Os01g0880800 - Revision history

192.168.72.52 at 05:04, 14 May 2015

2015-05-14T05:04:09Z

Zhangamanda: /* References */

2014-05-25T09:46:26Z

‎References

Zhangamanda: /* Expression */

2014-05-25T09:41:07Z

‎Expression

Zhangamanda: /* Labs working on this gene */

2014-05-25T09:16:50Z

‎Labs working on this gene

Zhangamanda: /* References */

2014-05-25T09:15:31Z

‎References

Zhangamanda: /* Function */

2014-05-25T09:11:37Z

‎Function

Zhangamanda: /* Function */

2014-05-25T08:47:06Z

‎Function

Zhangamanda: /* Expression */

2014-05-25T07:43:19Z

‎Expression

Zhangamanda: /* Evolution */

2014-05-25T07:39:14Z

‎Evolution

Zhangamanda: /* Evolution */

2014-05-25T07:34:19Z

‎Evolution

← Older revision		Revision as of 05:04, 14 May 2015
Line 56:		Line 56:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0880800\|~~
−	~~Description = Similar to Acyl-[acyl-carrier-protein] desaturase, chloroplast precursor (EC 1.14.19.2) (Stearoyl-ACP desaturase)\|~~
−	~~Version = NM_001051529.1 GI:115441428 GeneID:4324844\|~~
−	~~Length = 1484 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0880800, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:39980300..39981783\|~~
−	~~CDS = 39980365..39980940,39981027..39981596\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:39980300..39981783~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:39980300..39981783~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgccggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcggcgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaagggtgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacggacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcgcgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgaggaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagaccggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgccacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtcgagaagaccgtccagtacctcatcggctccggcatggatccggggacggagaacaacccgtacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaacacggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatcgccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcggctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatgcccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtggcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtcaagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgggacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagggctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgattgtctag</cdnaseq>\|
−	AA = <aaseq>MQVVGTVRVSGCGAVVAPSRRQCRVSAAVLTAAETATATRRRVT HSMPPEKAEVFRSLEGWARSSLLPLLKPVEECWQPTDFLPDSSSEMFEHQVHELRARA AGLPDEYFVVLVGDMITEEALPTYQTMINTLDGVRDETGASACPWAVWTRTWTAEENR HGDILGKYMYLSGRVDMRMVEKTVQYLIGSGMDPGTENNPYLGFVYTSFQERATAVSH GNTARLARAHGDDVLARTCGTIAADEKRHETAYGRIVEQLLRLDPDGAMLAIADMMHK RITMPAHLMHDGRDMNLFDHFAAVAQRLNVYTARDYADIVEFLVKRWKLETLETGLSG EGRRARDFVCGLAKRMRRAAERAEDRAKKDEQRKVKFSWIYDREVIV</aaseq>\|
−	DNA = <dnaseqindica>66..641#728..1297#agaagaaatcaagaaaccaaccaccaactagctactgtagttgactgacagtgatagtggcagtcatgcaggtcgtgggaaccgtgcgtgtcagtggctgcggcgcggtggtggcgccctcgcgccggcagtgccgcgtgtccgcggcggtgctgacggccgcggagacggcgacggcgacgcggcgccgcgtgacgcactcgatgccgccggagaaggcggaggtgttccggtcgctggaagggtgggcgaggtcgtcgctgctgccgctgctcaagcccgtggaggagtgctggcagccgacggacttcctgccggactcgtcgtcggagatgttcgagcaccaggtccacgagctccgcgcgcgcgccgcggggctccccgacgagtacttcgtcgtgctggtcggggacatgattaccgaggaggcgctgccgacgtaccagaccatgatcaacacgctcgacggcgtccgcgacgagaccggcgccagcgcctgcccctgggccgtctggacgcgcacctggaccgccgaggagaaccgccacggcgacatcctcggcaagtacatgtacctctccggccgcgtcgacatgcgcatggtcgagaagaccgtccagtacctcatcggctccggcatggtacgaatctctcgaaatgttgatgccatttctctgcttggtttcaatcttttttttgcttagcattgttgctgaatccatggcaggatccggggacggagaacaacccgtacctggggttcgtgtacaccagcttccaggagcgcgcgacggccgtgtcgcacgggaacacggcgcgcctcgccagggcgcacggggacgacgtcctggcgcgcacctgcggcaccatcgccgccgacgagaagcggcacgagacggcgtacgggcgcatcgtggagcagctgctgcggctcgacccggacggcgccatgctcgccatcgccgacatgatgcacaagcggatcaccatgcccgcgcacctcatgcacgacggccgcgacatgaacctgttcgaccacttcgccgccgtggcgcagcgcctcaacgtctacaccgcgcgcgactacgccgacatcgtcgagttcctcgtcaagcggtggaagctggagaccctggagactgggctctccggcgagggccggagggcccgggacttcgtgtgcgggctcgcgaagaggatgcggcgggccgcggagcgggctgaggacagggctaagaaggatgagcagaggaaggtcaagttcagctggatctatgatagggaagtgattgtctagtttaacttgtcttggttgaattctgaattcccagtcctagatgatcatgccatttcgttatcatctctgttcttgtgttctctttgcaatgcagtaaattggtaatagttaatggtgctttgatcttggaaatttggcgttgatgtattttctggtatcattagtgaagatagtttggtttcttttc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051529.1 RefSeq:Os01g0880800]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	~~[[Category:Japonica Genes]]~~
−	[[Category:Japonica ~~Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 48: / Line 48: @@
 Joern Klinkenberg, Hanna Faist, Stefanie Saupe, Sophie Lambertz, Markus Krischke, Nadja Stingl,Agnes Fekete, Martin J. Mueller, Ivo Feussner, Rainer Hedrich, and Rosalia Deeken*.Two Fatty Acid Desaturases, STEAROYL-ACYL CARRIER PROTEIN D9-DESATURASE6 and FATTY ACID DESATURASE3, Are Involved in Drought and Hypoxia
 Stress Signaling in Arabidopsis Crown Galls.Plant Physiology,2014,164:(570-583).
 Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.

