Os02g0110200 - Revision history

Xysj2017 at 09:25, 14 February 2017

2017-02-14T09:25:19Z

Xysj2017: /* Evolution */

2017-02-14T09:24:26Z

‎Evolution

Xysj2017 at 09:23, 14 February 2017

2017-02-14T09:23:51Z

192.168.72.52 at 06:24, 14 May 2015

2015-05-14T06:24:11Z

Ibpfdd: /* Expression */

2014-06-09T01:06:59Z

‎Expression

Ibpfdd: /* Function */

2014-06-09T01:06:18Z

‎Function

Ibpfdd: /* Evolution */

2014-06-02T15:17:42Z

‎Evolution

Ibpfdd: /* Evolution */

2014-06-02T15:17:08Z

‎Evolution

Ibpfdd: /* Evolution */

2014-06-02T15:16:35Z

‎Evolution

Ibpfdd: /* Evolution */

2014-06-02T15:15:58Z

‎Evolution

@@ Line 2: / Line 2: @@
 The rice OsHPL3 gene is also known as CYP74B2 and similar to Hydroperoxide lyase.
 ==Annotated Information==
 ===Function===
 * '''''OsHPL3''''' is a hydroperoxide lyase gene． GLV，the product of OsHPL3，play an important role in the flee resistance to WBPH.
 * OsHPL3 encodes a lipid hydroperoxide lyase, CYP74B2, which mediates plant specific defense responses.

@@ Line 19: / Line 19: @@
 * OsHPL3 shares limited homology with other HPLs, including OsHPL1, OsHPL2 and an Arabidopsis HPL that modulates biosynthesis of GLVs and JA in Arabidopsis and tobacco.
 * OsHPL3 has intrinsic HPL activity, metabolizing hydroperoxylinolenic acid to produce GLVs in planta. Loss of OsHPL3function results in increased resistance to the chewing herbivore SSB but enhanced susceptibility to the phloem-feeding herbivore BPH. Interestingly, thehpl3-1plants also exhibited increased attractiveness to the BPH parasitoid A. nilaparvatae.
 * These data strongly suggest that, as an HPL, OsHPL3 is an important player in modulating rice direct and indirect defense responses specifically against different invaders by modulating the oxylipin pathway. [1]
 ==Labs working on this gene==

