Os01g0929600 - Revision history

192.168.72.52 at 05:07, 14 May 2015

2015-05-14T05:07:26Z

Xyuanying: /* Evolution */

2014-06-09T10:04:49Z

‎Evolution

Xyuanying: /* Evolution */

2014-06-09T10:04:33Z

‎Evolution

Xyuanying: /* Expression */

2014-06-09T10:04:19Z

‎Expression

Xyuanying: /* Expression */

2014-06-09T10:03:55Z

‎Expression

Xyuanying: /* References */

2014-06-09T10:02:39Z

‎References

Xyuanying: /* References */

2014-06-09T10:02:20Z

‎References

Xyuanying: /* References */

2014-06-09T10:02:00Z

‎References

Xyuanying: /* References */

2014-06-09T10:01:40Z

‎References

Xyuanying: /* Evolution */

2014-06-09T09:59:53Z

‎Evolution

← Older revision		Revision as of 05:07, 14 May 2015
Line 24:		Line 24:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0929600\|~~
−	~~Description = Conserved hypothetical protein\|~~
−	~~Version = NM_001051819.1 GI:115442008 GeneID:4326940\|~~
−	~~Length = 585 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0929600, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:42592788..42593372\|~~
−	~~CDS = 42593018..42593293\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:42592788..42593372~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:42592788..42593372~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctga</cdnaseq>\|
−	~~AA = <aaseq>MVRVGAAAAVLVLAAAAAAMAAEPPTDDGAVRVAAGLTKCVSGC GSKVTSCLLGCYGGGGGAAAAATAMPFCVIGCTSDVLSCATGCSTSL</aaseq>\|~~
−	DNA = <dnaseqindica>80..355#tgcatcatcatcatcagctcgatagaaaaagaaagaaattaaaaagaaaatcacggcgcgtgagcttgcagagacagcaatggtgagagttggtgccgccgcggcggtgctcgtgctggcggcggcggcggcggccatggccgccgagccgcccaccgatgacggcgcggtccgggtggcggcggggctgacgaagtgcgtgtccgggtgcggtagcaaggtgacctcctgcttgctcggctgctacggcggcggcggcggcgccgccgccgccgcgacggcgatgccgttctgcgtcatcggctgcaccagcgacgtcttgtcctgcgccaccggctgctccacctcgctctgattaagtactaatgaagtaattaaccgcgctaattaataataaatcgcacctacgtatgccacatgtggactcgcttgactaattaaatactgccatgcgaatgcgattagtggattatgaaaagaggaaatgtaagaactcatggctctctctgtgccatgcctgtactgcattgaaatgaatctgcatgcagccatgaactgatatacaaatacgaccatgttacctgt</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001051819.1 RefSeq:Os01g0929600]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 12: / Line 12: @@
 ===Evolution===
 The nucleotide and deduced amino acid sequence of the gene do not show significant homology to any known sequences. However, a sequence in the promoter region, GAATTTGTTA, differs only by one or two nucleotides from one of the conserved motifs in the promoter region of two pollen-specific genes of tomato. Several other sequence motifs found in other anther-specific promoters were also identified in the promoter of the RTS gene.The promoter region of RTS, when fused to the Bacillus amyloliquefaciens ribonuclease gene, barnase, or the antisense of the RTS gene, is able to drive tissue-specific expression of both genes in rice, creeping bentgrass (Agrostis stolonifera L.) and Arabidopsis, conferring male sterility to the transgenic plants. Light and near-infrared confocal microscopy of cross-sections through developing flowers of male-sterile transgenics shows that tissue-specific expression of barnase or the antisense RTS genes interrupts tapetal development, resulting in deformed non-viable pollen.
 [[File:rst1.jpg|below|300px|Fig. 2 Induction of male sterility in rice and creeping bentgrass through tissue-specific expression of barnase driven by the promoter of the rice tapetum-specific RTS gene. Anthers from transgenic control rice (A) and creeping bentgrass (C) plants that do not contain TAP-driving barnase and from male-sterile transgenic rice (B) and creeping bentgrass (D) plants expressing barnase gene. Note that there is no pollen produced in the male-sterile transgenics. (E) Light microscopy of cross-sectioned anthers from transgenic control creeping bentgrass plants that do not contain TAP driving barnase. (F) Light microscopy of cross-sectioned anther from male-sterile transgenic creeping bentgrass plant expressing TAP driving barnase gene. Note the abnormal anther and pollen development. Scale bar is 100 um.]]

@@ Line 12: / Line 12: @@
 ===Evolution===
 The nucleotide and deduced amino acid sequence of the gene do not show significant homology to any known sequences. However, a sequence in the promoter region, GAATTTGTTA, differs only by one or two nucleotides from one of the conserved motifs in the promoter region of two pollen-specific genes of tomato. Several other sequence motifs found in other anther-specific promoters were also identified in the promoter of the RTS gene.The promoter region of RTS, when fused to the Bacillus amyloliquefaciens ribonuclease gene, barnase, or the antisense of the RTS gene, is able to drive tissue-specific expression of both genes in rice, creeping bentgrass (Agrostis stolonifera L.) and Arabidopsis, conferring male sterility to the transgenic plants. Light and near-infrared confocal microscopy of cross-sections through developing flowers of male-sterile transgenics shows that tissue-specific expression of barnase or the antisense RTS genes interrupts tapetal development, resulting in deformed non-viable pollen.
-[[File:rst1.jpg|right|300px|Fig. 2 Induction of male sterility in rice and creeping bentgrass through tissue-specific expression of barnase driven by the promoter of the rice tapetum-specific RTS gene. Anthers from transgenic control rice (A) and creeping bentgrass (C) plants that do not contain TAP-driving barnase and from male-sterile transgenic rice (B) and creeping bentgrass (D) plants expressing barnase gene. Note that there is no pollen produced in the male-sterile transgenics. (E) Light microscopy of cross-sectioned anthers from transgenic control creeping bentgrass plants that do not contain TAP driving barnase. (F) Light microscopy of cross-sectioned anther from male-sterile transgenic creeping bentgrass plant expressing TAP driving barnase gene. Note the abnormal anther and pollen development. Scale bar is 100 um.]]
+[[File:rst1.jpg|below|300px|Fig. 2 Induction of male sterility in rice and creeping bentgrass through tissue-specific expression of barnase driven by the promoter of the rice tapetum-specific RTS gene. Anthers from transgenic control rice (A) and creeping bentgrass (C) plants that do not contain TAP-driving barnase and from male-sterile transgenic rice (B) and creeping bentgrass (D) plants expressing barnase gene. Note that there is no pollen produced in the male-sterile transgenics. (E) Light microscopy of cross-sectioned anthers from transgenic control creeping bentgrass plants that do not contain TAP driving barnase. (F) Light microscopy of cross-sectioned anther from male-sterile transgenic creeping bentgrass plant expressing TAP driving barnase gene. Note the abnormal anther and pollen development. Scale bar is 100 um.]]
 ==Labs working on this gene==

@@ Line 8: / Line 8: @@
 RNA blot analysis and in situ hybridization indicates that this gene is predominantly expressed in the anther,s tapetum during meiosis and disappears before anthesis. RTS has no introns and encodes a putative polypeptide of 94 amino acids with a hydrophobic N-terminal region.
-[[File:rst.jpg|right|250px|Fig. 1 Northern blot analysis of the RTS gene.]]
+[[File:rst.jpg|below|250px|Fig. 1 Northern blot analysis of the RTS gene.]]
 ===Evolution===

@@ Line 8: / Line 8: @@
 RNA blot analysis and in situ hybridization indicates that this gene is predominantly expressed in the anther,s tapetum during meiosis and disappears before anthesis. RTS has no introns and encodes a putative polypeptide of 94 amino acids with a hydrophobic N-terminal region.
-[[File:rst.jpg|below|250px|Fig. 1 Northern blot analysis of the RTS gene.]]
+[[File:rst.jpg|right|250px|Fig. 1 Northern blot analysis of the RTS gene.]]
 ===Evolution===

@@ Line 19: / Line 19: @@
 ==References==
 . Hong Luo,Jang-Yong Lee,Qian Hu,Kimberly Nelson-Vasilchik,Timothy K. Eitas,Colin Lickwar,Albert P. Kausch,Joel M. Chandlee,Thomas K. Hodges, RTS, a rice anther-specific gene is required for male fertility and its promoter sequence directs tissue-specific gene expression in different plant species. Plant Molecular Biology, 2006, 62(3): 397-408.
 .Gonza´lez S, Swindells K Rajadhyaksha M, Torres A (2003) Changing paradigms in dermatology: confocal microscopy in clinical and surgical dermatology. Clin Dermatol 21:359–369.

@@ Line 18: / Line 18: @@
 ==References==
-<ref name="ref1">1. Hong Luo,Jang-Yong Lee,Qian Hu,Kimberly Nelson-Vasilchik,Timothy K. Eitas,Colin Lickwar,Albert P. Kausch,Joel M. Chandlee,Thomas K. Hodges, RTS, a rice anther-specific gene is required for male fertility and its promoter sequence directs tissue-specific gene expression in different plant species. Plant Molecular Biology, 2006, 62(3): 397-408.</ref>
+. Hong Luo,Jang-Yong Lee,Qian Hu,Kimberly Nelson-Vasilchik,Timothy K. Eitas,Colin Lickwar,Albert P. Kausch,Joel M. Chandlee,Thomas K. Hodges, RTS, a rice anther-specific gene is required for male fertility and its promoter sequence directs tissue-specific gene expression in different plant species. Plant Molecular Biology, 2006, 62(3): 397-408.
 ==Structured Information==