Os01g0911700 - Revision history

192.168.72.52 at 05:06, 14 May 2015

2015-05-14T05:06:07Z

Houyanlin: /* Expression */

2014-06-05T16:04:02Z

‎Expression

Houyanlin: /* Labs working on this gene */

2014-06-05T15:48:12Z

‎Labs working on this gene

Houyanlin: /* Expression */

2014-06-05T15:44:01Z

‎Expression

Houyanlin: /* Expression */

2014-06-04T17:18:37Z

‎Expression

Houyanlin: /* Annotated Information */

2014-06-04T17:17:16Z

‎Annotated Information

Houyanlin: /* Labs working on this gene */

2014-06-04T17:11:04Z

‎Labs working on this gene

Houyanlin: /* Labs working on this gene */

2014-06-04T17:10:42Z

‎Labs working on this gene

Houyanlin: /* References */

2014-06-04T17:08:27Z

‎References

Houyanlin: /* Expression */

2014-06-04T17:02:25Z

‎Expression

← Older revision		Revision as of 05:06, 14 May 2015
Line 40:		Line 40:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0911700\|~~
−	~~Description = Similar to Regulatory protein viviparous-1\|~~
−	~~Version = NM_001051697.2 GI:297598172 GeneID:4324314\|~~
−	~~Length = 3799 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0911700, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:41479033..41482831\|~~
−	~~CDS = 41479311..41479604,41479844..41479920,41480040..41480086,41480541..41480638,41480859..41480948<br>,41481144..41482626,41482696..41482721\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:41479033..41482831~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:41479033..41482831~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggacgcctccgccggctcgtcggccccggcggcggagatcaggggtgaggcggcgagggatgacgtctttttcgctgacgataccttcccgttgctcccggacttcccgtgcctttcttccccgtcaagctcaaccttctcgtcgtcgtcgtcgtcgaactcgtccagcgctttcaccaccgcggcgggagggggttgcggcggtgagccgtccgagccggcctcggcggcggacgggtttggtgagctcgccgacatagaccagctcctcgacctcgcgtcgctgtccgtcccgtgggaggccgagcagccgctgttcccggacgacgttggcatgatgatagaggacgccatgtccgggcaaccgcatcaggcggacgactgtaccggcgacggcgatacgaaggcggtgatggaggcggccgggggaggagacgacgccggcgacgcatgcatggaggggagtgatgcgcccgacgatctgccggcgttcttcatggagtggctcacgagcaaccgtgagtacatctccgccgacgacctccgcagcatccgcctccgccgatccaccatcgaggcggcggccgcgcggctcggcggcgggcgccagggcaccatgcagctgctcaagctcatcctcacctgggtgcagaaccaccacctccagaagaagcgcccccgcacggcgattgacgacggcgccgcgtcgtcggaccctcagctccccagccccggcgcaaaccccggctacgagttcccctccggtggccaggagatgggctccgccgccgccacatcctggatgccctaccaggccttcacgccgccagccgcgtacggcggcgacgccatgtacccaggcgccgccggcccgttccctttccagcagagctgcagcaagagcagcgtggtcgtgagcagccagccgttctccccgccgaccgcggcggcggcgggcgacatgcatgcgtcgggcggagggaacatggcctggccgcagcaattcgcgccgttccccgtctcctccacgagctcctacaccatgccgtcggtcgtgccaccgccgttcaccgccggattccccgggcagtactccggcggccacgccatgtgctctccacgcctcgccggagtcgagccgtcctcgacaaaggaggcccggaagaagcggatggcgaggcagcgccgcctctcctgcctgcagcagcaacgtagccagcagctcaacctgagccagatccacatctccggccatccacaggagccctcccctcgcgccgcgcactcggcgccggtcaccccgtcgtcggccggctgccggagctggggcatctggccgccggcggcccagatcatccagaatcccctatcaaacaagcccaatcctcctcccgccacgtcgaagcagccgaaaccctcgccggagaaaccgaagccgaagccgcaggcggcggcgacggccggagcggagagccttcagcgctcgacggcttcagagaagcggcaggcgaagacggacaagaacctgcggttcctgctgcagaaggtgctgaagcagagcgacgtcgggagcctcggccgcatcgtgctccccaaagaagcagaggttcacctgccggagctgaagacgagggatggtgtctccatccccatggaagacatcgggacgtctcaggtgtggaacatgcggtaccggttttggcccaacaacaaaagcaggatgtatcttctcgaaaacacaggtgattttgttcgttcaaacgagctgcaggagggtgatttcattgtgatctactccgatatcaagtcaggcaaatatctgatacgtggtgtgaaggtgaggcgcgcggcgcaggagcaaggcaactcgtcgggggcggtaggtaagcataagcatggctcgccggagaaacccggcgtctcgtccaatacaaaggccgccggcgccgaggacggcaccggcggcgatgacagtgccgaagccgcagcggcggcggcggcaggcaaggctgacggcggcggctgcaagggcaagtccccgcacggcgtgcggcgttctcgccaggaggccgccgccgccgcctccatgagccagatggcggttagcatctga</cdnaseq>\|
−	AA = <aaseq>MDASAGSSAPAAEIRGEAARDDVFFADDTFPLLPDFPCLSSPSS STFSSSSSSNSSSAFTTAAGGGCGGEPSEPASAADGFGELADIDQLLDLASLSVPWEA EQPLFPDDVGMMIEDAMSGQPHQADDCTGDGDTKAVMEAAGGGDDAGDACMEGSDAPD DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQ NHHLQKKRPRTAIDDGAASSDPQLPSPGANPGYEFPSGGQEMGSAAATSWMPYQAFTP PAAYGGDAMYPGAAGPFPFQQSCSKSSVVVSSQPFSPPTAAAAGDMHASGGGNMAWPQ QFAPFPVSSTSSYTMPSVVPPPFTAGFPGQYSGGHAMCSPRLAGVEPSSTKEARKKRM ARQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTPSSAGCRSWGIWPPAA QIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQAKTDK NLRFLLQKVLKQSDVGSLGRIVLPKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYR FWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRRAAQEQGNS SGAVGKHKHGSPEKPGVSSNTKAAGAEDGTGGDDSAEAAAAAAAGKADGGGCKGKSPH GVRRSRQEAAAAASMSQMAVSI</aaseq>\|
−	DNA = <dnaseqindica>3228..3521#2912..2988#2746..2792#2194..2291#1884..1973#206..1688#111..136#ctcagtaactgcacccacctccacacctacacgcacacagacaaacaaagccaaaccccccgcctcgcctacatctcgcgctctccgccccccgcccgcctccactctgcatggacgcctccgccggctcgtcggcgccgcactcgcacgggaacccggggaagcagggtggcggcggcggcggcggcggcggacgggggaaggccccggcggcggagatcaggggtgaggcggcgagggatgacgtctttttcgctgacgataccttcccgttgctcccggacttcccgtgcctttcttccccgtcaagctcaaccttctcgtcgtcgtcgtcgtcgaactcgtccagcgctttcaccaccgcggcgggagggggttgcggcggtgagccgtccgagccggcctcggcggcggacgggtttggtgagctcgccgacatagaccagctcctcgacctcgcgtcgctgtccgtcccgtgggaggccgagcagccgctgttcccggacgacgttggcatgatgatagaggacgccatgtccgggcaaccgcatcaggcggacgactgtaccggcgacggcgatacgaaggcggtgatggaggcggccgggggaggagacgacgccggcgacgcatgcatggaggggagtgatgcgcccgacgatctgccggcgttcttcatggagtggctcacgagcaaccgtgagtacatctccgccgacgacctccgcagcatccgcctccgccgatccaccatcgaggcggcggccgcgcggctcggcggcgggcgccagggcaccatgcagctgctcaagctcatcctcacctgggtgcagaaccaccacctccagaagaagcgcccccgcacggcgattgacgacggcgccgcgtcgtcggaccctcagctccccagccccggcgcaaaccccggctacgagttcccctccggtggccaggagatgggctccgccgccgccacatcctggatgccctaccaggccttcacgccgccagccgcgtacggcggcgacgccatgtacccaggcgccgccggcccgttccctttccagcagagctgcagcaagagcagcgtggtcgtgagcagccagccgttctccccgccgaccgcggcggcggcgggcgacatgcatgcgtcgggcggagggaacatggcctggccgcagcaattcgcgccgttccccgtctcctccacgagctcctacaccatgccgtcggtcgtgccaccgccgttcaccgccggattccccgggcagtactccggcggccacgccatgtgctctccacgcctcgccggagtcgagccgtcctcgacaaaggaggcccggaagaagcggatggcgaggcagcgccgcctctcctgcctgcagcagcaacgtagccagcagctcaacctgagccagatccacatctccggccatccacaggagccctcccctcgcgccgcgcactcggcgccggtcaccccgtcgtcggccggctgccggagctggggcatctggccgccggcggcccagatcatccagaatcccctatcaaacaagcccaatcctcctcccgccacgtcgaagcagccgaaaccctcgccggagaaaccgaagccgaagccgcaggcggcggcgacggccggagcggagagccttcagcgctcgacggcttcagagaagcggcaggtgtgcatgcatgcagacgattgacatcaatcgctatccaccatagctaggatctcacgcgagtgagaactcgattctcctcctcacacacactccacacactcaaaactcactcactcacatcgctgtccagggatagaatctccaatatttatcaacctagctaattaaacggcatcgattggattgctgcaggcgaagacggacaagaacctgcggttcctgctgcagaaggtgctgaagcagagcgacgtcgggagcctcggccgcatcgtgctccccaaagtgagacagtcaccaccatctcgaacaccttctccttccaaatccactaccccacttggcacaaatccattccatggaaggatcccacttgcacacactcacatacttgatgtttctcccctaatcaaagacggaatttgcctgaaccttctcttcacatttccgatcatggtagaactaaaaagtctcccctttcttgatctgtggatggtttcagaaggaagcagaggttcacctgccggagctgaagacgagggatggtgtctccatccccatggaagacatcgggacgtctcaggtgtggaacatgcggtaccggtgagtaatcaacattcgatcgaagcatcaagcatgatttgggattgcttattaagcttgtttaagtccacttgcttctttgttaattgggaggggatagaaacctctgaaccagaaatagtaaatgactatgggatggtccctttcccaattgggcaagtgggtcatacgaacatatcattggaatctgggagtcaaataggagcatgcattcatcgtgttctatgttgatgctcaagtgcatacaacaaaaaaataaaagtgatcttttcctgctgttttcagtactaacattatgcatatgatttttgctggttctgctgagctcatgtttttgattaattaatttaattatttccattggcaatattatatatgcacaagttattcgaatacatgatggcttagattttgattcactgacattaatggatattgattttcatgaacacaggttttggcccaacaacaaaagcaggatgtatcttctcgaaaacacaggtgaatagcaaacttttgaattattcaaattttacagtcacaagccatgccaataacttccatccttaatttgtggctctcaagtattgttgattaatcgttgtcatatgttttttcaggtgattttgttcgttcaaacgagctgcaggagggtgatttcattgtgatctactccgatatcaagtcaggcaaatatgtaatgttcatccatcattgcccttcccacttctttcgagtactctttaactcaactcagttggatgtgattttgagtgccaataagctatatatagttgctgcatgccactgtttgtctttaattcggatgaccagtttggcagtatctttgtttatggagtacttctgttaatttctgcaagcagcagctaattaattattaaccgtaatcttaatttatctcttaattattagcagctgatacgtggtgtgaaggtgaggcgcgcggcgcaggagcaaggcaactcgtcgggggcggtaggtaagcataagcatggctcgccggagaaacccggcgtctcgtccaatacaaaggccgccggcgccgaggacggcaccggcggcgatgacagtgccgaagccgcagcggcggcggcggcaggcaaggctgacggcggcggctgcaagggcaagtccccgcacggcgtgcggcgttctcgccaggaggccgccgccgccgcctccatgagccagatggcggttagcatctgaagaaacagatgacagcagcagcagcaagcttcagtccatttgaaggttaattattagctagctagctccgtattataaccgatggtaaaacctcctaaaaaaattaattaagttgtgcatgtgaatcgtagcgctagctagggatgatatttgatcagtaacccgtagtccccgtaccagtgacgcttaagtacgcatggtttggttgttcatcgttgaacccctgtagtgtgtcgtcgtcctgtacatgcatcgaattatggaattaattaattacc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051697.2 RefSeq:Os01g0911700]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 15: / Line 15: @@
 [[File:Fig.3.jpg|right|thumb|150px|]]
 [[File:Fig.4.jpg|right|thumb|150px|]]
 ===Evolution===

