mRNA]]
	+	[[Category:Oryza Sativa Japonica Group]]
	+	[[Category:Japonica Genes]]
	+	[[Category:Japonica Chromosome 1]]
	+	[[Category:Chromosome 1]]