Os01g0822900 - Revision history

Xysj2012: /* Structured Information */

2015-05-13T07:36:15Z

‎Structured Information

Mmma: /* Wide Type VS Mutant */

2014-05-25T08:50:22Z

‎Wide Type VS Mutant

Mmma: /* Wide Type VS Mutant */

2014-05-25T08:32:21Z

‎Wide Type VS Mutant

Mmma: /* Responses to GA and BR */

2014-05-25T08:17:38Z

‎Responses to GA and BR

Mmma: /* Responses to GA and BR */

2014-05-25T08:12:35Z

‎Responses to GA and BR

Mmma: /* Annotated Information */

2014-05-25T07:59:29Z

‎Annotated Information

Mmma: /* References */

2014-05-25T07:54:56Z

‎References

Mmma: /* References */

2014-05-25T07:54:16Z

‎References

Mmma: /* References */

2014-05-25T07:53:38Z

‎References

Mmma: /* References */

2014-05-25T07:37:16Z

‎References

← Older revision		Revision as of 07:36, 13 May 2015
Line 65:		Line 65:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~
−	~~GeneName = Os01g0822900\|~~
−	~~Description = Similar to Lipid transfer protein\|~~
−	~~Version = NM_001051189.1 GI:115440748 GeneID:4327617\|~~
−	~~Length = 901 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0822900, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~

−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:36885860..36886760\|~~
−	~~CDS = 36886214..36886223,36886310..36886662\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:36885860..36886760~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:36885860..36886760~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>\|
−	AA = <aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>\|
−	DNA = <dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051189.1 RefSeq:Os01g0822900]\|~~
−	}}

	[[Category:Genes]]		[[Category:Genes]]

@@ Line 36: / Line 36: @@
 [[File:Table1.jpg‎|right|thumb|500px|'''Table1.'''
 ''Length of the third-leaf sheath of ''Psd1'' and ''ZH11'' plants grown in dark and under light.'']]''
 ===Responses to GA and BR===

← Older revision		Revision as of 08:32, 25 May 2014
Line 27:		Line 27:

	*There is a big difference with the length of the third-leaf sheath between ''Psd1'' and ''ZH11'' plants.(Table.1)		*There is a big difference with the length of the third-leaf sheath between ''Psd1'' and ''ZH11'' plants.(Table.1)
		+
		+	*Average cell number and size are of obvious difference. Transverse sections of elongated internodes of ''Psd1'' and ''ZH11'' showed that the structure of parenchyma cells and vascular bundles of ''Psd1'' was different from ''ZH11'', the average number of cells and the cell size of the internodes were also different. All together, cell division and elongation were impaired in the ''Psd1'' mutant.

	[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎\|right\|thumb\|500px\|'''Figure 3.'''		[[File:Phenotypic characterization of the ''Psd1'' mutant and ''ZH11'' wide-type plants grown in long-day and short-day.jpg‎\|right\|thumb\|500px\|'''Figure 3.'''

@@ Line 39: / Line 39: @@
 ''Psd1''mutant respond to exogenous bioactive GA to a similar degree as wild-type rice, but exogenous GA could not rescue the dwarf phenotype. Also, the dwarf phenotype could not be rescued by exogenous BR.(Fig.4)
 Moreover, the sheaths of ''Psd1'' seedings could elongate to the similar length as ''ZH11'' under complete darkness, a phenotype different from that of BR-related mutants, in which sheaths could not elongate in the dark. These characterization suggest that Psd1 may not be deficient in the bio synthesis and perception of GA or BR.
 ==Labs working on this gene==

← Older revision		Revision as of 08:12, 25 May 2014
Line 36:		Line 36:

	===Responses to GA and BR===		===Responses to GA and BR===
		+
		+	''Psd1''mutant respond to exogenous bioactive GA to a similar degree as wild-type rice, but exogenous GA could not rescue the dwarf phenotype. Also, the dwarf phenotype could not be rescued by exogenous BR.(Fig.4)
		+	Moreover, the sheaths of ''Psd1'' seedings could elongate to the similar length as ''ZH11'' under complete darkness, a phenotype different from that of BR-related mutants, in which sheaths could not elongate in the dark. These characterization suggest that Psd1 may not be deficient in the bio synthesis and perception of GA or BR.

	==Labs working on this gene==		==Labs working on this gene==

@@ Line 46: / Line 46: @@
 <references>
 <ref name="ref1">
-  Riqing Li, Jixing Xia, Yiwei Xu, Xiucai Zhao, Yao-Guang Liu, Yuanling Chen. Characterization and genetic mapping of a ''Photoperiod-sensitive dwarf1'' locus in rice(Oryza sativa L.)[J] Theor Appl Genet, 2014, 127: 241-250.
+  Riqing Li, Jixing Xia, Yiwei Xu, Xiucai Zhao, Yao-Guang Liu, Yuanling Chen. Characterization and genetic mapping of a ''Photoperiod-sensitive dwarf1'' locus in rice(Oryza sativa L.)[J] Theor Appl Genet, 2014, 127: 241-250.</ref>
 <ref name="ref2">
-  Mits unagas, Tashiro T, Yamaguti J. Rice gibberellin-insensitive dwarf mutant gene ''Dwarf 1'' encodes the α-subunit of GTP-binding protein.[J] PNAS, 1999, 96: 10284-10289.
+  Mits unagas, Tashiro T, Yamaguti J. Rice gibberellin-insensitive dwarf mutant gene ''Dwarf 1'' encodes the α-subunit of GTP-binding protein.[J] PNAS, 1999, 96: 10284-10289.</ref>
 </references>