@@ Line 15: / Line 15: @@
 As mentioned above, this gene has a function of drought-resistant.By detected drought-tolerant quantitative trait loci (QTL) in an RIL population from a
-cross of the Zhenshan97 and IRAT109 rice strains,several this gene is detected by 2-DE and/or microarray and it is localized on chromosomes containing drought-resistant QTLs (Table.1.).After transcription,this is responsible will be translated into Stearoyl-ACP desaturase.
+cross of the Zhenshan97 and IRAT109 rice strains,several this gene is detected by 2-DE and/or microarray and it is localized on chromosomes containing drought-resistant QTLs (Table.1.).After transcription,this is responsible will be translated into Stearoyl-ACP desaturase.a stearoyl-ACP desaturase gene promoter from B. napus was shown to drive GUS expression in a manner subject to temporal regulation.However, the levels of activity in the developing seeds were not greatly in excess of those in the leaf, suggesting that this promoter may not be a major contributor to seed transcript accumulation. The promoter also directed high levels of expression in a number of other specific tissues associated with TAG accumulation or with a likely requirement for high
 [[File:zxq3.png|200px|thumb|left|Table. 1. RNA blot analysis.]]

@@ Line 36: / Line 36: @@
 Interdisciplinary Program in Bioinformatics, Seoul National University, Seoul, Republic of Korea;
 Department of Biomedical Sciences, Sunmoon University, Asan 336-708, Republic of Korea.
 ==References==

← Older revision		Revision as of 09:15, 25 May 2014
Line 41:		Line 41:

	Kyuri Jo , Hawk-Bin Kwon , Sun Kim.Time-series RNA-seq analysis package (TRAP) and its application to the analysis of rice, Oryza sativa L. ssp. Japonica, upon drought stress.Methods(2014)http://dx.doi.org/10.1016/j.ymeth.2014.02.001.		Kyuri Jo , Hawk-Bin Kwon , Sun Kim.Time-series RNA-seq analysis package (TRAP) and its application to the analysis of rice, Oryza sativa L. ssp. Japonica, upon drought stress.Methods(2014)http://dx.doi.org/10.1016/j.ymeth.2014.02.001.
		+
		+	Joern Klinkenberg, Hanna Faist, Stefanie Saupe, Sophie Lambertz, Markus Krischke, Nadja Stingl,Agnes Fekete, Martin J. Mueller, Ivo Feussner, Rainer Hedrich, and Rosalia Deeken*.Two Fatty Acid Desaturases, STEAROYL-ACYL CARRIER PROTEIN D9-DESATURASE6 and FATTY ACID DESATURASE3, Are Involved in Drought and Hypoxia
		+	Stress Signaling in Arabidopsis Crown Galls.Plant Physiology,2014,164:(570-583).

	Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.		Hui-Yuan Ya, Qiu-Fang Chen, Wei-Dong Wang, Guang-Yong Qin, and Zhen Jiao.Pathway Analysis of the Differentially Expressed Genes in Oryza Sativa Exposed to the Implantation of Low-Energy Nitrogen Ion.International Journal of Bioscience, Biochemistry and Bioinformatics, 2011,1( 2 ):89-97.

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-On the one hand,PathwayId of the Os01g0880800 include osa00061 and osa01040. The function of osa00061 is used in Fatty acid biosynthesis,and the function of osa01040 is used in Biosynthesis of unsaturated fatty acids.Their category are both included lipid metabolism.They both play a importnt role in the lipid metobolism.
+This gene encode a protein similar to stearoyl-acyl carrier protein desaturase(SAD).On the one hand,PathwayId of the Os01g0880800 include osa00061 and osa01040. The function of osa00061 is used in Fatty acid biosynthesis,and the function of osa01040 is used in Biosynthesis of unsaturated fatty acids.Their category are both included lipid metabolism.They both play a importnt role in the lipid metobolism.The biosynthesis of PUFAs is initiated by introduction of the first double bond into stearic acid (18:0) by stearoyl-acyl carrier protein desaturase(SAD). SAD genes exhibit a tissue-specific expression profile, and the encoding enzymes regulate the pools of oleic acid (18:1), a monounsaturated fatty acid .It is capable of desaturating 18:0 and contribute to the 18:1 pool . Furthermore,the salicylic acid-mediated defense signaling pathway is constitutively active, resulting in lesion formation and increased expression of the pathogenesis-related(PR) genes. On the other hand,because multiple approaches have been used to study drought-resistant genes and identify the mechanisms of drought resistance,some researches reported that this gene can also play a pole in rice drought resistance.
 ===Expression===

@@ Line 20: / Line 20: @@
 Phylogenetic tree of stearoyl acyl carrier protein (ACP) fatty-acid desaturase (SACPD) family proteins in rice is displayed as Fig.2.
 [[File:zxq2.png|200px|thumb|left|Fig. 2. Phylogenetic tree.]]
 ==Labs working on this gene==