@@ Line 4: / Line 4: @@
 ===Function===
-OsHPL3 is a hydroperoxide lyase gene．Expression levels of OsHPL3 could be significantly enhanced by mechanical wounding，SSB，BPH and WBPH infestation, whereas exogenous hormones JA and SA treatment had no significant effect. GLV，the product of OsHPL3，play an important role in the flee resistance to WBPH. OsHPL3 encodes a lipid hydroperoxide lyase, CYP74B2, which mediates plant specific defense responses. In addition, OsHPL3 plays an important role in normal rice growth and development. [1-4]
+* '''''OsHPL3''''' is a hydroperoxide lyase gene． GLV，the product of OsHPL3，play an important role in the flee resistance to WBPH.
-The loss-of-function mutant hpl3-1 produced disease-resembling lesions spreading through the whole leaves. A biochemical assay revealed that OsHPL3 possesses intrinsic HPL activity, hydrolyzing hydroperoxylinolenic acid to produce GLVs. OsHPL3 positively modulates resistance to the rice brown planthopper, but negatively modulates resistance to the rice striped stem borer. OsHPL3, by affecting the levels of JA, GLVs and other volatiles, modulates rice-specific defense responses against different invaders. OsHPL3 positively modulates the production of GLVs but negatively affects other volatiles and TrypPI activity as well as JA biosynthesis through substrate competition. OsHPL3 acts as a negative regulator of plant resistance to the chewing herbivore SSB, but a positive regulator of defense against the phloem feeder BPH. OsHPL3 also functions in indirect resistance to BPH through attractiveness to Anagrus nilaparvatae, an egg parasitoid of BPH. We propose that OsHPL3 modulates rice direct and indirect defense responses by affecting the levels of JA and GLVs. [1]
+* OsHPL3 encodes a lipid hydroperoxide lyase, CYP74B2, which mediates plant specific defense responses.
-OsHPL3 shares limited homology with other HPLs, including OsHPL1, OsHPL2 and an Arabidopsis HPL that modulates biosynthesis of GLVs and JA in Arabidopsis and tobacco.  OsHPL3 has intrinsic HPL activity, metabolizing hydroperoxylinolenic acid to produce GLVs in planta. Loss of OsHPL3function results in increased resistance to the chewing herbivore SSB but enhanced susceptibility to the phloem-feeding herbivore BPH. Interestingly, thehpl3-1plants also exhibited increased attractiveness to the BPH parasitoid A. nilaparvatae. These data strongly suggest that, as an HPL, OsHPL3 is an important player in modulating rice direct and indirect defense responses specifically against different invaders by modulating the oxylipin pathway. [1]
+* In addition, OsHPL3 plays an important role in normal rice growth and development. [1-4]
-OsHPL3 transcripts are known to be upregulated in response to wounding[2], suggesting that OsHPL3 plays an important role in wound signaling. OsHPL3 is wound-inducible and exclusively expressed in leaves. In contrast, OsHPL1 and OsHPL2 are not wound induced. OsHPL3 is the major wound-induced HPL in rice leaves. Interestingly, mutation in OsHPL3 also creates plants with enhanced resistance to bacterial blight and enhanced expression of PR genes[1].
+* OsHPL3 transcripts are known to be upregulated in response to wounding[2], suggesting that OsHPL3 plays an important role in wound signaling. OsHPL3 is wound-inducible and exclusively expressed in leaves. In contrast, OsHPL1 and OsHPL2 are not wound induced.
 ===Expression===
+* Expression levels of OsHPL3 could be significantly enhanced by mechanical wounding，SSB，BPH and WBPH infestation, whereas exogenous hormones JA and SA treatment had no significant effect.
 ===Evolution===
+* OsHPL3 shares limited homology with other HPLs, including OsHPL1, OsHPL2 and an Arabidopsis HPL that modulates biosynthesis of GLVs and JA in Arabidopsis and tobacco.
-The rice OsHPL3 gene is also known as CYP74B2 and similar to Hydroperoxide lyase.
+* OsHPL3 has intrinsic HPL activity, metabolizing hydroperoxylinolenic acid to produce GLVs in planta. Loss of OsHPL3function results in increased resistance to the chewing herbivore SSB but enhanced susceptibility to the phloem-feeding herbivore BPH. Interestingly, thehpl3-1plants also exhibited increased attractiveness to the BPH parasitoid A. nilaparvatae.
-Search for the theme “OsHPL3” on web of science. The total is four related references. And the Citation Report is as follows(Fig3a, Fig3b). It shows that the study of OsHPL3 gene was started at the year of 2006. And the study is sustainable development and rises sharply in recent two years.
+* These data strongly suggest that, as an HPL, OsHPL3 is an important player in modulating rice direct and indirect defense responses specifically against different invaders by modulating the oxylipin pathway. [1]

← Older revision		Revision as of 06:24, 14 May 2015
Line 45:		Line 45:

	==Structured Information==		==Structured Information==
−	~~{{JaponicaGene\|~~	+	[[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]]
−	~~GeneName = Os02g0110200\|~~
−	~~Description = Similar to Hydroperoxide lyase\|~~
−	~~Version = NM_001052183.1 GI:115443736 GeneID:4328040\|~~
−	~~Length = 1742 bp\|~~
−	~~Definition = Oryza sativa Japonica Group Os02g0110200, complete gene.\|~~
−	~~Source = Oryza sativa Japonica Group~~
−
−	~~ORGANISM Oryza sativa Japonica Group~~
−	~~Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;~~
−	~~Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP~~
−	~~clade; Ehrhartoideae; Oryzeae; Oryza.~~
−	\|
−	~~Chromosome = [[:category:Japonica Chromosome 2\|Chromosome 2]]\|~~
−	~~AP = Chromosome 2:554579..556320\|~~
−	~~CDS = 554635..556098\|~~
−	~~GCID = <gbrowseImage1>~~
−	~~name=NC_008395:554579..556320~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage1>\|~~
−	~~GSID = <gbrowseImage2>~~
−	~~name=NC_008395:554579..556320~~
−	~~source=RiceChromosome02~~
−	~~preset=GeneLocation~~
−	~~</gbrowseImage2>\|~~
−	CDNA = <cdnaseq>atggtgccgtcgttcccgcagccggccagtgcggcggcggcgacgcggccaataccggggagctacggcccgccgctgctcggcccgctccgcgaccgcctcgactacttctggttccagggccccgacgacttcttccgccgccgcgccgccgaccacaagagcaccgtgttccgcgccaacatcccgcccaccttccccttcttcctcggcgtcgacccgcgcgtcgtcgccgtcgttgatgccgccgccttcaccgcgctcttcgacccggccctcgtcgacaagcgcgacgtcctcatcggcccctacgtccccagcctcgccttcacccgcggcacccgcgtcggcgtctacctcgacacccaggaccccgaccacgcccgcaccaaggccttctccatcgacctcctccgccgcgccgcccgcaactgggccgccgagctccgcgccgccgtcgacgacatgctcgccgccgtcgaggaagacctcaacagggcccctgaccccgccgccgcctccgccagctacctcatcccgctccagaagtgcatcttccgcttcctctgcaaggcgctcgtcggcgccgacccggcggcggacggcctcgtcgaccgcttcggcgtgtacatcctcgacgtgtggctggcgttgcagctggtgccgacgcagaaggtgggcgtcatcccgcagccgctggaggagctcctgctccactccttcccgctgccgtcgttcgtcgtcaagcccgggtacgacctcctctaccgcttcgtggagaagcacggcgccgccgccgtgtccatcgctgagaaggagcacggcatcagcaaggaggaggccatcaacaacatcctcttcgtgctcggcttcaacgcgttcggcggcttctcggtgttcctgccgttcctggtcatggaggtcggcaagcccggccgggacgacctgcggcggcggctgcgggaggaggtgcgccgcgtgctgggcggcggcgacggcggcgaggccgggttcgcggcggtgagggagatggcgctggtgcggtcgacggtgtacgaggtgctccggatgcagccgccggtgccgctgcagttcgggcgggcgcggcgagacttcgtgctgcggtcgcacggcggcgcggcgtacgaggtgggcaagggcgagctgctgtgcgggtaccagccgctggccatgcgcgacccggcggtgttcgaccggccggaggagttcgtgccggagaggttcctcggcgacgacggcgaggcgctgctgcagtacgtgtactggtccaacgggccggagaccggcgagccgtcgccggggaacaaacagtgtgccgccaaggaggtggtcgtcgccaccgcgtgcatgctcgtcgccgagcttttccggcggtacgacgacttcgaatgcgacggcacctccttcaccaagctcgacaagcgggagctcactcccagctaa</cdnaseq>\|
−	AA = <aaseq>MVPSFPQPASAAAATRPIPGSYGPPLLGPLRDRLDYFWFQGPDD FFRRRAADHKSTVFRANIPPTFPFFLGVDPRVVAVVDAAAFTALFDPALVDKRDVLIG PYVPSLAFTRGTRVGVYLDTQDPDHARTKAFSIDLLRRAARNWAAELRAAVDDMLAAV EEDLNRAPDPAAASASYLIPLQKCIFRFLCKALVGADPAADGLVDRFGVYILDVWLAL QLVPTQKVGVIPQPLEELLLHSFPLPSFVVKPGYDLLYRFVEKHGAAAVSIAEKEHGI SKEEAINNILFVLGFNAFGGFSVFLPFLVMEVGKPGRDDLRRRLREEVRRVLGGGDGG EAGFAAVREMALVRSTVYEVLRMQPPVPLQFGRARRDFVLRSHGGAAYEVGKGELLCG YQPLAMRDPAVFDRPEEFVPERFLGDDGEALLQYVYWSNGPETGEPSPGNKQCAAKEV VVATACMLVAELFRRYDDFECDGTSFTKLDKRELTPS</aaseq>\|
−	DNA = <dnaseqindica>57..1520#ataacgcaagctaccacacgtagctgataagtccgatcgtcgccgcgcgccgcgccatggtgccgtcgttcccgcagccggccagtgcggcggcggcgacgcggccaataccggggagctacggcccgccgctgctcggcccgctccgcgaccgcctcgactacttctggttccagggccccgacgacttcttccgccgccgcgccgccgaccacaagagcaccgtgttccgcgccaacatcccgcccaccttccccttcttcctcggcgtcgacccgcgcgtcgtcgccgtcgttgatgccgccgccttcaccgcgctcttcgacccggccctcgtcgacaagcgcgacgtcctcatcggcccctacgtccccagcctcgccttcacccgcggcacccgcgtcggcgtctacctcgacacccaggaccccgaccacgcccgcaccaaggccttctccatcgacctcctccgccgcgccgcccgcaactgggccgccgagctccgcgccgccgtcgacgacatgctcgccgccgtcgaggaagacctcaacagggcccctgaccccgccgccgcctccgccagctacctcatcccgctccagaagtgcatcttccgcttcctctgcaaggcgctcgtcggcgccgacccggcggcggacggcctcgtcgaccgcttcggcgtgtacatcctcgacgtgtggctggcgttgcagctggtgccgacgcagaaggtgggcgtcatcccgcagccgctggaggagctcctgctccactccttcccgctgccgtcgttcgtcgtcaagcccgggtacgacctcctctaccgcttcgtggagaagcacggcgccgccgccgtgtccatcgctgagaaggagcacggcatcagcaaggaggaggccatcaacaacatcctcttcgtgctcggcttcaacgcgttcggcggcttctcggtgttcctgccgttcctggtcatggaggtcggcaagcccggccgggacgacctgcggcggcggctgcgggaggaggtgcgccgcgtgctgggcggcggcgacggcggcgaggccgggttcgcggcggtgagggagatggcgctggtgcggtcgacggtgtacgaggtgctccggatgcagccgccggtgccgctgcagttcgggcgggcgcggcgagacttcgtgctgcggtcgcacggcggcgcggcgtacgaggtgggcaagggcgagctgctgtgcgggtaccagccgctggccatgcgcgacccggcggtgttcgaccggccggaggagttcgtgccggagaggttcctcggcgacgacggcgaggcgctgctgcagtacgtgtactggtccaacgggccggagaccggcgagccgtcgccggggaacaaacagtgtgccgccaaggaggtggtcgtcgccaccgcgtgcatgctcgtcgccgagcttttccggcggtacgacgacttcgaatgcgacggcacctccttcaccaagctcgacaagcgggagctcactcccagctaagctttgctgccgccattctctcactcgatctccatgcacatatgcatgaagaaattaattaaattcaagttgctagctccattttttctctttgagctgctgataaaaaaaacatctctattcttctgtgcaataagccaataattaagcattaatcagagcgtacaagtaaaaattgttttcactgttttatgtggatatatatatgtacagggatccacc</dnaseqindica>\|
−	~~Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001052183.1 RefSeq:Os02g0110200]\|~~
−	}}
−	[[Category:Genes]]
−	~~[[Category:Japonica mRNA]]~~
−	[[Category:Oryza Sativa Japonica Group]]
−	[[Category:Japonica ~~Genes]]~~
−	~~[[Category:Japonica Chromosome 2]]~~
−	~~[[Category:~~Chromosome 2]]

