Os01g0968800 - Revision history

192.168.72.52 at 05:09, 14 May 2015

2015-05-14T05:09:54Z

Biolizhen at 07:41, 7 June 2014

2014-06-07T07:41:19Z

Biolizhen at 07:34, 7 June 2014

2014-06-07T07:34:19Z

Biolizhen at 07:25, 7 June 2014

2014-06-07T07:25:01Z

Biolizhen at 07:02, 7 June 2014

2014-06-07T07:02:45Z

Biolizhen at 06:46, 7 June 2014

2014-06-07T06:46:52Z

Biolizhen at 06:35, 7 June 2014

2014-06-07T06:35:57Z

Biolizhen at 05:10, 7 June 2014

2014-06-07T05:10:14Z

Biolizhen at 04:28, 7 June 2014

2014-06-07T04:28:32Z

Biolizhen at 03:16, 7 June 2014

2014-06-07T03:16:30Z

← Older revision		Revision as of 05:09, 14 May 2015
Line 44:		Line 44:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 1]]
−	~~GeneName = Os01g0968800\|~~
−	~~Description = Similar to Dehydration responsive element binding protein 1F (DREB1F protein)\|~~
−	~~Version = NM_001052056.1 GI:115442482 GeneID:4323832\|~~
−	~~Length = 840 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os01g0968800, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 1\|Chromosome 1]]\|~~
−	~~AP = Chromosome 1:44522272..44523111\|~~
−	~~CDS = 44522341..44523000\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008394:44522272..44523111~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008394:44522272..44523111~~
−	~~source=RiceChromosome01~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactga</cdnaseq>\|
−	AA = <aaseq>MDTEDTSSASSSSVSPPSSPGGGHHHRLPPKRRAGRKKFRETRH PVYRGVRARAGGSRWVCEVREPQAQARIWLGTYPTPEMAARAHDVAAIALRGERGAEL NFPDSPSTLPRARTASPEDIRLAAAQAAELYRRPPPPLALPEDPQEGTSGGGATATSG RPAAVFVDEDAIFDMPGLIDDMARGMMLTPPAIGRSLDDWAAIDDDDDHYHMDYKLWM D</aaseq>\|
−	DNA = <dnaseqindica>70..729#ccctcctctcatcgcaccaccacgccactgagctcaagctaagctaagtgctaacctaggtgttcgaccatggacaccgaggacacgtcgtcggcttcgtcctcgtcggtgtcgccgccgtcgtcgccgggcggcgggcaccaccaccggctgccgccgaagcggcgggcggggcggaagaaattccgggagacgcggcacccggtgtaccgcggcgtgcgcgcgcgggcgggggggagcaggtgggtgtgcgaggtgcgcgagccgcaggcgcaggcgcgcatctggctcggcacctacccgacgccggagatggcggcgcgcgcgcacgacgtcgcggccatcgccctccgcggcgagcgcggcgccgagctcaacttcccggactccccctccacgctcccgcgcgcgcgcacggcgtcgcccgaggacatccgcctcgccgccgcgcaggccgccgagctgtaccgccgcccgccgccgccgctggcattgccggaggatccgcaggaaggcacgagcggcggcggcgccaccgccacctcggggcgtccggctgccgtgttcgtggacgaggacgccatcttcgacatgccggggctgatcgacgacatggcgagggggatgatgctgacgccgccggcgattgggagatctctcgacgactgggccgccatcgacgacgacgatgaccattaccacatggactacaagctatggatggactgacatgtatacacacatatcgttcgagtatatatgcttacagatatagataatactccatcagttcctactaaatacggagtatatatttttagataaaggatttatataaaa</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052056.1 RefSeq:Os01g0968800]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 1]]~~
−	~~[[Category:~~Chromosome 1]]

@@ Line 29: / Line 29: @@
 ==Labs working on this gene==
-Please input related labs here.
+*State Key Laboratory of Plant Genomics and National Centre for Plant Gene Research (Beijing), Institute of Genetics and Developmental Biology, Chinese     Academy of Sciences (CAS)
 ==References==

← Older revision		Revision as of 07:34, 7 June 2014
Line 8:		Line 8:

	===Expression===		===Expression===
		+	[[File: tissue.png\|right\|thumb\|150px\|''The organ-specific expression of OsDREB1F. 1 to 6 represents the young roots, young leaves,mature roots, mature leaves, spike and the callus, respectively. (from reference <ref name="ref1" />).'']]
		+
		+	[[File: condition.png\|right\|thumb\|150px\|''OsDREB1F expression patterns in response to various treatments (from reference <ref name="ref1" />).'']]
		+
	OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues. <ref name="ref1"/>		OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues. <ref name="ref1"/>

← Older revision		Revision as of 07:25, 7 June 2014
Line 16:		Line 16:

	===Evolution===		===Evolution===
		+	[[File: OsDREB1F evolution.png\|right\|thumb\|150px\|''The comparison of OsDREB1F and other AP2/EREBP proteins (from reference <ref name="ref1" />).'']]
		+
		+
	DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively<ref name="ref3"/>.		DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element binding proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively<ref name="ref3"/>.

@@ Line 3: / Line 3: @@
 ==Annotated Information==
 ===Function===
-Dimerization is one of the most distinct characteristics of TFs, OsDREB1F was indicates that can form homodimeric complex by using two-hybrid system. So OsDREB1F was a transactivator, and the transactivation domain located in the C-terminal of OsDREB1F as well. It plays a key role in plant stress signalling transduction pathway which can specifically bind to DRE/CRT element (G/ACCGAC) and activate the expression of many stress inducible genes. Additionaly,OsDREB1F localizes in nucleus.<ref name="ref1"/>
+Dimerization is one of the most distinct characteristics of TFs, OsDREB1F was indicates that can form homodimeric complex by using two-hybrid system. So OsDREB1F was a transactivator, and the transactivation domain located in the C-terminal of OsDREB1F as well. It plays a key role in plant stress signalling transduction pathway which can specifically bind to DRE/CRT element (G/ACCGAC) and activate the expression of many stress inducible genes. Additionaly,OsDREB1F localizes in nucleus.
 ===Expression===
-OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues.
+OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues. <ref name="ref1"/>
 ===Evolution===

@@ Line 6: / Line 6: @@
 ===Expression===
-Please input expression information here.
+OsDREB1F was constitutively expressed in almost all the tissues and organs examined, including the young leaves, young roots, mature leaves, mature roots, young panicles and callus, and the expression is higher in panicles and callus than in the other tissues.
 ===Evolution===
-DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element  binding  proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, i.e. ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively.<ref name="ref3"/>
+DREB/CBF is one prominent class of transcription factors, which binds to the stress responsive cis-acting elements. DREB/CBF belongs to the ERF(ethylene responsive element binding factors) family of transcription factors. And ERF proteins are a subfamily of the APETLA2 (AP2)/ethylene responsive element  binding  proteins (EREBP), which are characteristics of plants. The ERF family comprises two subfamilies, the EREBP (single AP2 domain) and AP2/family (two copies of AP2). The EREBP subfamily is further divided into two classes, ERFs and DREBs/CBFs. ERFs bind to the GCCbox found in the promoters of many pathogenesis-related (PR) genes conferring ethylene responsiveness, while DREBs/CBFs bind to the dehydration responsive element (DRE/CRT) in the promoters of cold and dehydration responsive LEA genes including rd29A, rd17, cor6.6, cor15a, erd10 and kin1. The DREBs/CBFs are further divided into two subclasses, DREB1/CBF and DREB2, induced by cold and dehydration stress respectively<ref name="ref3"/>.
 You can also add sub-section(s) at will.

← Older revision		Revision as of 03:16, 7 June 2014
Line 21:		Line 21:
	<ref name="ref2">Donghai Mao,Caiyan Chen.(2012) Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway,PLoS ONE,7(10): e47275.</ref>		<ref name="ref2">Donghai Mao,Caiyan Chen.(2012) Colinearity and Similar Expression Pattern of Rice DREB1s Reveal Their Functional Conservation in the Cold-Responsive Pathway,PLoS ONE,7(10): e47275.</ref>
	<ref name="ref3">Mohammad Sayyar Khan.(2011)THE ROLE OF DREB TRANSCRIPTION FACTORS IN ABIOTIC STRESS TOLERANCE OF PLANTS,Biotechnol.2433-2442</ref>		<ref name="ref3">Mohammad Sayyar Khan.(2011)THE ROLE OF DREB TRANSCRIPTION FACTORS IN ABIOTIC STRESS TOLERANCE OF PLANTS,Biotechnol.2433-2442</ref>
		+	</references>