← Older revision		Revision as of 15:48, 5 June 2014
Line 25:		Line 25:

	Center for Molecular Biology and Genetics, Mie University, Tsu, 514-8507 Japan		Center for Molecular Biology and Genetics, Mie University, Tsu, 514-8507 Japan
		+
		+	Center for Molecular Biology and Genetics,Mie University,1515 Kamihama-cho,Tsu,514 Japan
		+
		+	State Key Laboratory of Plant Physiology and Biochemistry, College of Life Sciences, Zhejiang University, Hangzhou 310058, People’s Republic of China

	==References==		==References==

@@ Line 10: / Line 10: @@
 [[File:Fig.1.jpg|right|thumb|180px|]]
 [[File:Fig.2.jpg|right|thumb|150px|]]
-Temporal and spatial regulation of OSVP1 expression during embryo development
+Temporal and spatial regulation of OSVP1 expression during embryo development[http://pcp.oxfordjournals.org/content/43/3/307.full]
 Temporal and spatial patterns of OSVP1 expression, at both the mRNA and protein level, were examined by in situ hybridization and immuno-localization analyses. OSVP1 mRNA was not detected in the embryo at 1 DAP (Fig. 1A), but was expressed in the whole embryo by 2 DAP (Fig. 1B). Examination of multiple sections from independent seeds revealed that OSVP1 mRNA became detectable in the embryos of 50–70 µm in length, which corresponded to the mid-globular stage. Until 4 DAP, when the coleoptiles started to differentiate, OSVP1 mRNA was distributed uniformly throughout the embryo (Fig. 1B–D). At 6 DAP, however, the signals became localized to those regions where the shoot and radicle were developing (Fig. 1E). A clearer distribution of OSVP1 mRNA could be observed when all the embryonic organs were fully established (Fig. 1F–H). OSVP1 mRNA could be detected in the vascular tissues, a part of coleoptiles, leaves, shoot meristem, and radicle. Epidermal layers of the scutellum and epiblast also showed stronger signals than the inner tissues of these organs. Although other parts of the embryo appeared to express lower levels of OSVP1, it was not certain whether those signals were above the non-specific background. Overall levels of OSVP1 mRNA appeared to decrease by the mature 20 DAP stage (Fig. 1H) compared to those at 10–15 DAP (Fig. 1F, G). In the endosperm, OSVP1 mRNA was detected only in the aleurone layers, the outermost cell layers, after 6 DAP when they had just differentiated, but not in the inner tissues (Fig. 2A–D).
 Spatial distribution of OSVP1 protein during development of the embryo was also examined using antibody against OSVP1. The localization of OSVP1 protein was essentially the same as that of the mRNA throughout embryogenesis (Fig. 3). OSVP1 protein was also detected in the aleurone layers (Fig. 2E–H). In Fig. 3, the protein was first detected at 3 DAP but not at 2 DAP. Although there was a 1-d difference in the earliest time the mRNA and protein could be detected, the actual difference in the developmental stage may be much smaller considering the size of the globular embryo. Examination at higher magnification revealed that signals of OSVP1 protein could be found in the nuclei irrespective of the developmental stages (Fig. 3, 4). This observation provides an additional piece of evidence that (OS)VP1 is a transcription factor. In the radicle, the protein was localized in the meristem, epidermis, central stele and the outer cells, but not in the inner cells of the cortex (Fig. 4A). In contrast to the highly tissue-specific localization of OSVP1 detected in the radicle, the shoot apex exhibited quite uniform expression (Fig. 4). The overall expression pattern of OSVP1 mRNA and protein at the later stages appeared to be localized to those organs and tissues that are still undergoing development or play a vital role in the germination and post-germination phases.

