Os01g0897700 - Revision history

192.168.72.52 at 05:05, 14 May 2015

2015-05-14T05:05:17Z

Tina: /* References */

2014-06-02T02:41:57Z

‎References

Tina: /* References */

2014-06-02T02:41:37Z

‎References

Tina: /* References */

2014-06-02T02:38:54Z

‎References

Tina: /* References */

2014-06-02T02:36:24Z

‎References

Tina: /* References */

2014-06-02T02:35:42Z

‎References

Tina: /* Expression */

2014-06-02T02:34:19Z

‎Expression

Tina: /* Evolution */

2014-06-02T02:33:08Z

‎Evolution

Tina: /* Function */

2014-06-02T02:30:52Z

‎Function

Tina: /* Function */

2014-06-02T02:29:39Z

‎Function

← Older revision		Revision as of 05:05, 14 May 2015
Line 45:		Line 45:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0897700\|~~
−	~~Description = Similar to FH protein NFH1\|~~
−	~~Version = NM_001051625.1 GI:115441620 GeneID:4325107\|~~
−	~~Length = 1054 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0897700, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:40769673..40770726\|~~
−	~~CDS = 40769990..40770463\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:40769673..40770726~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:40769673..40770726~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttga</cdnaseq>\|
−	AA = <aaseq>MDSDVLSSYVSKLAGGIEKITEVLRLNEEVKSREDAWRFHDSMQ KFLKRADDDIIRVQAQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLSVLDQ VCKEVGRINDRTIASSVRHFPVPVNPMMPQLFPRIHALRAGISDDESSATSASSP</aaseq>\|
−	DNA = <dnaseqindica>264..737#atcgcggcgatgcacacgcgttcaagcttgatactctactcaaattggttgatgtcaaaggcactgatggcaagactacacttttgcattttgtcgtgcaggagattatccgaacggagggctcccacctctctgctagcaaccaatcaactccacgaactcaggcaaaccctttacgggacgagctcgagtgcaaaaagcttggcctccaggtagtggctggcctcggaaacgagctcagcaatgtcaagaaggcagctgccatggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttgatcaccagtagtctgccaatagaaatttttcgcagagtactgtgggaaacctccatagggcagagggagaccaacggcgacggggtgtcaaatttttttttgaaccttttgtacctgtagattatagaatgtaagaagtttttttgcaaatatttatttctatatataagaggagataaaatctagatcagaggaggaaataagcagttcatgtgtttgtcatcttcagtctgtacatgacacgaggtagtgaaacagcctgtacaatgtactaacaatttcaagtatggccagtctgcagaattcaaaggtaagctg</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051625.1 RefSeq:Os01g0897700]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 42: / Line 42: @@
 <ref  name="ref2">Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>
 <ref name="ref3">Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>
 </references>

@@ Line 38: / Line 38: @@
 Please input cited references here.
-<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>
+<references>
 <ref name="ref1">Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>
-<ref name="ref2"> Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>
+<ref  name="ref2">Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>
+<ref name="ref3">Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>
-<ref name="ref3"> Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>
+<ref name="ref4">。。。  </ref>
 ==Structured Information==

@@ Line 40: / Line 40: @@
 <ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>
-<ref name="ref2"> Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>
+<ref name="ref2"> Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>
-<ref name="ref3"> Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>
+<ref name="ref3"> Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>
 ==Structured Information==

@@ Line 38: / Line 38: @@
 Please input cited references here.
 <ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>
@@ Line 44: / Line 43: @@
 <ref name="ref3"> Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>
 ==Structured Information==

@@ Line 15: / Line 15: @@
 Since rice is grown in water-logged paddy fields, rice root hairs are exposed to physical and chemical conditions that are different from those
 of upland plants such as wheat and corn. Compared with Arabidopsis, only a few genes have been reported to regulate root hair development in rice.
-The phenotypic effect of OsFH1on root hair development was verified by using three independent mutants, one point mutation and two T-DNA insertions[2].
+The phenotypic effect of OsFH1on root hair development was verified by using three independent mutants, one point mutation and two T-DNA insertions<ref name="ref2"> Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>.
 OsFH1-mediated cellular processes are required for the elongation of submerged root hairs. It is likely that submergence induces physiological or
-cellular changes that interfere with root hair elongation and that OsFH1overcomes these changes via some physiological factor involved in root hair elongation. Considering that rice grows in water-logged soil, OsFH1has an important role to play in rice plant survival under this condition. The physiological factor that mediates the effect of OsFH1 on root hair elongation remains to be identified.
+cellular changes that interfere with root hair elongation and that OsFH1overcomes these changes via some physiological factor involved in root hair elongation. Considering that rice grows in water-logged soil, OsFH1has an important role to play in rice plant survival under this condition. The physiological factor that mediates the effect of OsFH1 on root hair elongation remains to be identified<ref name="ref2"> Jin Huang,†Jingmiao Liu†and Chang-deok Han*Division of Applied Life Science (BK21 Program); Plant Molecular Biology and Biotechnology Research Center (PMBBRC); Gyeongsang National University; Jinju, Korea.(2013)Formin homology 1 (OsFH1) regulates submergence-dependent root hair development in rice plants.Plant Signaling & Behavior 8:8, e24970.</ref>.
 ===Evolution===

@@ Line 23: / Line 23: @@
 Formin family members are defined by the presence of a FH2 domain. There are at least 21 putative formin genes in Arabidopsis, whereas rice genomes contain 16 putative formin genes. This gene is coded by Os01g67240 and Os01g67240 has been annotated as aformin-like protein 1 in public databases.
-Further sequence analysis indicated that it belongs to the rice formin family that contains FH1and FH2 domains.
+Further sequence analysis indicated that it belongs to the rice formin family that contains FH1and FH2 domains<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.
 ==Labs working on this gene==

@@ Line 5: / Line 5: @@
 Please input function information here.
-This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref><ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4,OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa<ref name="ref3"> Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>.
+This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4,OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa<ref name="ref3"> Jiaojiao Wang&Xiuhua Xue&Haiyun Ren.(2012)New insights into the role of plant formins: regulating the organization of the actin and microtubule cytoskeleton.Protoplasma 249 (Suppl 2):S101–S107.</ref>.
-Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation. Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref><ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.
+Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation. Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition<ref name="ref1"> Jin Huang• Chul Min Kim• Yuan-hu Xuan•Jingmiao Liu• Tae Ho Kim• Bo-Kyeong Kim•Chang-deok Han.(2013) Formin homology 1 (OsFH1) regulates root-hair elongation in rice(Oryza sativa).Planta 237:1227–1239.</ref>.
 [[File:OsFH1-1.png]]