@@ Line 11: / Line 11: @@
 ===Expression===
-Sequencing the candidates revealed that Os02g0110200, which encodes an HPL (OsHPL3, accession number AY340220) with 487 amino acids, was disrupted by insertion of a transposon-like element of approximately 700 bp between nucleotides 518 and 519. The insertion probably results in loss of Os02g0110200 functions, as its transcripts and encoded products were undetectable inhpl3-1. Furthermore, a complementation construct containing the WT OsHPL3genomic region with its own promoter complemented thehpl3-1 phenotypes, confirming that the mutation in OsHPL3 is responsible for the mutant phenotypes.
+Sequencing the candidates revealed that Os02g0110200, which encodes an HPL (OsHPL3, accession number AY340220) with 487 amino acids, was disrupted by insertion of a transposon-like element of approximately 700 bp between nucleotides 518 and 519. The insertion probably results in loss of Os02g0110200 functions, as its transcripts and encoded products were undetectable inhpl3-1. Furthermore, a complementation construct containing the WT OsHPL3genomic region with its own promoter complemented thehpl3-1 phenotypes, confirming that the mutation in OsHPL3 is responsible for the mutant phenotypes. [1,2]
 ===Evolution===

@@ Line 21: / Line 21: @@
-a
+Fig.3a
 [[File:3a.jpeg]]
-b
+Fig.3b
 [[File:OsHPL3-2.jpg]]
 (June 2, 2014)

← Older revision		Revision as of 15:16, 2 June 2014
Line 21:		Line 21:


−	3a[[File:3a.jpeg]]3b[[File:OsHPL3-2.jpg]]	+	3a 3b
		+	[[File:3a.jpeg]] [[File:OsHPL3-2.jpg]]
	(June 2, 2014)		(June 2, 2014)