@@ Line 8: / Line 8: @@
 ===Expression===
 Temporal and spatial regulation of OSVP1 expression during embryo development
 Temporal and spatial patterns of OSVP1 expression, at both the mRNA and protein level, were examined by in situ hybridization and immuno-localization analyses. OSVP1 mRNA was not detected in the embryo at 1 DAP (Fig. 1A), but was expressed in the whole embryo by 2 DAP (Fig. 1B). Examination of multiple sections from independent seeds revealed that OSVP1 mRNA became detectable in the embryos of 50–70 µm in length, which corresponded to the mid-globular stage. Until 4 DAP, when the coleoptiles started to differentiate, OSVP1 mRNA was distributed uniformly throughout the embryo (Fig. 1B–D). At 6 DAP, however, the signals became localized to those regions where the shoot and radicle were developing (Fig. 1E). A clearer distribution of OSVP1 mRNA could be observed when all the embryonic organs were fully established (Fig. 1F–H). OSVP1 mRNA could be detected in the vascular tissues, a part of coleoptiles, leaves, shoot meristem, and radicle. Epidermal layers of the scutellum and epiblast also showed stronger signals than the inner tissues of these organs. Although other parts of the embryo appeared to express lower levels of OSVP1, it was not certain whether those signals were above the non-specific background. Overall levels of OSVP1 mRNA appeared to decrease by the mature 20 DAP stage (Fig. 1H) compared to those at 10–15 DAP (Fig. 1F, G). In the endosperm, OSVP1 mRNA was detected only in the aleurone layers, the outermost cell layers, after 6 DAP when they had just differentiated, but not in the inner tissues (Fig. 2A–D).
 Spatial distribution of OSVP1 protein during development of the embryo was also examined using antibody against OSVP1. The localization of OSVP1 protein was essentially the same as that of the mRNA throughout embryogenesis (Fig. 3). OSVP1 protein was also detected in the aleurone layers (Fig. 2E–H). In Fig. 3, the protein was first detected at 3 DAP but not at 2 DAP. Although there was a 1-d difference in the earliest time the mRNA and protein could be detected, the actual difference in the developmental stage may be much smaller considering the size of the globular embryo. Examination at higher magnification revealed that signals of OSVP1 protein could be found in the nuclei irrespective of the developmental stages (Fig. 3, 4). This observation provides an additional piece of evidence that (OS)VP1 is a transcription factor. In the radicle, the protein was localized in the meristem, epidermis, central stele and the outer cells, but not in the inner cells of the cortex (Fig. 4A). In contrast to the highly tissue-specific localization of OSVP1 detected in the radicle, the shoot apex exhibited quite uniform expression (Fig. 4). The overall expression pattern of OSVP1 mRNA and protein at the later stages appeared to be localized to those organs and tissues that are still undergoing development or play a vital role in the germination and post-germination phases.
 [[File:Fig.3.jpg|right|thumb|150px|]]

@@ Line 2: / Line 2: @@
 ==Annotated Information==
 ===Function===
 During the mid- to late phase of seed development, the embryo and the aleurone tissue undergo a maturation process, whereby each becomes dormant or quiescent and acquires the ability to tolerate desiccation. The maturation process is associated with the accumulation of characteristic sets of mRNAs and proteins, which are products of the so-called LEA (Late Embryogenesis Abundant protein) genes (Baker et al. 1988, Skriver and Mundy 1990). The phytohormone ABA plays key roles in the control of these events (McCarty 1995, Leung and Giraudat 1998). Genetic loci have been identified in Arabidopsis and maize that are required for the control of maturation processes. The viviparous1 (vp1) mutant of maize has been characterized as an ABA-insensitive mutant, in which various events during seed maturation are blocked (McCarty et al. 1991, Robichaud et al. 1980). At the molecular level, the vp1 mutant fails to accumulate mRNAs of ABA-regulated LEA genes, such as Rab28 (Pla et al. 1989) and the maize homologue of the wheat Em gene (McCarty et al. 1991), as well as the genes for globulin storage proteins (Kriz et al. 1990). The Vp1 gene encodes a transcription factor that can activate the transcription of maturation-associated genes(McCarty et al. 1991, Hattori et al. 1992).

@@ Line 21: / Line 21: @@
 ==Labs working on this gene==
 Graduate School of Agricultural and Life Sciences, University of Tokyo, Tokyo, 113-8657 Japan
 Center for Molecular Biology and Genetics, Mie University, Tsu, 514-8507 Japan

@@ Line 24: / Line 24: @@
 ==References==
-Please input cited references here.
+<ref name="ref1">Kazumaru Miyoshi, Yasuaki Kagaya, Yuichirou Ogawa,et  al.(2002)Temporal and Spatial Expression Pattern of the OSVP1 and OSEM Genes during Seed Development in Rice. Plant and Cell Physiology.Volume 43: 307-313.</ref>
 ==Structured Information==